von Willebrand factor A domain-containing protein 3A

Overview
Namevon Willebrand factor A domain-containing protein 3A
Smed IDSMED30034618
Length (bp)4287
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of von Willebrand factor A domain-containing protein 3A (SMED30034618) t-SNE clustered cells

Violin plots show distribution of expression levels for von Willebrand factor A domain-containing protein 3A (SMED30034618) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of von Willebrand factor A domain-containing protein 3A (SMED30034618) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for von Willebrand factor A domain-containing protein 3A (SMED30034618) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034618

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30034618SMESG000022334.1 SMESG000022332.1 SmedASXL_017519SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30034618SMESG000022334.1 SMESG000022332.1 dd_Smed_v4_10972_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034618SMESG000022334.1 SMESG000022332.1 dd_Smed_v4_10972_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034618SMESG000022334.1 SMESG000022332.1 dd_Smed_v4_10972_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034618SMESG000022334.1 SMESG000022332.1 dd_Smed_v4_10972_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30034618SMESG000022334.1 SMESG000022332.1 dd_Smed_v6_10972_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30034618SMESG000022332.1 Contig34102uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30034618SMESG000022332.1 Contig34102newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30034618SMESG000022334.1 SMESG000022332.1 dd_Smed_v4_10972_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Human
Match: VWA3A (von Willebrand factor A domain containing 3A [Source:HGNC Symbol;Acc:HGNC:27088])

HSP 1 Score: 488.419 bits (1256), Expect = 7.978e-150
Identity = 292/798 (36.59%), Postives = 446/798 (55.89%), Query Frame = 3
Query: 1860 NILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYPPSHSKK---NEDIIKNAVELCRRNSSDNMVALMPPRQTSLSKARLKYLSDKTEENLKIPKTLAYKSDIDPRKSIT--NSKPPYRPVIQS--------------AFYTEDKNSKGVVYRDYPGQNMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQDRTTVAADLLS---IDPHYPPLPNLEGDDLVRLAKEIQLTRENLAKINYFRQLHIQLQK 4187
             +L+ NA+    EF+P + + V+S+++EKAMIQ EW DG+V+N+H D   L++YQ+ L   +++ E+RI WLS  SRRI+GT+ E++V+++LD+S +N  Y++HI  SL++L+++QL  KD FN+IAF +TI S++  +  V+  NLQ +W W  +L C GSRN+L AL+   E          +QGIYLFT G+PDQ +  L AY+ E   G D++++  LF V +  +  TP P+RYA+ T TA   + +  +  GRFHWF ++GI ESDDI  +M+E++ A+ YS++   ++   K     +HS K   +  + K   +  +  S      L PPR T    AR+    D   E     K+L ++  +  R  I+   ++P    +++                FYTE  N  G VY+ YP Q    RR      +P K+   +S++W+ KY LK + L++ R + GP C H+++     ++   AK+C+ +FP V + G  +H+Q+T  E+  Y    +K L RY++RL+WL+  S+R+FG + E+ V ILLDTSGSM P++ ++   L  LIWEQL K   S+N+++F    + +++ LV   +++CH A+ W  HL A G+T   +ALL       ++G+YLLTDGKPD S  +VL  VQ +   R  KV  HTIS NC D +A EFL++LA  + GRYH                                +D  +    LL+   I+   P LP  EGDDL  LA+EI   R  L +   FR    QLQK
Sbjct:  425 QVLAPNAFSPVEEFVPILQKTVSSTIHEKAMIQFEWHDGTVKNIHVDPPFLYKYQQQLSRAMRMYERRIEWLSLASRRIWGTVCEKRVVVLLDISATNSMYIIHIQHSLRLLLEEQLSNKDCFNLIAFGSTIESWRPEMVPVSHNNLQSAWRWALNLRCRGSRNVLSALRKAVEVDFKDKDKHQSQGIYLFTGGIPDQDMPTLSAYMAEACGGCDLQLNVCLFYVGEPKMDTTP-PARYASHTDTAAAYKEVTRAAGGRFHWFGDTGIYESDDINSIMSEMEKALNYSQKCAFLMASLK-----NHSGKVLGSSALPKEKPKTLQLRSQPK--KLCPPRPTVPLGARMSIKDDPDREKSPPLKSLKWRP-LSSRVGISPAAAQPTKEGMMELRRKTKSREAETSLLLFYTEKGNDVGSVYKKYP-QGRGLRRTSSSIDLPRKDTVCSSQEWVAKYGLKKLKLEISRCM-GPNCTHQKSG----QRSASAKHCS-IFPSVEIHGVVRHIQWTPREMEVYIRHLEKVLRRYVQRLQWLLSGSRRLFGTVLESKVCILLDTSGSMGPYLQQVKTELVLLIWEQLRKCCDSFNLLSFAESFQSWQDTLVETTDAACHEAMQWVTHLQAQGSTSILQALLKAFSFHDLEGLYLLTDGKPDTSCSLVLNEVQKLREKRDVKV--HTISLNCSDRAAVEFLRKLASFTGGRYH----------------------------CPVGEDTLSKIHSLLTKGFINEKDPTLPPFEGDDLRILAQEITKARSFLWQAQSFRS---QLQK 1173          

HSP 2 Score: 227.254 bits (578), Expect = 1.052e-59
Identity = 131/375 (34.93%), Postives = 207/375 (55.20%), Query Frame = 3
Query:  390 KVKNFEIIDRNKKYYPPNQFTVTSINQAHDLLRVQNNPAVSGDEQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEW 1514
            K KN   + +N      N   VT +NQ  DLLR+Q +   S D + SEDWL  H+L   +LT+ DLIS+G        E+       + +   I+  +E KL   IE+Y +RI+W  + S+K FG + G+++++LID S  + G  +   FQ +L+ L+DEQL  K+ + +  FGTN   L+ D M ++   ++E+K    T+   GG NL+QALK +   K +D ++ I+ SCPDQ +++L  ++QQ  +GRDL  H ++Y    +   ++LK +A    G YH YS   E   YTS D+D LL EI++ Q +L  ++ ++        +  + +I+ E+ N P    LPKP   + PL  E P  + +TS+EW
Sbjct:   48 KQKNMNGLGQNSD----NGLLVTHVNQTQDLLRLQGSETQSSDWEDSEDWLSAHSLKCQKLTLADLISQGT----EVLEEGTNVVQKICFSTQIIRHFESKLSDTIEVYQERIQWLTENSKKAFGLIKGARVSILIDVSAISSGPQKE-EFQKDLMSLIDEQLSHKEKLFVLSFGTNAGSLWPDPMEVSASTLQELKLWVKTLQPDGGSNLLQALKKIFTLKGLDSLVAIMRSCPDQPSEILSDYIQQSTMGRDLIIHFITYRCDDQMPPAVLKNLAEAVRGYYHCYSPKMEH--YTSRDMDELLAEIQKAQSLLSHVQALQHSSPCEALTCTMEEISTEITNGPLISLLPKPPKHDAPLTIEFPNLD-KTSAEW 410          

HSP 3 Score: 140.969 bits (354), Expect = 5.599e-33
Identity = 186/782 (23.79%), Postives = 331/782 (42.33%), Query Frame = 3
Query:  633 GTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALK------YVTKEKSIDE-VLLILGSCPDQEAKMLMYFVQQLLLGRDLPFH-CVSYETQSE-------------EVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRG-------IFSNRASPYINQIAEELKNIPQSENLPKP-------ISF-NDPLKFEVPKFEPRTSSEWXXXXXXXXXXXXXYSKNILSATMANNFERNPTSYPVIEMSDVFPLRESN------FTRDAN----ISRKSIQGR---RFSSTISKPVKSRISQILTIDNLKEFSQFGSEFEGIKESTDEKRFIEMFTENILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXX-XXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHW------------FRESGII----------ESDDIRVLMAEIDLAVEYSRRTQQIINDYKEK 2762
            GT  N  V   F+   Y+ +L  A+ MY +RI+W    SR+++G V   ++ VL+D S  N  +  +I  Q +L  LL+EQL  K   N+  FG+  +    + + ++   ++        +   G  N++ AL+      +  K+K   + + L  G  PDQ+   L  ++ +   G DL  + C+ Y  + +             + ++  K +   + G +H +       +Y S+DI+ ++ E+E+     +K   +          +  + A P       +L++ P+    P+P       +S  +DP + + P   P  S +W   S          S+  +S   A      PT   ++E+      RE+       +T   N    + +K  QGR   R SS+I  P K         D +    ++ +++ G+K+       +++     +  N    KS      G+   S+ +      VE   G VR++     ++  Y + L + ++   QR+ WL +GSRR+FGT++E KV ++LD S S   YL  +   L +LI +Q  K  D FN+++F+ +  S++  L    +    ++  W+  L   GS ++L AL   F     S H+   +G+YL T G PD     ++  +++     D+K+HT+  N  D          R A      E +R LA  T GR+H                 G I          E DD+R+L  EI  A  +  + Q   +  ++K
Sbjct:  463 GTVKNIHVDPPFLY-KYQQQLSRAMRMYERRIEWLSLASRRIWGTVCEKRVVVLLDISATNSMY--IIHIQHSLRLLLEEQLSNKDCFNLIAFGSTIESWRPEMVPVSHNNLQSAWRWALNLRCRGSRNVLSALRKAVEVDFKDKDKHQSQGIYLFTGGIPDQDMPTLSAYMAEACGGCDLQLNVCLFYVGEPKMDTTPPARYASHTDTAAAYKEVTRAAGGRFHWFGDTG---IYESDDINSIMSEMEKALNYSQKCAFLMASLKNHSGKVLGSSALPKEKPKTLQLRSQPKKLCPPRPTVPLGARMSIKDDPDREKSP---PLKSLKWRPLS----------SRVGISPAAAQ-----PTKEGMMELRRKTKSREAETSLLLFYTEKGNDVGSVYKKYPQGRGLRRTSSSIDLPRK---------DTVCSSQEWVAKY-GLKK-------LKLEISRCMGPNCTHQKS------GQRSASAKHCSIFPSVE-IHGVVRHIQWTPREMEVYIRHLEKVLRRYVQRLQWLLSGSRRLFGTVLESKVCILLDTSGSMGPYLQQVKTELVLLIWEQLRKCCDSFNLLSFAESFQSWQDTLVETTDAACHEAMQWVTHLQAQGSTSILQALLKAF-----SFHD--LEGLYLLTDGKPDTSCSLVLNEVQKLREKRDVKVHTISLNCSD----------RAA-----VEFLRKLASFTGGRYHCPVGEDTLSKIHSLLTKGFINEKDPTLPPFEGDDLRILAQEITKARSFLWQAQSFRSQLQKK 1174          

HSP 4 Score: 71.633 bits (174), Expect = 1.160e-11
Identity = 55/255 (21.57%), Postives = 113/255 (44.31%), Query Frame = 3
Query:  525 SSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTD--------------YEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFK-KKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYH 1244
            SS++W+  + L  L+L I   +      + +  +++ +A +C ++    +                Y   L   +  Y +R++W L GSR++FG V  SK+ +L+D+S +   + + +  +  L+ L+ EQL K   S N+  F  + +      +        E  +  + + + G  +++QAL        ++ + L+    PD    +++  VQ+L   RD+  H +S           L+ +A+ + G YH
Sbjct:  861 SSQEWVAKYGLKKLKLEISRCMGPN-CTHQKSGQRSASAKHCSIFPSVEIHGVVRHIQWTPREMEVYIRHLEKVLRRYVQRLQWLLSGSRRLFGTVLESKVCILLDTSGSMGPYLQQV--KTELVLLIWEQLRKCCDSFNLLSFAESFQSWQDTLVETTDAACHEAMQWVTHLQAQGSTSILQALLKAFSFHDLEGLYLLTDGKPDTSCSLVLNEVQKLREKRDVKVHTISLNCSDRAAVEFLRKLASFTGGRYH 1112          

HSP 5 Score: 70.0922 bits (170), Expect = 3.019e-11
Identity = 66/283 (23.32%), Postives = 121/283 (42.76%), Query Frame = 3
Query: 3132 EWITSKDWMKKYSLKNMGLDLLRLVS-GPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSG-SMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQ 3974
            +W  S+DW+  +SLK   L L  L+S G E   E   ++        K C                 ++   +  +  +    +  Y +R++WL  +SK+ FG+I    V+IL+D S  S  P   E   +L +LI EQL  ++  + +++F +         +    S+      W + L   G ++  +AL        +  +  +    PD  +EI+   +Q   S+    + IH I++ C+D+     LK LA    G YH  C+   +  ++ R +++
Sbjct:   86 DWEDSEDWLSAHSLKCQKLTLADLISQGTEVLEEGTNVV-------QKIC-----------------FSTQIIRHFESKLSDTIEVYQERIQWLTENSKKAFGLIKGARVSILIDVSAISSGPQKEEFQKDLMSLIDEQLSHKEKLF-VLSFGTNAGSLWPDPMEVSASTLQELKLWVKTLQPDGGSNLLQALKKIFTLKGLDSLVAIMRSCPDQPSEILSDYIQQ--STMGRDLIIHFITYRCDDQMPPAVLKNLAEAVRGYYH--CYSPKMEHYTSRDMDE 339          

HSP 6 Score: 67.0106 bits (162), Expect = 3.172e-10
Identity = 72/286 (25.17%), Postives = 130/286 (45.45%), Query Frame = 3
Query: 2019 YQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLS-ISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFE-NPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIE---SDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYPPSHSKKNEDIIKNAVELCRRNSSDNMVALMP 2861
            ++  L + +++ ++RI WL+  S++ FG I   +V +++D+S IS+        + L  LI +QL  K+K  +++F     S       V+ + LQ+   W+++L   G  NLL ALK +F    +DS        +       PDQ  E L  YI++  +G D+ IH + +  DD       +P           +++ LA + +G +H +  S  +E   S D+  L+AEI  A       Q +           HS   E +     E+    ++  +++L+P
Sbjct:  137 FESKLSDTIEVYQERIQWLTENSKKAFGLIKGARVSILIDVSAISSGPQKEEFQKDLMSLIDEQLSHKEKLFVLSFGTNAGSLWPDPMEVSASTLQELKLWVKTLQPDGGSNLLQALKKIFTLKGLDS--------LVAIMRSCPDQPSEILSDYIQQSTMGRDLIIHFITYRCDDQ------MP---------PAVLKNLAEAVRGYYHCY--SPKMEHYTSRDMDELLAEIQKAQSLLSHVQAL----------QHSSPCEALTCTMEEISTEITNGPLISLLP 387          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Human
Match: VWA3A (von Willebrand factor A domain containing 3A [Source:HGNC Symbol;Acc:HGNC:27088])

HSP 1 Score: 256.529 bits (654), Expect = 1.828e-74
Identity = 146/395 (36.96%), Postives = 233/395 (58.99%), Query Frame = 3
Query: 1860 NILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYPPSHSKK---NEDIIKNAVELCRRNSSDNMVALMPPRQTSLSKARLKYLSDKTEENLKIPKTLAYKSDIDPRKSITNSKPPYRPVIQSAFYTE 3035
             +L+ NA+    EF+P + + V+S+++EKAMIQ EW DG+V+N+H D   L++YQ+ L   +++ E+RI WLS  SRRI+GT+ E++V+++LD+S +N  Y++HI  SL++L+++QL  KD FN+IAF +TI S++  +  V+  NLQ +W W  +L C GSRN+L AL+   E          +QGIYLFT G+PDQ +  L AY+ E   G D++++  LF V +  +  TP P+RYA+ T TA   + +  +  GRFHWF ++GI ESDDI  +M+E++ A+ YS++   ++   K     +HS K   +  + K   +  +  S      L PPR T    AR+    D   E     K+L ++    P  S     P     +++ F+++
Sbjct:   35 QVLAPNAFSPVEEFVPILQKTVSSTIHEKAMIQFEWHDGTVKNIHVDPPFLYKYQQQLSRAMRMYERRIEWLSLASRRIWGTVCEKRVVVLLDISATNSMYIIHIQHSLRLLLEEQLSNKDCFNLIAFGSTIESWRPEMVPVSHNNLQSAWRWALNLRCRGSRNVLSALRKAVEVDFKDKDKHQSQGIYLFTGGIPDQDMPTLSAYMAEACGGCDLQLNVCLFYVGEPKMDTTP-PARYASHTDTAAAYKEVTRAAGGRFHWFGDTGIYESDDINSIMSEMEKALNYSQKCAFLMASLK-----NHSGKVLGSSALPKEKPKTLQLRSQPK--KLCPPRPTVPLGARMSIKDDPDREKSPPLKSLKWR----PLSSRVGISPGMAEWLRAEFWSQ 417          

HSP 2 Score: 87.8113 bits (216), Expect = 2.999e-17
Identity = 65/218 (29.82%), Postives = 108/218 (49.54%), Query Frame = 3
Query: 3141 TSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAK-YCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLE-------DPRIQGIYLLTDGKPDN 3770
            TS +W+K   LK   L L ++++       E  +  L+K V +  +   +       GT K++      L KY  +  +A+  Y +R+EWL ++S+RI+G + E  V +LLD S + + ++  +  +L+ L+ EQL   K  +N+IAF S I  +R  +V    ++  SA  W  +L   G+ +   AL   +E         + QGIYL T G PD 
Sbjct:   16 TSAEWLKVNGLKAKKLSLYQVLAPNAFSPVEEFVPILQKTVSSTIHEKAMIQFEWHDGTVKNIHVDPPFLYKYQQQLSRAMRMYERRIEWLSLASRRIWGTVCEKRVVVLLDISATNSMYIIHIQHSLRLLLEEQL-SNKDCFNLIAFGSTIESWRPEMVPVSHNNLQSAWRWALNLRCRGSRNVLSALRKAVEVDFKDKDKHQSQGIYLFTGGIPDQ 232          

HSP 3 Score: 73.9442 bits (180), Expect = 9.258e-13
Identity = 76/362 (20.99%), Postives = 152/362 (41.99%), Query Frame = 3
Query:  519 EQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQ------------------------TGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALK------YVTKEKSIDE-VLLILGSCPDQEAKMLMYFVQQLLLGRDLPFH-CVSYETQSE-------------EVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRG-------IFSNRASPYINQIAEELKNIPQSENLPKP 1448
            +++S +WLK + L A +L++  +++        P E+                         GT  N  V   F+   Y+ +L  A+ MY +RI+W    SR+++G V   ++ VL+D S  N  +  +I  Q +L  LL+EQL  K   N+  FG+  +    + + ++   ++        +   G  N++ AL+      +  K+K   + + L  G  PDQ+   L  ++ +   G DL  + C+ Y  + +             + ++  K +   + G +H +       +Y S+DI+ ++ E+E+     +K   +          +  + A P       +L++ P+    P+P
Sbjct:   14 DKTSAEWLKVNGLKAKKLSLYQVLAPNAFS---PVEEFVPILQKTVSSTIHEKAMIQFEWHDGTVKNIHVDPPFLY-KYQQQLSRAMRMYERRIEWLSLASRRIWGTVCEKRVVVLLDISATNSMY--IIHIQHSLRLLLEEQLSNKDCFNLIAFGSTIESWRPEMVPVSHNNLQSAWRWALNLRCRGSRNVLSALRKAVEVDFKDKDKHQSQGIYLFTGGIPDQDMPTLSAYMAEACGGCDLQLNVCLFYVGEPKMDTTPPARYASHTDTAAAYKEVTRAAGGRFHWFGDTG---IYESDDINSIMSEMEKALNYSQKCAFLMASLKNHSGKVLGSSALPKEKPKTLQLRSQPKKLCPPRP 366          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Human
Match: VWA3A (von Willebrand factor A domain containing 3A [Source:HGNC Symbol;Acc:HGNC:27088])

HSP 1 Score: 240.35 bits (612), Expect = 7.223e-66
Identity = 135/368 (36.68%), Postives = 214/368 (58.15%), Query Frame = 3
Query: 1716 STISKPVKSRISQILTIDNLKEFSQFGSEFEGIKESTDEKRFIEMFTENILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQ---------------------KLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYK 2756
            S + KP K      +   NL + S    +  G+K         ++    +L+ NA+    EF+P + + V+S+++EKAMIQ EW DG+V+N+H D   L++YQ                     + L   +++ E+RI WLS  SRRI+GT+ E++V+++LD+S +N  Y++HI  SL++L+++QL  KD FN+IAF +TI S++  +  V+  NLQ +W W  +L C GSRN+L AL+   E          +QGIYLFT G+PDQ +  L AY+ E   G D++++  LF V +  +  TP P+RYA+ T TA   + +  +  GRFHWF ++GI ESDDI  +M+E++ A+ YS++   ++   K
Sbjct:  384 SLLPKPPKHDAPLTIEFPNLDKTSAEWLKVNGLKAK-------KLSLYQVLAPNAFSPVEEFVPILQKTVSSTIHEKAMIQFEWHDGTVKNIHVDPPFLYKYQWNDYTAWIPRDLTHHSLKPTQQQLSRAMRMYERRIEWLSLASRRIWGTVCEKRVVVLLDISATNSMYIIHIQHSLRLLLEEQLSNKDCFNLIAFGSTIESWRPEMVPVSHNNLQSAWRWALNLRCRGSRNVLSALRKAVEVDFKDKDKHQSQGIYLFTGGIPDQDMPTLSAYMAEACGGCDLQLNVCLFYVGEPKMDTTP-PARYASHTDTAAAYKEVTRAAGGRFHWFGDTGIYESDDINSIMSEMEKALNYSQKCAFLMASLK 743          

HSP 2 Score: 226.098 bits (575), Expect = 4.399e-61
Identity = 131/375 (34.93%), Postives = 207/375 (55.20%), Query Frame = 3
Query:  390 KVKNFEIIDRNKKYYPPNQFTVTSINQAHDLLRVQNNPAVSGDEQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEW 1514
            K KN   + +N      N   VT +NQ  DLLR+Q +   S D + SEDWL  H+L   +LT+ DLIS+G        E+       + +   I+  +E KL   IE+Y +RI+W  + S+K FG + G+++++LID S  + G  +   FQ +L+ L+DEQL  K+ + +  FGTN   L+ D M ++   ++E+K    T+   GG NL+QALK +   K +D ++ I+ SCPDQ +++L  ++QQ  +GRDL  H ++Y    +   ++LK +A    G YH YS   E   YTS D+D LL EI++ Q +L  ++ ++        +  + +I+ E+ N P    LPKP   + PL  E P  + +TS+EW
Sbjct:   48 KQKNMNGLGQNSD----NGLLVTHVNQTQDLLRLQGSETQSSDWEDSEDWLSAHSLKCQKLTLADLISQGT----EVLEEGTNVVQKICFSTQIIRHFESKLSDTIEVYQERIQWLTENSKKAFGLIKGARVSILIDVSAISSGPQKE-EFQKDLMSLIDEQLSHKEKLFVLSFGTNAGSLWPDPMEVSASTLQELKLWVKTLQPDGGSNLLQALKKIFTLKGLDSLVAIMRSCPDQPSEILSDYIQQSTMGRDLIIHFITYRCDDQMPPAVLKNLAEAVRGYYHCYSPKMEH--YTSRDMDELLAEIQKAQSLLSHVQALQHSSPCEALTCTMEEISTEITNGPLISLLPKPPKHDAPLTIEFPNLD-KTSAEW 410          

HSP 3 Score: 77.0258 bits (188), Expect = 1.765e-13
Identity = 47/139 (33.81%), Postives = 76/139 (54.68%), Query Frame = 3
Query: 3372 KALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLE-------DPRIQGIYLLTDGKPD 3767
            +A+  Y +R+EWL ++S+RI+G + E  V +LLD S + + ++  +  +L+ L+ EQL   K  +N+IAF S I  +R  +V    ++  SA  W  +L   G+ +   AL   +E         + QGIYL T G PD
Sbjct:  505 RAMRMYERRIEWLSLASRRIWGTVCEKRVVVLLDISATNSMYIIHIQHSLRLLLEEQL-SNKDCFNLIAFGSTIESWRPEMVPVSHNNLQSAWRWALNLRCRGSRNVLSALRKAVEVDFKDKDKHQSQGIYLFTGGIPD 642          

HSP 4 Score: 70.4774 bits (171), Expect = 2.223e-11
Identity = 66/283 (23.32%), Postives = 121/283 (42.76%), Query Frame = 3
Query: 3132 EWITSKDWMKKYSLKNMGLDLLRLVS-GPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSG-SMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQ 3974
            +W  S+DW+  +SLK   L L  L+S G E   E   ++        K C                 ++   +  +  +    +  Y +R++WL  +SK+ FG+I    V+IL+D S  S  P   E   +L +LI EQL  ++  + +++F +         +    S+      W + L   G ++  +AL        +  +  +    PD  +EI+   +Q   S+    + IH I++ C+D+     LK LA    G YH  C+   +  ++ R +++
Sbjct:   86 DWEDSEDWLSAHSLKCQKLTLADLISQGTEVLEEGTNVV-------QKIC-----------------FSTQIIRHFESKLSDTIEVYQERIQWLTENSKKAFGLIKGARVSILIDVSAISSGPQKEEFQKDLMSLIDEQLSHKEKLF-VLSFGTNAGSLWPDPMEVSASTLQELKLWVKTLQPDGGSNLLQALKKIFTLKGLDSLVAIMRSCPDQPSEILSDYIQQ--STMGRDLIIHFITYRCDDQMPPAVLKNLAEAVRGYYH--CYSPKMEHYTSRDMDE 339          

HSP 5 Score: 65.855 bits (159), Expect = 4.577e-10
Identity = 77/312 (24.68%), Postives = 139/312 (44.55%), Query Frame = 3
Query: 2019 YQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLS-ISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFE-NPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIE---SDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYPPSHSKKNEDIIKNAVELCRRNSSDNMVALM--PPRQTSLSKARLKYLSDKTEENLKI 2933
            ++  L + +++ ++RI WL+  S++ FG I   +V +++D+S IS+        + L  LI +QL  K+K  +++F     S       V+ + LQ+   W+++L   G  NLL ALK +F    +DS        +       PDQ  E L  YI++  +G D+ IH + +  DD       +P           +++ LA + +G +H +  S  +E   S D+  L+AEI  A       Q +           HS   E +     E+    ++  +++L+  PP+  +        L   + E LK+
Sbjct:  137 FESKLSDTIEVYQERIQWLTENSKKAFGLIKGARVSILIDVSAISSGPQKEEFQKDLMSLIDEQLSHKEKLFVLSFGTNAGSLWPDPMEVSASTLQELKLWVKTLQPDGGSNLLQALKKIFTLKGLDS--------LVAIMRSCPDQPSEILSDYIQQSTMGRDLIIHFITYRCDDQ------MP---------PAVLKNLAEAVRGYYHCY--SPKMEHYTSRDMDELLAEIQKAQSLLSHVQAL----------QHSSPCEALTCTMEEISTEITNGPLISLLPKPPKHDAPLTIEFPNLDKTSAEWLKV 413          

HSP 6 Score: 65.0846 bits (157), Expect = 8.969e-10
Identity = 55/244 (22.54%), Postives = 111/244 (45.49%), Query Frame = 3
Query:  684 EYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALK------YVTKEKSIDE-VLLILGSCPDQEAKMLMYFVQQLLLGRDLPFH-CVSYETQSE-------------EVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELM 1352
            + +L  A+ MY +RI+W    SR+++G V   ++ VL+D S  N  +  +I  Q +L  LL+EQL  K   N+  FG+  +    + + ++   ++        +   G  N++ AL+      +  K+K   + + L  G  PDQ+   L  ++ +   G DL  + C+ Y  + +             + ++  K +   + G +H +       +Y S+DI+ ++ E+E+     +K   +
Sbjct:  500 QQQLSRAMRMYERRIEWLSLASRRIWGTVCEKRVVVLLDISATNSMY--IIHIQHSLRLLLEEQLSNKDCFNLIAFGSTIESWRPEMVPVSHNNLQSAWRWALNLRCRGSRNVLSALRKAVEVDFKDKDKHQSQGIYLFTGGIPDQDMPTLSAYMAEACGGCDLQLNVCLFYVGEPKMDTTPPARYASHTDTAAAYKEVTRAAGGRFHWFGDTG---IYESDDINSIMSEMEKALNYSQKCAFL 738          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Human
Match: VWA3A (von Willebrand factor A domain containing 3A [Source:HGNC Symbol;Acc:HGNC:27088])

HSP 1 Score: 173.711 bits (439), Expect = 1.485e-47
Identity = 109/302 (36.09%), Postives = 152/302 (50.33%), Query Frame = 3
Query: 3354 YSVEAKKALIRYMKRLEWLMIS------------------------SKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQDRTTVAADLLSIDPHYPPLPNLEGDDLVRLAKEIQLTRENLAKINYFRQLHIQLQK 4187
            Y    +K L RY++RL+WL+                          S+R+FG + E+ V ILLDTSGSM P++ ++   L  LIWEQL K   S+N+++F    + +++ LV   +++CH A+ W  HL A G+T   +ALL       ++G+YLLTDGKPD S  +VL  VQ +   R  KV  HTIS NC D +A EFL++LA  + GRYH    +  +          SK  +L       ++D               P LP  EGDDL  LA+EI   R  L +   FR    QLQK
Sbjct:    4 YIRHLEKVLRRYVQRLQWLLSGPVLCSRTWYRQSMDRGVMMTAASGSRRLFGTVLESKVCILLDTSGSMGPYLQQVKTELVLLIWEQLRKCCDSFNLLSFAESFQSWQDTLVETTDAACHEAMQWVTHLQAQGSTSILQALLKAFSFHDLEGLYLLTDGKPDTSCSLVLNEVQKLREKRDVKV--HTISLNCSDRAAVEFLRKLASFTGGRYHCPVGEDTL----------SKIHSLLTKGFINEKD---------------PTLPPFEGDDLRILAQEITKARSFLWQAQSFRS---QLQK 275          

HSP 2 Score: 80.8777 bits (198), Expect = 1.054e-15
Identity = 70/252 (27.78%), Postives = 113/252 (44.84%), Query Frame = 3
Query: 2076 STGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXX-XXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHW------------FRESGII----------ESDDIRVLMAEIDLAVEYSRRTQQIINDYKEK 2762
            ++GSRR+FGT++E KV ++LD S S   YL  +   L +LI +Q  K  D FN+++F+ +  S++  L    +    ++  W+  L   GS ++L AL   F     S H+   +G+YL T G PD     ++  +++     D+K+HT+  N  D                   E +R LA  T GR+H                 G I          E DD+R+L  EI  A  +  + Q   +  ++K
Sbjct:   47 ASGSRRLFGTVLESKVCILLDTSGSMGPYLQQVKTELVLLIWEQLRKCCDSFNLLSFAESFQSWQDTLVETTDAACHEAMQWVTHLQAQGSTSILQALLKAF-----SFHD--LEGLYLLTDGKPDTSCSLVLNEVQKLREKRDVKVHTISLNCSD---------------RAAVEFLRKLASFTGGRYHCPVGEDTLSKIHSLLTKGFINEKDPTLPPFEGDDLRILAQEITKARSFLWQAQSFRSQLQKK 276          

HSP 3 Score: 52.373 bits (124), Expect = 3.124e-6
Identity = 40/168 (23.81%), Postives = 78/168 (46.43%), Query Frame = 3
Query:  744 GSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKK-KSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYH 1244
            GSR++FG V  SK+ +L+D+S +   + + +  +  L+ L+ EQL K   S N+  F  + +      +        E  +  + + + G  +++QAL        ++ + L+    PD    +++  VQ+L   RD+  H +S           L+ +A+ + G YH
Sbjct:   49 GSRRLFGTVLESKVCILLDTSGSMGPYLQQV--KTELVLLIWEQLRKCCDSFNLLSFAESFQSWQDTLVETTDAACHEAMQWVTHLQAQGSTSILQALLKAFSFHDLEGLYLLTDGKPDTSCSLVLNEVQKLREKRDVKVHTISLNCSDRAAVEFLRKLASFTGGRYH 214          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Human
Match: VWA3B (von Willebrand factor A domain containing 3B [Source:HGNC Symbol;Acc:HGNC:28385])

HSP 1 Score: 137.502 bits (345), Expect = 8.069e-32
Identity = 89/274 (32.48%), Postives = 133/274 (48.54%), Query Frame = 3
Query: 3144 SKDWMKKYSLKNMGLDLLRLVSGPECRHEEALII---------------PLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYH 3920
            SK W++KY LK   L L  +++    RH + ++                  +K V AKYC+         G+  H+  T  +   YS     AL R  +R++WL   S+ +FG +    + IL+DTS SM   +  +   +   I EQL K K  +N + F+ Q   +RE+L   +E +   A  W   +    +T+T  AL     D   Q IYLLTDG+PD   E V+  V+     R  ++PI+TISFN  DE AN FLK +A ++ G +H
Sbjct:  390 SKTWLQKYGLKAQKLSLYDVLADCSFRHADGVVDIKAKPENESVQTSAETNKKTVHAKYCSRFVHAPWKDGSLVHVNITKEKCKWYSERIHTALARIRRRIKWLQDGSQSLFGRLHNDCIYILIDTSHSMKSKLDLVKDKIIQFIQEQL-KYKSKFNFVKFDGQAVAWREQLAEVNEDNLEQAQSWIRDIKIGSSTNTLSALKTAFADKETQAIYLLTDGRPDQPPETVIDQVK-----RFQEIPIYTISFNYNDEIANRFLKEVAALTGGEFH 657          

HSP 2 Score: 99.7525 bits (247), Expect = 3.265e-20
Identity = 76/267 (28.46%), Postives = 128/267 (47.94%), Query Frame = 3
Query: 3138 ITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFP-IVNVKGTRKHLQYTVTELNKYSVEA-KKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHL---VACGNTDTTKALLITLEDPRIQGIYLLTDGK-PDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYH 3920
            I+S+ W++ + LK+  L L +++S     H E  +  L + V ++Y  GLFP +   +  R +     +EL    VE   +A+  Y +R++WL   S++IFGVI E  V I+LD  G +   + +L      ++ ++       +NII  + +  +++E      E S  +AI W E L   +         ALL    D  I+ IY    G  P+ S E++L+    I        P++T+SFN   E    FLK L+  ++ R+H
Sbjct:   34 ISSEKWLQLHGLKSNKLTLKQILSQIGFPHCEDYVASLGRPVASRYADGLFPQLYRAEDGRVYNLTAKSELIYQFVEHLTQAVESYKQRMDWLTSKSRQIFGVILEQCVTIVLDFGGILEGEL-DLCREALTMVLQEQVAHITEFNIIRVSQEPVKWQENATPVTEQSIATAISWVEKLTVELTVSEAGRLDALLEAGRDKTIESIYYFVVGDVPEESKELLLQRALEI------PCPVYTVSFNARGEGTIAFLKDLSAKTHSRFH 293          

HSP 3 Score: 91.6633 bits (226), Expect = 7.955e-18
Identity = 125/524 (23.85%), Postives = 223/524 (42.56%), Query Frame = 3
Query: 1938 YEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFR-------ESGIIESDDIRVLMAEI-----DLAVEYSRRTQQIINDY---KEKYPPSHSKKNEDIIKNAVELCRRNSSD-------NMVALMPPRQTSLSKARLKYL--SDKTEENLKIPKTLAYKSD-IDPRKSITNSKPPYR--------PVIQSAFYTEDKNSKGVVYRDYPGQNMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQY---TVTELNKYSVEAKKALIRYMKRL 3401
            Y    +   W DGS+ +V+    +   Y + +   +  + +RI WL  GS+ +FG +    + +++D S S    L  +   +   IQ+QLK K KFN + F     +++  L  VNE NL+ + SW+R +    S N L ALK  F        +   Q IYL T G PDQ   P    I++     +I I+T+ FN +D       I +R+         ++ +A  T G FH++            ++++D+ +L+ E+     DL       ++ +I D+    EK   S  +K    + +  E C +  SD       ++  L  P   S  K + K +  ++ T+ +L   +  + +S     RK   ++    R         ++ +  + +DK+S+ V                G  V       ++S++W+K Y L    L L+  +S     H    +  L+K+V +K    +FP+ +V      +        +LN Y  + ++A+  Y KRL
Sbjct:  448 YCSRFVHAPWKDGSLVHVNITKEKCKWYSERIHTALARIRRRIKWLQDGSQSLFGRLHNDCIYILIDTSHSMKSKLDLVKDKIIQFIQEQLKYKSKFNFVKFDGQAVAWREQLAEVNEDNLEQAQSWIRDIKIGSSTNTLSALKTAFA-------DKETQAIYLLTDGRPDQ---PPETVIDQVKRFQEIPIYTISFNYND------EIANRF---------LKEVAALTGGEFHFYNFGCKDPTPPEAVQNEDLTLLVKEMEQGHSDLEKMQDLYSESLIMDWWYNAEKDGDSKHQKEICSMISTPEKCAKPQSDVDSTQTSSLNMLKGPWGLSDQKVQKKKVLHAESTKTSLLRSQMSSLRSSACSERKDGLSNASSRRTALSDKEMSILLAEEWLDDKSSEKVTRE-------------GSQVYDHDSSDVSSENWLKTYGLVAKKLTLMDALSVAAVPHSSTYVPVLDKHVVSKVFDEVFPLAHVCNDTNKMTLINPQGAKLNIYKRKVEQAIQSYEKRL 933          

HSP 4 Score: 76.6406 bits (187), Expect = 3.016e-13
Identity = 86/321 (26.79%), Postives = 148/321 (46.11%), Query Frame = 3
Query: 1713 SSTIS-KPVKSRISQILTIDNLKEFSQFGSE----FEGIKESTDEKRFIEMFTENILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQV-EWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSG-VPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRE 2654
            SSTIS + ++ +   I T  +L E S   SE      G+K +       ++  + ILS+  +    +++ S+GR V S   +    Q+    DG V N+ A    ++++ + L + V+  +QR+ WL++ SR+IFG I+E+ V ++LD        L    ++L +++Q+Q+    +FNII  S     ++   T V E ++  + SW+  L    + +  G L  + E   D       + IY F  G VP++  E L+    +R L     ++TV FN               A    T   ++ L+  T  RFH F E
Sbjct:    7 SSTISEQQLQRQEGWINTKTDLAEQSLISSEKWLQLHGLKSN-------KLTLKQILSQIGFPHCEDYVASLGRPVASRYADGLFPQLYRAEDGRVYNLTAKSELIYQFVEHLTQAVESYKQRMDWLTSKSRQIFGVILEQCVTIVLDFGGILEGELDLCREALTMVLQEQVAHITEFNIIRVSQEPVKWQENATPVTEQSIATAISWVEKLTVELTVSEAGRLDALLEAGRDKT----IESIYYFVVGDVPEESKELLL----QRALEIPCPVYTVSFN---------------ARGEGTIAFLKDLSAKTHSRFHAFAE 297          

HSP 5 Score: 72.4034 bits (176), Expect = 5.672e-12
Identity = 52/226 (23.01%), Postives = 103/226 (45.58%), Query Frame = 3
Query:  681 YEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYS----SMTEELMYTSNDIDLLLLEIERTQEVLEKIE 1346
            Y  ++H A+    +RIKW   GS+ +FG +    + +LID+S +     ++   +D ++  + EQL  K   N   F        +    +N   +E+ +     +      N + ALK    +K    + L+    PDQ  + ++  V++    +++P + +S+    E  +  LK +A ++ G +H Y+      T      + D+ LL+ E+E+    LEK++
Sbjct:  475 YSERIHTALARIRRRIKWLQDGSQSLFGRLHNDCIYILIDTSHSMK--SKLDLVKDKIIQFIQEQLKYKSKFNFVKFDGQAVAWREQLAEVNEDNLEQAQSWIRDIKIGSSTNTLSALKTAFADKETQAIYLLTDGRPDQPPETVIDQVKRF---QEIPIYTISFNYNDEIANRFLKEVAALTGGEFHFYNFGCKDPTPPEAVQNEDLTLLVKEMEQGHSDLEKMQ 695          

HSP 6 Score: 60.8474 bits (146), Expect = 1.960e-8
Identity = 56/278 (20.14%), Postives = 115/278 (41.37%), Query Frame = 3
Query:  525 SSEDWLKTHNLDALQLTIEDLISK----------GKLGNPRPDE------------QTGTAYNCLVYDDFIVTDYEYKLHM--AIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSS---DANLGFGR---VISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEV-LLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTE 1265
            SSE WL+ H L + +LT++ ++S+            LG P                + G  YN     + I   Y++  H+  A+E Y +R+ W    SR++FG +    + +++D     +  L   R    +  Q+ + H+ +  + +     + +    T    Q        V     E  +   ++     + AL    ++K+I+ +   ++G  P++  ++L+    Q  L    P + VS+  + E   + LK ++  +H  +H ++  TE
Sbjct:   35 SSEKWLQLHGLKSNKLTLKQILSQIGFPHCEDYVASLGRPVASRYADGLFPQLYRAEDGRVYNLTAKSELI---YQFVEHLTQAVESYKQRMDWLTSKSRQIFGVILEQCVTIVLDFGGILEGELDLCREALTMVLQEQVAHITEFNIIRVSQEPVKWQENATPVTEQSIATAISWV-----EKLTVELTVSEAGRLDALLEAGRDKTIESIYYFVVGDVPEESKELLL----QRALEIPCPVYTVSFNARGEGTIAFLKDLSAKTHSRFHAFAERTE 300          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Zebrafish
Match: vwa3a (von Willebrand factor A domain containing 3A [Source:ZFIN;Acc:ZDB-GENE-131121-527])

HSP 1 Score: 238.039 bits (606), Expect = 1.433e-68
Identity = 124/372 (33.33%), Postives = 200/372 (53.76%), Query Frame = 3
Query: 3051 GVVYRDYPGQNMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQDRTTVAADLLSIDPHYPPLPNLEGDDLVRLAKEIQLTRENLAKINYFRQ 4166
            G V++ YP +    R+ I    +P  E   ++K W+K++ ++N+ LDL RL+SGPECRH++ L+  +++ V AKYCA +FP + + G  KHL  +  EL +Y  + +  ++RY +RL+WL+  S+R+FG + E +V +LLD SGSM    PEL   L  LIW+QL    + +N++AF+  +  +R  LV   E  C  A+ W   +   G++ T  AL          G+YL++DG+ D S  ++L  ++ +   R+    +HTI+ NC D S+++FLKRLA  + GR+H+     D  +  +++ + S    LP+                             EGDDL RL +EIQ  R    +   FR+
Sbjct:   52 GFVFKSYP-KPKSVRKSIASIKLPKHEGICSTKQWLKRFGIRNLHLDLHRLLSGPECRHQDTLVPSVQRRVSAKYCA-IFPSIQINGAVKHLHLSPAELKQYISQTETLMLRYCQRLQWLLTGSRRMFGSVLEKEVCLLLDVSGSMASCFPELQKGLTLLIWDQLHANSVRFNMLAFSRGLCMWRPALVQSTEDQCVHAVQWLSQINTHGSSSTLTALQTACGLADGVGVYLISDGRSDCSHSLILTEMETL--RREKSFTVHTIALNCSDRSSSDFLKRLAHKNGGRFHQAPESTDPDLIREQLSDPSSALNLPE----------------------------FEGDDLKRLTEEIQKLRLFQKQAKAFRE 391          

HSP 2 Score: 83.5741 bits (205), Expect = 3.864e-16
Identity = 76/286 (26.57%), Postives = 130/286 (45.45%), Query Frame = 3
Query: 1833 KRF----IEMFTENILSKNAYESKSEFIPSIGRMVTS---SVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLM---EQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXX-XXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRES 2657
            KRF    + +    +LS      +   +PS+ R V++   +++    I     +G+V+++H   A+L +Y   + +   LM    QR+ WL TGSRR+FG+++E++V L+LD+S S       + + L +LI  Q      +FN++AFS  +  ++  L    E     +  WL  +N  GS + L AL+       D V      G+YL + G  D     ++  +E         +HT+  N  D                 +++ ++ LAH   GRFH   ES
Sbjct:   87 KRFGIRNLHLDLHRLLSGPECRHQDTLVPSVQRRVSAKYCAIFPSIQI-----NGAVKHLHLSPAELKQY---ISQTETLMLRYCQRLQWLLTGSRRMFGSVLEKEVCLLLDVSGSMASCFPELQKGLTLLIWDQLHANSVRFNMLAFSRGLCMWRPALVQSTEDQCVHAVQWLSQINTHGSSSTLTALQTAC-GLADGV------GVYLISDGRSDCSHSLILTEMETLRREKSFTVHTIALNCSDRS---------------SSDFLKRLAHKNGGRFHQAPES 342          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Xenopus
Match: muc4 (mucin 4, cell surface associated [Source:Xenbase;Acc:XB-GENE-852599])

HSP 1 Score: 250.366 bits (638), Expect = 1.955e-73
Identity = 127/291 (43.64%), Postives = 198/291 (68.04%), Query Frame = 3
Query: 1863 ILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFE-NPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRT 2732
            IL+ NAY    EF+P + + V+S+++E+AM+Q EW DG+V+N+H D   L EYQ+ L +  +  E+RI WL+ GSRR++G + E++V+L++D+S+SN  +++HI  SL++L+++Q+  KD FNIIAF + I+S+K+ +      NLQ +W W+ SLNC G RN+LGA++   E N +D+  N  +QGIYLFTSGVPDQ +  + AY+ E   G+D+++H  LF+V + +V          +   T  I++ LAH + GRFHWF E G+IESDDI  L++E++ A+ YS + 
Sbjct:   58 ILAPNAYSLVEEFVPILQKTVSSTLHERAMMQFEWHDGTVKNIHVDPPVLREYQRQLAKMARTYEKRIDWLTNGSRRLWGAVCEKRVVLLVDISLSNSMHIIHIQHSLRLLLEEQMSNKDLFNIIAFGSEITSWKSEMVPPTAENLQRAWKWVLSLNCEGGRNVLGAMRRAVEVNFIDN-ENQESQGIYLFTSGVPDQDLHTVSAYLSEATSGSDLQLHVCLFSVGEMNVEDLT-----EDTNNTTGILKDLAHISNGRFHWFDEKGLIESDDISFLISEMEKAMNYSSKV 342          

HSP 2 Score: 99.3673 bits (246), Expect = 1.448e-21
Identity = 80/276 (28.99%), Postives = 127/276 (46.01%), Query Frame = 3
Query: 3141 TSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAK-YCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKAL-------LITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTIS---FNCED--ESANE---FLKRLARMSNGRYH 3920
            TS +W+KK  LK   L L ++++       E  +  L+K V +  +   +       GT K++      L +Y  +  K    Y KR++WL   S+R++G + E  V +L+D S S + H+  +  +L+ L+ EQ+  + + +NIIAF S+I  ++  +V P   +   A  W   L   G  +   A+        I  E+   QGIYL T G PD     V   +    S    ++ +   S    N ED  E  N     LK LA +SNGR+H
Sbjct:   38 TSAEWLKKNGLKAKKLSLYQILAPNAYSLVEEFVPILQKTVSSTLHERAMMQFEWHDGTVKNIHVDPPVLREYQRQLAKMARTYEKRIDWLTNGSRRLWGAVCEKRVVLLVDISLSNSMHIIHIQHSLRLLLEEQMSNKDL-FNIIAFGSEITSWKSEMVPPTAENLQRAWKWVLSLNCEGGRNVLGAMRRAVEVNFIDNENQESQGIYLFTSGVPDQDLHTVSAYLSEATSGSDLQLHVCLFSVGEMNVEDLTEDTNNTTGILKDLAHISNGRFH 312          

HSP 3 Score: 82.0333 bits (201), Expect = 9.116e-16
Identity = 65/256 (25.39%), Postives = 115/256 (44.92%), Query Frame = 3
Query:  633 GTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDE-------VLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEV----------SSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIEL 1349
            GT  N  V D  ++ +Y+ +L      Y KRI W   GSR+++G V   ++ +L+D S +N     +I  Q +L  LL+EQ+  K   NI  FG+       + +      ++   +   +++  GG N++ A++   +   ID        + L     PDQ+   +  ++ +   G DL  H   +      V          + ILK +A IS+G +H +    E+ +  S+DI  L+ E+E+      K+ L
Sbjct:   95 GTVKNIHV-DPPVLREYQRQLAKMARTYEKRIDWLTNGSRRLWGAVCEKRVVLLVDISLSN--SMHIIHIQHSLRLLLEEQMSNKDLFNIIAFGSEITSWKSEMVPPTAENLQRAWKWVLSLNCEGGRNVLGAMRRAVEVNFIDNENQESQGIYLFTSGVPDQDLHTVSAYLSEATSGSDLQLHVCLFSVGEMNVEDLTEDTNNTTGILKDLAHISNGRFHWFD---EKGLIESDDISFLISEMEKAMNYSSKVGL 344          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Xenopus
Match: muc4 (mucin 4, cell surface associated [Source:Xenbase;Acc:XB-GENE-852599])

HSP 1 Score: 245.358 bits (625), Expect = 5.605e-70
Identity = 127/291 (43.64%), Postives = 197/291 (67.70%), Query Frame = 3
Query: 1863 ILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFE-NPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRT 2732
            IL+ NAY    EF+P + + V+S+++E+AM+Q EW DG+V+N+H D   L EYQ  L +  +  E+RI WL+ GSRR++G + E++V+L++D+S+SN  +++HI  SL++L+++Q+  KD FNIIAF + I+S+K+ +      NLQ +W W+ SLNC G RN+LGA++   E N +D+  N  +QGIYLFTSGVPDQ +  + AY+ E   G+D+++H  LF+V + +V          +   T  I++ LAH + GRFHWF E G+IESDDI  L++E++ A+ YS + 
Sbjct:  195 ILAPNAYSLVEEFVPILQKTVSSTLHERAMMQFEWHDGTVKNIHVDPPVLREYQ--LAKMARTYEKRIDWLTNGSRRLWGAVCEKRVVLLVDISLSNSMHIIHIQHSLRLLLEEQMSNKDLFNIIAFGSEITSWKSEMVPPTAENLQRAWKWVLSLNCEGGRNVLGAMRRAVEVNFIDN-ENQESQGIYLFTSGVPDQDLHTVSAYLSEATSGSDLQLHVCLFSVGEMNVEDLT-----EDTNNTTGILKDLAHISNGRFHWFDEKGLIESDDISFLISEMEKAMNYSSKV 477          

HSP 2 Score: 121.324 bits (303), Expect = 5.297e-28
Identity = 61/190 (32.11%), Postives = 108/190 (56.84%), Query Frame = 3
Query:  945 MNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEW 1514
            M LN  ++ E ++    +   GGCNL++ALK V + + +D +++++ SCPDQ  + L  ++QQ  +GR +  H +++++  + +     Y+   S GN+          +Y+S DI LLL EI+    VL +I+ MR G+  +     + +++ EL+ +  S  LPKP + + PL  E+P F P+TS+EW
Sbjct:    6 MKLN--ILHETRQWIQELQPQGGCNLLRALKRVLQVQELDSLVIVVSSCPDQTEEALSDYIQQCTIGRTIQIHIIAFDSLGQVI-----YLCACSWGNHE---------IYSSTDIQLLLNEIQAAINVLNQIKEMRHGMLGDSLISIMQELSTELEKVSPSAFLPKPPNHDGPLNIEIPNFSPKTSAEW 179          

HSP 3 Score: 94.7449 bits (234), Expect = 2.534e-19
Identity = 82/276 (29.71%), Postives = 129/276 (46.74%), Query Frame = 3
Query: 3141 TSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAK-YCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKAL-------LITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTIS---FNCED--ESANE---FLKRLARMSNGRYH 3920
            TS +W+KK  LK   L L ++++       E  +  L+K V +  +   +       GT K++      L +Y + AK A   Y KR++WL   S+R++G + E  V +L+D S S + H+  +  +L+ L+ EQ+  + + +NIIAF S+I  ++  +V P   +   A  W   L   G  +   A+        I  E+   QGIYL T G PD     V   +    S    ++ +   S    N ED  E  N     LK LA +SNGR+H
Sbjct:  175 TSAEWLKKNGLKAKKLSLYQILAPNAYSLVEEFVPILQKTVSSTLHERAMMQFEWHDGTVKNIHVDPPVLREYQL-AKMAR-TYEKRIDWLTNGSRRLWGAVCEKRVVLLVDISLSNSMHIIHIQHSLRLLLEEQMSNKDL-FNIIAFGSEITSWKSEMVPPTAENLQRAWKWVLSLNCEGGRNVLGAMRRAVEVNFIDNENQESQGIYLFTSGVPDQDLHTVSAYLSEATSGSDLQLHVCLFSVGEMNVEDLTEDTNNTTGILKDLAHISNGRFH 447          

HSP 4 Score: 78.1814 bits (191), Expect = 4.180e-14
Identity = 61/239 (25.52%), Postives = 107/239 (44.77%), Query Frame = 3
Query:  684 EYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDE-------VLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEV----------SSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIEL 1349
            EY+L      Y KRI W   GSR+++G V   ++ +L+D S +N     +I  Q +L  LL+EQ+  K   NI  FG+       + +      ++   +   +++  GG N++ A++   +   ID        + L     PDQ+   +  ++ +   G DL  H   +      V          + ILK +A IS+G +H +    E+ +  S+DI  L+ E+E+      K+ L
Sbjct:  246 EYQLAKMARTYEKRIDWLTNGSRRLWGAVCEKRVVLLVDISLSN--SMHIIHIQHSLRLLLEEQMSNKDLFNIIAFGSEITSWKSEMVPPTAENLQRAWKWVLSLNCEGGRNVLGAMRRAVEVNFIDNENQESQGIYLFTSGVPDQDLHTVSAYLSEATSGSDLQLHVCLFSVGEMNVEDLTEDTNNTTGILKDLAHISNGRFHWFD---EKGLIESDDISFLISEMEKAMNYSSKVGL 479          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Xenopus
Match: muc4 (mucin 4, cell surface associated [Source:Xenbase;Acc:XB-GENE-852599])

HSP 1 Score: 182.185 bits (461), Expect = 3.638e-49
Identity = 93/200 (46.50%), Postives = 144/200 (72.00%), Query Frame = 3
Query: 1863 ILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFE-NPVDSVHNDYAQGIYLFTSGVPDQQI 2459
            IL+ NAY    EF+P + + V+S+++E+AM+Q EW DG+V+N+H D   L EYQ+ L +  +  E+RI WL+ GSRR++G + E++V+L++D+S+SN  +++HI  SL++L+++Q+  KD FNIIAF + I+S+K+ +      NLQ +W W+ SLNC G RN+LGA++   E N +D+  N  +QGIYLFTSGVPDQ +
Sbjct:  203 ILAPNAYSLVEEFVPILQKTVSSTLHERAMMQFEWHDGTVKNIHVDPPVLREYQRQLAKMARTYEKRIDWLTNGSRRLWGAVCEKRVVLLVDISLSNSMHIIHIQHSLRLLLEEQMSNKDLFNIIAFGSEITSWKSEMVPPTAENLQRAWKWVLSLNCEGGRNVLGAMRRAVEVNFIDN-ENQESQGIYLFTSGVPDQDL 401          

HSP 2 Score: 109.768 bits (273), Expect = 1.350e-24
Identity = 54/161 (33.54%), Postives = 95/161 (59.01%), Query Frame = 3
Query:  756 MFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGN 1238
            MFG + G+ + +LI+SSD N G  R + F   LL L+DEQL  KK + +  FGT    L++   ++N R++ E ++    +   GGCNL++ALK V + + +D +++++ SCPDQ  + L  ++QQ  +GR +  H +++++  + +     Y+   S GN
Sbjct:    1 MFGLIKGNSVGLLIESSDLNSG-PRRLDFLRGLLCLVDEQLCYKKQLFLLSFGTEVHSLWESAKDVNIRLLHETRQWIQELQPQGGCNLLRALKRVLQVQELDSLVIVVSSCPDQTEEALSDYIQQCTIGRTIQIHIIAFDSLGQVI-----YLCACSWGN 155          

HSP 3 Score: 84.7297 bits (208), Expect = 2.095e-16
Identity = 63/217 (29.03%), Postives = 104/217 (47.93%), Query Frame = 3
Query: 3141 TSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAK-YCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKAL-------LITLEDPRIQGIYLLTDGKPD 3767
            TS +W+KK  LK   L L ++++       E  +  L+K V +  +   +       GT K++      L +Y  +  K    Y KR++WL   S+R++G + E  V +L+D S S + H+  +  +L+ L+ EQ+  + + +NIIAF S+I  ++  +V P   +   A  W   L   G  +   A+        I  E+   QGIYL T G PD
Sbjct:  183 TSAEWLKKNGLKAKKLSLYQILAPNAYSLVEEFVPILQKTVSSTLHERAMMQFEWHDGTVKNIHVDPPVLREYQRQLAKMARTYEKRIDWLTNGSRRLWGAVCEKRVVLLVDISLSNSMHIIHIQHSLRLLLEEQMSNKDL-FNIIAFGSEITSWKSEMVPPTAENLQRAWKWVLSLNCEGGRNVLGAMRRAVEVNFIDNENQESQGIYLFTSGVPD 398          

HSP 4 Score: 57.3806 bits (137), Expect = 1.044e-7
Identity = 43/164 (26.22%), Postives = 76/164 (46.34%), Query Frame = 3
Query:  633 GTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDE-------VLLILGSCPDQE 1103
            GT  N  V D  ++ +Y+ +L      Y KRI W   GSR+++G V   ++ +L+D S +N     +I  Q +L  LL+EQ+  K   NI  FG+       + +      ++   +   +++  GG N++ A++   +   ID        + L     PDQ+
Sbjct:  240 GTVKNIHV-DPPVLREYQRQLAKMARTYEKRIDWLTNGSRRLWGAVCEKRVVLLVDISLSN--SMHIIHIQHSLRLLLEEQMSNKDLFNIIAFGSEITSWKSEMVPPTAENLQRAWKWVLSLNCEGGRNVLGAMRRAVEVNFIDNENQESQGIYLFTSGVPDQD 400          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Xenopus
Match: ENSXETT00000049307.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:109671931:109699265:1 gene:ENSXETG00000020946.1 transcript:ENSXETT00000049307.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.828 bits (377), Expect = 4.658e-36
Identity = 95/288 (32.99%), Postives = 144/288 (50.00%), Query Frame = 3
Query: 3129 EEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALI----IPLE-----------KYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIR 3947
            E++++SK W+ KY LK   L    + +    RH + ++     P +           K + AKYC          G+  HL  T  +   Y    K  L +  +R++WL   S+ +FG I E  V IL+DTS SM   +  +   +  LI EQL K K+ +N + F+S++  ++ RL    E +   A  W + L    +T+T +AL +   D   + IYLLTDG+PD   E +L  V N   S    VPIHTISF+C D  AN FL +L+  + GR+H  C+  ++R
Sbjct:  349 EDYVSSKQWLIKYGLKAQKLQFYDVFADCAFRHSDGVVDIKTKPEDESMQTDADTKMKLINAKYCDQFVHTQWKDGSVVHLYITKEKWRWYEERMKTVLEQMERRIQWLQQGSRELFGTILEDRVYILIDTSHSMKDKLFLVKEKMFQLIEEQL-KHKLMFNFVKFDSKVEAWKSRLAKVTEDTLQEASCWVKELQVGSSTNTLRALQVAFNDSSTEAIYLLTDGRPDQPAETILAQV-NFQKS----VPIHTISFSCNDVDANSFLYQLSCKTEGRFH--CYTSNLR 628          

HSP 2 Score: 106.686 bits (265), Expect = 1.471e-22
Identity = 77/262 (29.39%), Postives = 129/262 (49.24%), Query Frame = 3
Query: 1938 YEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWF-------RESGIIESDDIRVLMAEI 2702
            Y    +  +W DGSV +++    +   Y++ +   ++ ME+RI WL  GSR +FGTI+E +V +++D S S    L  + + +  LI++QLK K  FN + F + + ++K+ L  V E  LQ++  W++ L    S N L AL+  F       ++   + IYL T G PDQ  E ++A +        + IHT+ F+ +D D +                 +  L+  T+GRFH +       +      S+DI +L  EI
Sbjct:  412 YCDQFVHTQWKDGSVVHLYITKEKWRWYEERMKTVLEQMERRIQWLQQGSRELFGTILEDRVYILIDTSHSMKDKLFLVKEKMFQLIEEQLKHKLMFNFVKFDSKVEAWKSRLAKVTEDTLQEASCWVKELQVGSSTNTLRALQVAF-------NDSSTEAIYLLTDGRPDQPAETILAQVN---FQKSVPIHTISFSCNDVDANS---------------FLYQLSCKTEGRFHCYTSNLRDPKAPQPFVSEDICLLQNEI 648          

HSP 3 Score: 76.6406 bits (187), Expect = 2.337e-13
Identity = 52/226 (23.01%), Postives = 108/226 (47.79%), Query Frame = 3
Query:  681 YEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELM----YTSNDIDLLLLEIERTQEVLEKIE 1346
            YE ++   +E   +RI+W  QGSR++FG +   ++ +LID+S +     ++   ++ +  L++EQL  K   N   F +  +        +    ++E       +      N ++AL+    + S + + L+    PDQ A+ ++    Q+   + +P H +S+     + +S L  ++  + G +H Y+S   +      + S DI LL  EI++ +  L+K++
Sbjct:  439 YEERMKTVLEQMERRIQWLQQGSRELFGTILEDRVYILIDTSHSMK--DKLFLVKEKMFQLIEEQLKHKLMFNFVKFDSKVEAWKSRLAKVTEDTLQEASCWVKELQVGSSTNTLRALQVAFNDSSTEAIYLLTDGRPDQPAETIL---AQVNFQKSVPIHTISFSCNDVDANSFLYQLSCKTEGRFHCYTSNLRDPKAPQPFVSEDICLLQNEIKQGKADLQKVQ 659          

HSP 4 Score: 74.7146 bits (182), Expect = 8.812e-13
Identity = 75/325 (23.08%), Postives = 144/325 (44.31%), Query Frame = 3
Query: 3123 DKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGW---TEHLVA----CGNTDTTKALLITLEDPRIQGIYLLT-DGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDY--DIRMFSQRVIEQSKTTALP-------QNDIDTKQDRTTVAADL 4046
            D     +S  W+K + LK   L +++++S    + +E  +  L + V ++Y  GLFP  N  G   +L     +  +        +  Y +RL WL   S+ IFGVI E  V  +L+  G ++    E+  +   L+  +      ++NII  +    ++ ++ V   + S  +A+ W   T+H       C     ++ALL      +++ +Y  T +   +   +++LK V +      +  P+H +S+N + E    FLK ++  ++GR    CH Y  D +  +  +  +    ALP         ++D +QD   +  +L
Sbjct:    6 DAHTLTSSSKWLKTHGLKKKKLSMMKILSQLGFQQKEDYVSKLGRPVSSRYSQGLFPQYNFAGKIYNLTAKKEQFLQKVESLTNTIELYNERLGWLTSGSRAIFGVIQENSVIFVLE-CGCLSKEQFEMYQDAFCLLIREQVAHISNFNIIWVSQVPEKWHDKQVHVSQDSIETAVEWVHNTQHPPVENPECAANALSEALLY-----QVEAVYYFTAEDISEVKKQLLLKYVSD------SPCPVHFVSYNPQKEETITFLKEISHQTSGR----CHVYKADCKQLNTALKLKEVNAALPTSTTEKTHEELDLQQDEFLMMKEL 314          

HSP 5 Score: 62.003 bits (149), Expect = 8.622e-9
Identity = 59/264 (22.35%), Postives = 119/264 (45.08%), Query Frame = 3
Query: 1863 ILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTS-GVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFR 2651
            ILS+  ++ K +++  +GR V+S   +    Q  +  G + N+ A   Q  +  + L   ++L  +R+ WL++GSR IFG I E  VI +L+    + +       +  +LI++Q+     FNII  S     +      V++ +++ +  W+ +       N   A   + E  +  V     + +Y FT+  + + + + L+ Y+ +    +   +H V +N           P +   IT     ++ ++H T GR H ++
Sbjct:   32 ILSQLGFQQKEDYVSKLGRPVSSRYSQGLFPQYNFA-GKIYNLTAKKEQFLQKVESLTNTIELYNERLGWLTSGSRAIFGVIQENSVIFVLECGCLSKEQFEMYQDAFCLLIREQVAHISNFNIIWVSQVPEKWHDKQVHVSQDSIETAVEWVHNTQHPPVENPECAANALSEALLYQV-----EAVYYFTAEDISEVKKQLLLKYVSD----SPCPVHFVSYN-----------PQKEETIT----FLKEISHQTSGRCHVYK 270          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Mouse
Match: Vwa3a (von Willebrand factor A domain containing 3A [Source:MGI Symbol;Acc:MGI:3041229])

HSP 1 Score: 493.812 bits (1270), Expect = 1.945e-152
Identity = 301/828 (36.35%), Postives = 451/828 (54.47%), Query Frame = 3
Query: 1710 FSSTISKPVKSRISQILTIDNLKEFSQFGSEFEGIKESTDEKRFIEMFTENILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYPPSHSKKNEDIIKNAVEL--CRRNSSDNMVALMPPRQTSLSKARLKY---LSDKTEENLKIPKTLAYKSDIDPRKSIT-----NSKPPYRPVIQSAFYTEDKNSKGVVYRDYPGQNMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQDRTTVAADLLSIDPHYPPLPNLEGDDLVRLAKEIQLTRENLAKINYFR 4163
            F+S + KP K      +   +L + S    +  G+K         ++    +L+ NA+    EF+P + + V ++++EKAM+Q EW DG+V+N+H D   LFEYQK LG+ V++ E R+ WLS  SRRI+GT+ +R+V+++LD+S++N  Y++HI  SL++L+++QL  KD FNIIAF +TI S++  +  V+  NLQ +W W   L C GSRN+LGAL+   E      +   +QGIYLFT G+PDQ +  L AY+ E   G D++++  LF V +  +  TP P+ YA+ T TA   + +  + +GRFHWF E+GI ESDDI  +++EI+ A+ YS++   ++   K     +HS+K  ++   A+E    R           PP+ T+ S AR+     L  +T   LK  K     +   P K  T      +KP  RP +   FYTE  NS G VY+ Y  Q    RR      +P K+   +S++W     LK + L+L + + GP CR+++++  P      A++C  LFP + + G  +H+Q+T+ E+  Y    +K    Y++RL WL+  S+R+FG I E +V ILLDTSGSM PH+  +   L  LIWEQL K    +N+++F   ++ +++ LV   E++CH A+ W  HL A G+T    AL        +QG+YLLTDGKPD S  ++L  VQ+    R  KV  HTIS    D +A EFL+ LA +S GRYH    D  +          S    L       ++D               P LP  EGDDL  LA+E    R  L +   FR
Sbjct:  355 FTSLLPKPPKHEAPLTIKFPDLDKTSAEWLKINGLKAK-------KLSLYQVLAPNAFNPVEEFVPILQKTVAATIHEKAMVQFEWHDGTVKNIHVDPPVLFEYQKQLGKAVQIYEHRLQWLSLTSRRIWGTVCQRRVVILLDVSVTNSMYIIHIQHSLRLLLEEQLSNKDYFNIIAFGSTIESWRPEMVAVSHDNLQRAWRWALGLQCQGSRNVLGALRKAIEVDFKDKNKHESQGIYLFTGGIPDQDVHILSAYVAEAYGGCDLQLNVCLFYVGEPQMDTTP-PACYASRTDTATAYKEITQAARGRFHWFGETGIYESDDINAIVSEIEKALNYSQKCAFLVASLK-----NHSEK--ELQSGALEKDKPRTLKQSQPKKHYPPKPTAPSVARMSIKDGLDGETSSRLKALKCHPVNAAAQPEKEGTVEQRMKTKPRTRPKL-FLFYTEAGNSVGSVYKRYT-QGKSIRRINSSIQLPRKDTVCSSQEWTATCRLKRLKLELSKCL-GPNCRYQKSVRGP----ALAEHCT-LFPSIEINGVVRHIQWTLWEMETYITCMEKVTRCYVQRLHWLLSGSRRLFGTILERNVCILLDTSGSMGPHLQWIKTELVLLIWEQLRKHCARFNLLSFAEDLQLWQDTLVESTEAACHKAMQWVAHLQAQGSTSVLAALTKAFSFQDVQGLYLLTDGKPDTSCSLILNTVQSFQKERGVKV--HTISLTSADRTATEFLRELASLSGGRYHCPVSDKAL----------SGIQGLLTRGFIKERD---------------PKLPLFEGDDLRLLAEEFTRARNLLKQAQVFR 1132          

HSP 2 Score: 196.052 bits (497), Expect = 3.636e-50
Identity = 117/354 (33.05%), Postives = 191/354 (53.95%), Query Frame = 3
Query:  453 VTSINQAHDLLRVQNNPAVSGDEQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEW 1514
            VT +NQ  DLL++Q     +   + SEDWL  H+L   +LT+ DLIS+G +      E    A   + +    +  ++ +L   IE+Y +R++W  + S+K FG + GS++ +LIDSS  + G  +   FQ++L  L+DEQL  K+ + +  FG     L+ D M ++   ++E+K    T+   G  NL+QALK V   K ++ +++IL SCPDQ ++ L  F+QQ  LGR +  H  +Y+      S++LK +     G YH YS  +E  +YTS D+  L +E  + Q +L +++ +         S  I +I+ E+   P +  LPKP     PL  + P  + +TS+EW
Sbjct:   38 VTHVNQTQDLLQLQGRETQTSALEDSEDWLAMHSLKFEKLTLADLISQGTV----ELEDCNNAVPKVHFTTQTIHHFKSRLSDTIELYQQRMRWLTENSKKAFGLIKGSRVGLLIDSSQVSSG-SQTKEFQNDLTGLIDEQLSLKEKLYVLSFGVTINPLWPDPMEVSTSTLQELKLWVKTLQPEGSSNLLQALKKVFAHKELNSLVIILRSCPDQPSEFLSDFIQQSTLGRSVFIHVTTYKCDDHVPSAVLKNLTDALGGYYHCYSPESE--LYTSRDVVELQVETHKAQGLLSQVQALCHNNPCEELSCMIKEISIEIAKGPFTSLLPKPPKHEAPLTIKFPDLD-KTSAEW 383          

HSP 3 Score: 134.42 bits (337), Expect = 4.499e-31
Identity = 171/769 (22.24%), Postives = 318/769 (41.35%), Query Frame = 3
Query:  519 EQSSEDWLKTHNLDALQLTIEDLISKGKLGNP----------------------RPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVT----KEKSIDE---VLLILGSCPDQEAKMLMYFVQQLLLGRDLPFH-CVSYETQSE-------------EVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPK--------------FEPRTSSEWXXXXXXXXXXXXXYSKNILSATMANNFERNPTSYPVIEMSDVFPLRESNFTRDANISRKSIQG---RRFSSTISKPVKSRISQILTIDNLKEFSQFGSEFEGIKESTDEKRFIEMFTENILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXX-XXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFH 2642
            +++S +WLK + L A +L++  +++     NP                      + +   GT  N  V D  ++ +Y+ +L  A+++Y  R++W    SR+++G V   ++ +L+D S  N  +  +I  Q +L  LL+EQL  K   NI  FG+  +    + + ++   ++        +   G  N++ AL+       K+K+  E   + L  G  PDQ+  +L  +V +   G DL  + C+ Y  + +             + ++  K I   + G +H +    E  +Y S+DI+ ++ EIE+     +K   +         +   N   +EL++    ++ P+ +  + P K   PK               +  TSS                 K     T+    +  P + P      +F           ++ ++  QG   RR +S+I  P K       T+ + +E++           +T   + +++     L  N    KS   P++    T  ++    I     +G VR++   L ++  Y   + +  +   QR+ WL +GSRR+FGTI+ER V ++LD S S   +L  I   L +LI +Q  K   +FN+++F+  +  ++  L    E     +  W+  L   GS ++L AL   F     S  +   QG+YL T G PD     ++  ++       +K+HT+     D   +               E +R LA  + GR+H
Sbjct:  377 DKTSAEWLKINGLKAKKLSLYQVLAPNAF-NPVEEFVPILQKTVAATIHEKAMVQFEWHDGTVKNIHV-DPPVLFEYQKQLGKAVQIYEHRLQWLSLTSRRIWGTVCQRRVVILLDVSVTNSMY--IIHIQHSLRLLLEEQLSNKDYFNIIAFGSTIESWRPEMVAVSHDNLQRAWRWALGLQCQGSRNVLGALRKAIEVDFKDKNKHESQGIYLFTGGIPDQDVHILSAYVAEAYGGCDLQLNVCLFYVGEPQMDTTPPACYASRTDTATAYKEITQAARGRFHWFG---ETGIYESDDINAIVSEIEKALNYSQKCAFL--------VASLKNHSEKELQSGALEKDKPRTLKQSQPKKHYPPKPTAPSVARMSIKDGLDGETSSRLKALKCHPVNAAAQPEKE---GTVEQRMKTKPRTRP-----KLFLFYTEAGNSVGSVYKRYTQGKSIRRINSSIQLPRKD------TVCSSQEWT-----------ATCRLKRLKLELSKCLGPNCRYQKSVRGPALAEHCT--LFPSIEI-----NGVVRHIQWTLWEMETYITCMEKVTRCYVQRLHWLLSGSRRLFGTILERNVCILLDTSGSMGPHLQWIKTELVLLIWEQLRKHCARFNLLSFAEDLQLWQDTLVESTEAACHKAMQWVAHLQAQGSTSVLAALTKAF-----SFQD--VQGLYLLTDGKPDTSCSLILNTVQSFQKERGVKVHTISLTSADRTAT---------------EFLRELASLSGGRYH 1076          

HSP 4 Score: 75.0998 bits (183), Expect = 6.272e-13
Identity = 71/280 (25.36%), Postives = 131/280 (46.79%), Query Frame = 3
Query: 1917 RMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLS-ISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFR-ESGIIESDDIRVLMAEIDLAVEYSRRTQQIIND 2750
            ++  + +  +  +++E  + +V  VH     +  ++  L + ++L +QR+ WL+  S++ FG I   +V L++D S +S+          L  LI +QL  K+K  +++F  TI+        V+ + LQ+   W+++L   GS NLL ALK VF       H +    + +  S  PDQ  E L  +I++  LG  + IH   +  DD+      +PS          +++ L  +  G +H +  ES +  S D+  L  E   A     + Q + ++
Sbjct:   76 KLTLADLISQGTVELEDCNNAVPKVHFTTQTIHHFKSRLSDTIELYQQRMRWLTENSKKAFGLIKGSRVGLLIDSSQVSSGSQTKEFQNDLTGLIDEQLSLKEKLYVLSFGVTINPLWPDPMEVSTSTLQELKLWVKTLQPEGSSNLLQALKKVF------AHKELNSLVIILRS-CPDQPSEFLSDFIQQSTLGRSVFIHVTTYKCDDH------VPS---------AVLKNLTDALGGYYHCYSPESELYTSRDVVELQVETHKAQGLLSQVQALCHN 333          

HSP 5 Score: 67.3958 bits (163), Expect = 1.332e-10
Identity = 68/281 (24.20%), Postives = 120/281 (42.70%), Query Frame = 3
Query: 3144 SKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLD----TSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQR-VIE 3971
            S+DW+  +SLK   L L  L+S              +  VE + C    P V+         +T   ++ +       +  Y +R+ WL  +SK+ FG+I  + V +L+D    +SGS T    E   +L  LI EQL  ++  Y +++F   I       +    S+      W + L   G+++  +AL        +  + ++    PD  +E +   +Q   S+    V IH  ++ C+D   +  LK L     G YH  C+  +  +++ R V+E
Sbjct:   63 SEDWLAMHSLKFEKLTLADLIS--------------QGTVELEDCNNAVPKVH---------FTTQTIHHFKSRLSDTIELYQQRMRWLTENSKKAFGLIKGSRVGLLIDSSQVSSGSQT---KEFQNDLTGLIDEQLSLKEKLY-VLSFGVTINPLWPDPMEVSTSTLQELKLWVKTLQPEGSSNLLQALKKVFAHKELNSLVIILRSCPDQPSEFLSDFIQQ--STLGRSVFIHVTTYKCDDHVPSAVLKNLTDALGGYYH--CYSPESELYTSRDVVE 312          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Mouse
Match: Vwa3a (von Willebrand factor A domain containing 3A [Source:MGI Symbol;Acc:MGI:3041229])

HSP 1 Score: 493.812 bits (1270), Expect = 1.945e-152
Identity = 301/828 (36.35%), Postives = 451/828 (54.47%), Query Frame = 3
Query: 1710 FSSTISKPVKSRISQILTIDNLKEFSQFGSEFEGIKESTDEKRFIEMFTENILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYPPSHSKKNEDIIKNAVEL--CRRNSSDNMVALMPPRQTSLSKARLKY---LSDKTEENLKIPKTLAYKSDIDPRKSIT-----NSKPPYRPVIQSAFYTEDKNSKGVVYRDYPGQNMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQDRTTVAADLLSIDPHYPPLPNLEGDDLVRLAKEIQLTRENLAKINYFR 4163
            F+S + KP K      +   +L + S    +  G+K         ++    +L+ NA+    EF+P + + V ++++EKAM+Q EW DG+V+N+H D   LFEYQK LG+ V++ E R+ WLS  SRRI+GT+ +R+V+++LD+S++N  Y++HI  SL++L+++QL  KD FNIIAF +TI S++  +  V+  NLQ +W W   L C GSRN+LGAL+   E      +   +QGIYLFT G+PDQ +  L AY+ E   G D++++  LF V +  +  TP P+ YA+ T TA   + +  + +GRFHWF E+GI ESDDI  +++EI+ A+ YS++   ++   K     +HS+K  ++   A+E    R           PP+ T+ S AR+     L  +T   LK  K     +   P K  T      +KP  RP +   FYTE  NS G VY+ Y  Q    RR      +P K+   +S++W     LK + L+L + + GP CR+++++  P      A++C  LFP + + G  +H+Q+T+ E+  Y    +K    Y++RL WL+  S+R+FG I E +V ILLDTSGSM PH+  +   L  LIWEQL K    +N+++F   ++ +++ LV   E++CH A+ W  HL A G+T    AL        +QG+YLLTDGKPD S  ++L  VQ+    R  KV  HTIS    D +A EFL+ LA +S GRYH    D  +          S    L       ++D               P LP  EGDDL  LA+E    R  L +   FR
Sbjct:  355 FTSLLPKPPKHEAPLTIKFPDLDKTSAEWLKINGLKAK-------KLSLYQVLAPNAFNPVEEFVPILQKTVAATIHEKAMVQFEWHDGTVKNIHVDPPVLFEYQKQLGKAVQIYEHRLQWLSLTSRRIWGTVCQRRVVILLDVSVTNSMYIIHIQHSLRLLLEEQLSNKDYFNIIAFGSTIESWRPEMVAVSHDNLQRAWRWALGLQCQGSRNVLGALRKAIEVDFKDKNKHESQGIYLFTGGIPDQDVHILSAYVAEAYGGCDLQLNVCLFYVGEPQMDTTP-PACYASRTDTATAYKEITQAARGRFHWFGETGIYESDDINAIVSEIEKALNYSQKCAFLVASLK-----NHSEK--ELQSGALEKDKPRTLKQSQPKKHYPPKPTAPSVARMSIKDGLDGETSSRLKALKCHPVNAAAQPEKEGTVEQRMKTKPRTRPKL-FLFYTEAGNSVGSVYKRYT-QGKSIRRINSSIQLPRKDTVCSSQEWTATCRLKRLKLELSKCL-GPNCRYQKSVRGP----ALAEHCT-LFPSIEINGVVRHIQWTLWEMETYITCMEKVTRCYVQRLHWLLSGSRRLFGTILERNVCILLDTSGSMGPHLQWIKTELVLLIWEQLRKHCARFNLLSFAEDLQLWQDTLVESTEAACHKAMQWVAHLQAQGSTSVLAALTKAFSFQDVQGLYLLTDGKPDTSCSLILNTVQSFQKERGVKV--HTISLTSADRTATEFLRELASLSGGRYHCPVSDKAL----------SGIQGLLTRGFIKERD---------------PKLPLFEGDDLRLLAEEFTRARNLLKQAQVFR 1132          

HSP 2 Score: 196.052 bits (497), Expect = 3.636e-50
Identity = 117/354 (33.05%), Postives = 191/354 (53.95%), Query Frame = 3
Query:  453 VTSINQAHDLLRVQNNPAVSGDEQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEW 1514
            VT +NQ  DLL++Q     +   + SEDWL  H+L   +LT+ DLIS+G +      E    A   + +    +  ++ +L   IE+Y +R++W  + S+K FG + GS++ +LIDSS  + G  +   FQ++L  L+DEQL  K+ + +  FG     L+ D M ++   ++E+K    T+   G  NL+QALK V   K ++ +++IL SCPDQ ++ L  F+QQ  LGR +  H  +Y+      S++LK +     G YH YS  +E  +YTS D+  L +E  + Q +L +++ +         S  I +I+ E+   P +  LPKP     PL  + P  + +TS+EW
Sbjct:   38 VTHVNQTQDLLQLQGRETQTSALEDSEDWLAMHSLKFEKLTLADLISQGTV----ELEDCNNAVPKVHFTTQTIHHFKSRLSDTIELYQQRMRWLTENSKKAFGLIKGSRVGLLIDSSQVSSG-SQTKEFQNDLTGLIDEQLSLKEKLYVLSFGVTINPLWPDPMEVSTSTLQELKLWVKTLQPEGSSNLLQALKKVFAHKELNSLVIILRSCPDQPSEFLSDFIQQSTLGRSVFIHVTTYKCDDHVPSAVLKNLTDALGGYYHCYSPESE--LYTSRDVVELQVETHKAQGLLSQVQALCHNNPCEELSCMIKEISIEIAKGPFTSLLPKPPKHEAPLTIKFPDLD-KTSAEW 383          

HSP 3 Score: 134.42 bits (337), Expect = 4.499e-31
Identity = 171/769 (22.24%), Postives = 318/769 (41.35%), Query Frame = 3
Query:  519 EQSSEDWLKTHNLDALQLTIEDLISKGKLGNP----------------------RPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVT----KEKSIDE---VLLILGSCPDQEAKMLMYFVQQLLLGRDLPFH-CVSYETQSE-------------EVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPK--------------FEPRTSSEWXXXXXXXXXXXXXYSKNILSATMANNFERNPTSYPVIEMSDVFPLRESNFTRDANISRKSIQG---RRFSSTISKPVKSRISQILTIDNLKEFSQFGSEFEGIKESTDEKRFIEMFTENILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXX-XXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFH 2642
            +++S +WLK + L A +L++  +++     NP                      + +   GT  N  V D  ++ +Y+ +L  A+++Y  R++W    SR+++G V   ++ +L+D S  N  +  +I  Q +L  LL+EQL  K   NI  FG+  +    + + ++   ++        +   G  N++ AL+       K+K+  E   + L  G  PDQ+  +L  +V +   G DL  + C+ Y  + +             + ++  K I   + G +H +    E  +Y S+DI+ ++ EIE+     +K   +         +   N   +EL++    ++ P+ +  + P K   PK               +  TSS                 K     T+    +  P + P      +F           ++ ++  QG   RR +S+I  P K       T+ + +E++           +T   + +++     L  N    KS   P++    T  ++    I     +G VR++   L ++  Y   + +  +   QR+ WL +GSRR+FGTI+ER V ++LD S S   +L  I   L +LI +Q  K   +FN+++F+  +  ++  L    E     +  W+  L   GS ++L AL   F     S  +   QG+YL T G PD     ++  ++       +K+HT+     D   +               E +R LA  + GR+H
Sbjct:  377 DKTSAEWLKINGLKAKKLSLYQVLAPNAF-NPVEEFVPILQKTVAATIHEKAMVQFEWHDGTVKNIHV-DPPVLFEYQKQLGKAVQIYEHRLQWLSLTSRRIWGTVCQRRVVILLDVSVTNSMY--IIHIQHSLRLLLEEQLSNKDYFNIIAFGSTIESWRPEMVAVSHDNLQRAWRWALGLQCQGSRNVLGALRKAIEVDFKDKNKHESQGIYLFTGGIPDQDVHILSAYVAEAYGGCDLQLNVCLFYVGEPQMDTTPPACYASRTDTATAYKEITQAARGRFHWFG---ETGIYESDDINAIVSEIEKALNYSQKCAFL--------VASLKNHSEKELQSGALEKDKPRTLKQSQPKKHYPPKPTAPSVARMSIKDGLDGETSSRLKALKCHPVNAAAQPEKE---GTVEQRMKTKPRTRP-----KLFLFYTEAGNSVGSVYKRYTQGKSIRRINSSIQLPRKD------TVCSSQEWT-----------ATCRLKRLKLELSKCLGPNCRYQKSVRGPALAEHCT--LFPSIEI-----NGVVRHIQWTLWEMETYITCMEKVTRCYVQRLHWLLSGSRRLFGTILERNVCILLDTSGSMGPHLQWIKTELVLLIWEQLRKHCARFNLLSFAEDLQLWQDTLVESTEAACHKAMQWVAHLQAQGSTSVLAALTKAF-----SFQD--VQGLYLLTDGKPDTSCSLILNTVQSFQKERGVKVHTISLTSADRTAT---------------EFLRELASLSGGRYH 1076          

HSP 4 Score: 75.0998 bits (183), Expect = 6.272e-13
Identity = 71/280 (25.36%), Postives = 131/280 (46.79%), Query Frame = 3
Query: 1917 RMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLS-ISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFR-ESGIIESDDIRVLMAEIDLAVEYSRRTQQIIND 2750
            ++  + +  +  +++E  + +V  VH     +  ++  L + ++L +QR+ WL+  S++ FG I   +V L++D S +S+          L  LI +QL  K+K  +++F  TI+        V+ + LQ+   W+++L   GS NLL ALK VF       H +    + +  S  PDQ  E L  +I++  LG  + IH   +  DD+      +PS          +++ L  +  G +H +  ES +  S D+  L  E   A     + Q + ++
Sbjct:   76 KLTLADLISQGTVELEDCNNAVPKVHFTTQTIHHFKSRLSDTIELYQQRMRWLTENSKKAFGLIKGSRVGLLIDSSQVSSGSQTKEFQNDLTGLIDEQLSLKEKLYVLSFGVTINPLWPDPMEVSTSTLQELKLWVKTLQPEGSSNLLQALKKVF------AHKELNSLVIILRS-CPDQPSEFLSDFIQQSTLGRSVFIHVTTYKCDDH------VPS---------AVLKNLTDALGGYYHCYSPESELYTSRDVVELQVETHKAQGLLSQVQALCHN 333          

HSP 5 Score: 67.3958 bits (163), Expect = 1.332e-10
Identity = 68/281 (24.20%), Postives = 120/281 (42.70%), Query Frame = 3
Query: 3144 SKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLD----TSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQR-VIE 3971
            S+DW+  +SLK   L L  L+S              +  VE + C    P V+         +T   ++ +       +  Y +R+ WL  +SK+ FG+I  + V +L+D    +SGS T    E   +L  LI EQL  ++  Y +++F   I       +    S+      W + L   G+++  +AL        +  + ++    PD  +E +   +Q   S+    V IH  ++ C+D   +  LK L     G YH  C+  +  +++ R V+E
Sbjct:   63 SEDWLAMHSLKFEKLTLADLIS--------------QGTVELEDCNNAVPKVH---------FTTQTIHHFKSRLSDTIELYQQRMRWLTENSKKAFGLIKGSRVGLLIDSSQVSSGSQT---KEFQNDLTGLIDEQLSLKEKLY-VLSFGVTINPLWPDPMEVSTSTLQELKLWVKTLQPEGSSNLLQALKKVFAHKELNSLVIILRSCPDQPSEFLSDFIQQ--STLGRSVFIHVTTYKCDDHVPSAVLKNLTDALGGYYH--CYSPESELYTSRDVVE 312          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Mouse
Match: Vwa3a (von Willebrand factor A domain containing 3A [Source:MGI Symbol;Acc:MGI:3041229])

HSP 1 Score: 493.812 bits (1270), Expect = 1.945e-152
Identity = 301/828 (36.35%), Postives = 451/828 (54.47%), Query Frame = 3
Query: 1710 FSSTISKPVKSRISQILTIDNLKEFSQFGSEFEGIKESTDEKRFIEMFTENILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYPPSHSKKNEDIIKNAVEL--CRRNSSDNMVALMPPRQTSLSKARLKY---LSDKTEENLKIPKTLAYKSDIDPRKSIT-----NSKPPYRPVIQSAFYTEDKNSKGVVYRDYPGQNMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQDRTTVAADLLSIDPHYPPLPNLEGDDLVRLAKEIQLTRENLAKINYFR 4163
            F+S + KP K      +   +L + S    +  G+K         ++    +L+ NA+    EF+P + + V ++++EKAM+Q EW DG+V+N+H D   LFEYQK LG+ V++ E R+ WLS  SRRI+GT+ +R+V+++LD+S++N  Y++HI  SL++L+++QL  KD FNIIAF +TI S++  +  V+  NLQ +W W   L C GSRN+LGAL+   E      +   +QGIYLFT G+PDQ +  L AY+ E   G D++++  LF V +  +  TP P+ YA+ T TA   + +  + +GRFHWF E+GI ESDDI  +++EI+ A+ YS++   ++   K     +HS+K  ++   A+E    R           PP+ T+ S AR+     L  +T   LK  K     +   P K  T      +KP  RP +   FYTE  NS G VY+ Y  Q    RR      +P K+   +S++W     LK + L+L + + GP CR+++++  P      A++C  LFP + + G  +H+Q+T+ E+  Y    +K    Y++RL WL+  S+R+FG I E +V ILLDTSGSM PH+  +   L  LIWEQL K    +N+++F   ++ +++ LV   E++CH A+ W  HL A G+T    AL        +QG+YLLTDGKPD S  ++L  VQ+    R  KV  HTIS    D +A EFL+ LA +S GRYH    D  +          S    L       ++D               P LP  EGDDL  LA+E    R  L +   FR
Sbjct:  355 FTSLLPKPPKHEAPLTIKFPDLDKTSAEWLKINGLKAK-------KLSLYQVLAPNAFNPVEEFVPILQKTVAATIHEKAMVQFEWHDGTVKNIHVDPPVLFEYQKQLGKAVQIYEHRLQWLSLTSRRIWGTVCQRRVVILLDVSVTNSMYIIHIQHSLRLLLEEQLSNKDYFNIIAFGSTIESWRPEMVAVSHDNLQRAWRWALGLQCQGSRNVLGALRKAIEVDFKDKNKHESQGIYLFTGGIPDQDVHILSAYVAEAYGGCDLQLNVCLFYVGEPQMDTTP-PACYASRTDTATAYKEITQAARGRFHWFGETGIYESDDINAIVSEIEKALNYSQKCAFLVASLK-----NHSEK--ELQSGALEKDKPRTLKQSQPKKHYPPKPTAPSVARMSIKDGLDGETSSRLKALKCHPVNAAAQPEKEGTVEQRMKTKPRTRPKL-FLFYTEAGNSVGSVYKRYT-QGKSIRRINSSIQLPRKDTVCSSQEWTATCRLKRLKLELSKCL-GPNCRYQKSVRGP----ALAEHCT-LFPSIEINGVVRHIQWTLWEMETYITCMEKVTRCYVQRLHWLLSGSRRLFGTILERNVCILLDTSGSMGPHLQWIKTELVLLIWEQLRKHCARFNLLSFAEDLQLWQDTLVESTEAACHKAMQWVAHLQAQGSTSVLAALTKAFSFQDVQGLYLLTDGKPDTSCSLILNTVQSFQKERGVKV--HTISLTSADRTATEFLRELASLSGGRYHCPVSDKAL----------SGIQGLLTRGFIKERD---------------PKLPLFEGDDLRLLAEEFTRARNLLKQAQVFR 1132          

HSP 2 Score: 196.052 bits (497), Expect = 3.636e-50
Identity = 117/354 (33.05%), Postives = 191/354 (53.95%), Query Frame = 3
Query:  453 VTSINQAHDLLRVQNNPAVSGDEQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEW 1514
            VT +NQ  DLL++Q     +   + SEDWL  H+L   +LT+ DLIS+G +      E    A   + +    +  ++ +L   IE+Y +R++W  + S+K FG + GS++ +LIDSS  + G  +   FQ++L  L+DEQL  K+ + +  FG     L+ D M ++   ++E+K    T+   G  NL+QALK V   K ++ +++IL SCPDQ ++ L  F+QQ  LGR +  H  +Y+      S++LK +     G YH YS  +E  +YTS D+  L +E  + Q +L +++ +         S  I +I+ E+   P +  LPKP     PL  + P  + +TS+EW
Sbjct:   38 VTHVNQTQDLLQLQGRETQTSALEDSEDWLAMHSLKFEKLTLADLISQGTV----ELEDCNNAVPKVHFTTQTIHHFKSRLSDTIELYQQRMRWLTENSKKAFGLIKGSRVGLLIDSSQVSSG-SQTKEFQNDLTGLIDEQLSLKEKLYVLSFGVTINPLWPDPMEVSTSTLQELKLWVKTLQPEGSSNLLQALKKVFAHKELNSLVIILRSCPDQPSEFLSDFIQQSTLGRSVFIHVTTYKCDDHVPSAVLKNLTDALGGYYHCYSPESE--LYTSRDVVELQVETHKAQGLLSQVQALCHNNPCEELSCMIKEISIEIAKGPFTSLLPKPPKHEAPLTIKFPDLD-KTSAEW 383          

HSP 3 Score: 134.42 bits (337), Expect = 4.499e-31
Identity = 171/769 (22.24%), Postives = 318/769 (41.35%), Query Frame = 3
Query:  519 EQSSEDWLKTHNLDALQLTIEDLISKGKLGNP----------------------RPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVT----KEKSIDE---VLLILGSCPDQEAKMLMYFVQQLLLGRDLPFH-CVSYETQSE-------------EVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPK--------------FEPRTSSEWXXXXXXXXXXXXXYSKNILSATMANNFERNPTSYPVIEMSDVFPLRESNFTRDANISRKSIQG---RRFSSTISKPVKSRISQILTIDNLKEFSQFGSEFEGIKESTDEKRFIEMFTENILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXX-XXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFH 2642
            +++S +WLK + L A +L++  +++     NP                      + +   GT  N  V D  ++ +Y+ +L  A+++Y  R++W    SR+++G V   ++ +L+D S  N  +  +I  Q +L  LL+EQL  K   NI  FG+  +    + + ++   ++        +   G  N++ AL+       K+K+  E   + L  G  PDQ+  +L  +V +   G DL  + C+ Y  + +             + ++  K I   + G +H +    E  +Y S+DI+ ++ EIE+     +K   +         +   N   +EL++    ++ P+ +  + P K   PK               +  TSS                 K     T+    +  P + P      +F           ++ ++  QG   RR +S+I  P K       T+ + +E++           +T   + +++     L  N    KS   P++    T  ++    I     +G VR++   L ++  Y   + +  +   QR+ WL +GSRR+FGTI+ER V ++LD S S   +L  I   L +LI +Q  K   +FN+++F+  +  ++  L    E     +  W+  L   GS ++L AL   F     S  +   QG+YL T G PD     ++  ++       +K+HT+     D   +               E +R LA  + GR+H
Sbjct:  377 DKTSAEWLKINGLKAKKLSLYQVLAPNAF-NPVEEFVPILQKTVAATIHEKAMVQFEWHDGTVKNIHV-DPPVLFEYQKQLGKAVQIYEHRLQWLSLTSRRIWGTVCQRRVVILLDVSVTNSMY--IIHIQHSLRLLLEEQLSNKDYFNIIAFGSTIESWRPEMVAVSHDNLQRAWRWALGLQCQGSRNVLGALRKAIEVDFKDKNKHESQGIYLFTGGIPDQDVHILSAYVAEAYGGCDLQLNVCLFYVGEPQMDTTPPACYASRTDTATAYKEITQAARGRFHWFG---ETGIYESDDINAIVSEIEKALNYSQKCAFL--------VASLKNHSEKELQSGALEKDKPRTLKQSQPKKHYPPKPTAPSVARMSIKDGLDGETSSRLKALKCHPVNAAAQPEKE---GTVEQRMKTKPRTRP-----KLFLFYTEAGNSVGSVYKRYTQGKSIRRINSSIQLPRKD------TVCSSQEWT-----------ATCRLKRLKLELSKCLGPNCRYQKSVRGPALAEHCT--LFPSIEI-----NGVVRHIQWTLWEMETYITCMEKVTRCYVQRLHWLLSGSRRLFGTILERNVCILLDTSGSMGPHLQWIKTELVLLIWEQLRKHCARFNLLSFAEDLQLWQDTLVESTEAACHKAMQWVAHLQAQGSTSVLAALTKAF-----SFQD--VQGLYLLTDGKPDTSCSLILNTVQSFQKERGVKVHTISLTSADRTAT---------------EFLRELASLSGGRYH 1076          

HSP 4 Score: 75.0998 bits (183), Expect = 6.272e-13
Identity = 71/280 (25.36%), Postives = 131/280 (46.79%), Query Frame = 3
Query: 1917 RMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLS-ISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFR-ESGIIESDDIRVLMAEIDLAVEYSRRTQQIIND 2750
            ++  + +  +  +++E  + +V  VH     +  ++  L + ++L +QR+ WL+  S++ FG I   +V L++D S +S+          L  LI +QL  K+K  +++F  TI+        V+ + LQ+   W+++L   GS NLL ALK VF       H +    + +  S  PDQ  E L  +I++  LG  + IH   +  DD+      +PS          +++ L  +  G +H +  ES +  S D+  L  E   A     + Q + ++
Sbjct:   76 KLTLADLISQGTVELEDCNNAVPKVHFTTQTIHHFKSRLSDTIELYQQRMRWLTENSKKAFGLIKGSRVGLLIDSSQVSSGSQTKEFQNDLTGLIDEQLSLKEKLYVLSFGVTINPLWPDPMEVSTSTLQELKLWVKTLQPEGSSNLLQALKKVF------AHKELNSLVIILRS-CPDQPSEFLSDFIQQSTLGRSVFIHVTTYKCDDH------VPS---------AVLKNLTDALGGYYHCYSPESELYTSRDVVELQVETHKAQGLLSQVQALCHN 333          

HSP 5 Score: 67.3958 bits (163), Expect = 1.332e-10
Identity = 68/281 (24.20%), Postives = 120/281 (42.70%), Query Frame = 3
Query: 3144 SKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLD----TSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQR-VIE 3971
            S+DW+  +SLK   L L  L+S              +  VE + C    P V+         +T   ++ +       +  Y +R+ WL  +SK+ FG+I  + V +L+D    +SGS T    E   +L  LI EQL  ++  Y +++F   I       +    S+      W + L   G+++  +AL        +  + ++    PD  +E +   +Q   S+    V IH  ++ C+D   +  LK L     G YH  C+  +  +++ R V+E
Sbjct:   63 SEDWLAMHSLKFEKLTLADLIS--------------QGTVELEDCNNAVPKVH---------FTTQTIHHFKSRLSDTIELYQQRMRWLTENSKKAFGLIKGSRVGLLIDSSQVSSGSQT---KEFQNDLTGLIDEQLSLKEKLY-VLSFGVTINPLWPDPMEVSTSTLQELKLWVKTLQPEGSSNLLQALKKVFAHKELNSLVIILRSCPDQPSEFLSDFIQQ--STLGRSVFIHVTTYKCDDHVPSAVLKNLTDALGGYYH--CYSPESELYTSRDVVE 312          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Mouse
Match: Vwa3a (von Willebrand factor A domain containing 3A [Source:MGI Symbol;Acc:MGI:3041229])

HSP 1 Score: 195.282 bits (495), Expect = 5.814e-52
Identity = 117/354 (33.05%), Postives = 191/354 (53.95%), Query Frame = 3
Query:  453 VTSINQAHDLLRVQNNPAVSGDEQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEW 1514
            VT +NQ  DLL++Q     +   + SEDWL  H+L   +LT+ DLIS+G +      E    A   + +    +  ++ +L   IE+Y +R++W  + S+K FG + GS++ +LIDSS  + G  +   FQ++L  L+DEQL  K+ + +  FG     L+ D M ++   ++E+K    T+   G  NL+QALK V   K ++ +++IL SCPDQ ++ L  F+QQ  LGR +  H  +Y+      S++LK +     G YH YS  +E  +YTS D+  L +E  + Q +L +++ +         S  I +I+ E+   P +  LPKP     PL  + P  + +TS+EW
Sbjct:   38 VTHVNQTQDLLQLQGRETQTSALEDSEDWLAMHSLKFEKLTLADLISQGTV----ELEDCNNAVPKVHFTTQTIHHFKSRLSDTIELYQQRMRWLTENSKKAFGLIKGSRVGLLIDSSQVSSG-SQTKEFQNDLTGLIDEQLSLKEKLYVLSFGVTINPLWPDPMEVSTSTLQELKLWVKTLQPEGSSNLLQALKKVFAHKELNSLVIILRSCPDQPSEFLSDFIQQSTLGRSVFIHVTTYKCDDHVPSAVLKNLTDALGGYYHCYSPESE--LYTSRDVVELQVETHKAQGLLSQVQALCHNNPCEELSCMIKEISIEIAKGPFTSLLPKPPKHEAPLTIKFPDLD-KTSAEW 383          

HSP 2 Score: 194.897 bits (494), Expect = 8.275e-52
Identity = 102/250 (40.80%), Postives = 158/250 (63.20%), Query Frame = 3
Query: 1710 FSSTISKPVKSRISQILTIDNLKEFSQFGSEFEGIKESTDEKRFIEMFTENILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQI 2459
            F+S + KP K      +   +L + S    +  G+K         ++    +L+ NA+    EF+P + + V ++++EKAM+Q EW DG+V+N+H D   LFEYQK LG+ V++ E R+ WLS  SRRI+GT+ +R+V+++LD+S++N  Y++HI  SL++L+++QL  KD FNIIAF +TI S++  +  V+  NLQ +W W   L C GSRN+LGAL+   E      +   +QGIYLFT G+PDQ +
Sbjct:  355 FTSLLPKPPKHEAPLTIKFPDLDKTSAEWLKINGLKAK-------KLSLYQVLAPNAFNPVEEFVPILQKTVAATIHEKAMVQFEWHDGTVKNIHVDPPVLFEYQKQLGKAVQIYEHRLQWLSLTSRRIWGTVCQRRVVILLDVSVTNSMYIIHIQHSLRLLLEEQLSNKDYFNIIAFGSTIESWRPEMVAVSHDNLQRAWRWALGLQCQGSRNVLGALRKAIEVDFKDKNKHESQGIYLFTGGIPDQDV 597          

HSP 3 Score: 82.0333 bits (201), Expect = 3.038e-15
Identity = 66/218 (30.28%), Postives = 103/218 (47.25%), Query Frame = 3
Query: 3141 TSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAK-YCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLE-------DPRIQGIYLLTDGKPDN 3770
            TS +W+K   LK   L L ++++       E  +  L+K V A  +   +       GT K++      L +Y  +  KA+  Y  RL+WL ++S+RI+G + +  V ILLD S + + ++  +  +L+ L+ EQL   K  +NIIAF S I  +R  +V     +   A  W   L   G+ +   AL   +E           QGIYL T G PD 
Sbjct:  379 TSAEWLKINGLKAKKLSLYQVLAPNAFNPVEEFVPILQKTVAATIHEKAMVQFEWHDGTVKNIHVDPPVLFEYQKQLGKAVQIYEHRLQWLSLTSRRIWGTVCQRRVVILLDVSVTNSMYIIHIQHSLRLLLEEQL-SNKDYFNIIAFGSTIESWRPEMVAVSHDNLQRAWRWALGLQCQGSRNVLGALRKAIEVDFKDKNKHESQGIYLFTGGIPDQ 595          

HSP 4 Score: 73.559 bits (179), Expect = 1.141e-12
Identity = 69/263 (26.24%), Postives = 125/263 (47.53%), Query Frame = 3
Query: 1917 RMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLS-ISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFR-ESGIIESDDIRVLMAE 2699
            ++  + +  +  +++E  + +V  VH     +  ++  L + ++L +QR+ WL+  S++ FG I   +V L++D S +S+          L  LI +QL  K+K  +++F  TI+        V+ + LQ+   W+++L   GS NLL ALK VF       H +    + +  S  PDQ  E L  +I++  LG  + IH   +  DD+      +PS          +++ L  +  G +H +  ES +  S D+  L  E
Sbjct:   76 KLTLADLISQGTVELEDCNNAVPKVHFTTQTIHHFKSRLSDTIELYQQRMRWLTENSKKAFGLIKGSRVGLLIDSSQVSSGSQTKEFQNDLTGLIDEQLSLKEKLYVLSFGVTINPLWPDPMEVSTSTLQELKLWVKTLQPEGSSNLLQALKKVF------AHKELNSLVIILRS-CPDQPSEFLSDFIQQSTLGRSVFIHVTTYKCDDH------VPS---------AVLKNLTDALGGYYHCYSPESELYTSRDVVELQVE 316          

HSP 5 Score: 68.5514 bits (166), Expect = 4.606e-11
Identity = 68/281 (24.20%), Postives = 120/281 (42.70%), Query Frame = 3
Query: 3144 SKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLD----TSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQR-VIE 3971
            S+DW+  +SLK   L L  L+S              +  VE + C    P V+         +T   ++ +       +  Y +R+ WL  +SK+ FG+I  + V +L+D    +SGS T    E   +L  LI EQL  ++  Y +++F   I       +    S+      W + L   G+++  +AL        +  + ++    PD  +E +   +Q   S+    V IH  ++ C+D   +  LK L     G YH  C+  +  +++ R V+E
Sbjct:   63 SEDWLAMHSLKFEKLTLADLIS--------------QGTVELEDCNNAVPKVH---------FTTQTIHHFKSRLSDTIELYQQRMRWLTENSKKAFGLIKGSRVGLLIDSSQVSSGSQT---KEFQNDLTGLIDEQLSLKEKLY-VLSFGVTINPLWPDPMEVSTSTLQELKLWVKTLQPEGSSNLLQALKKVFAHKELNSLVIILRSCPDQPSEFLSDFIQQ--STLGRSVFIHVTTYKCDDHVPSAVLKNLTDALGGYYH--CYSPESELYTSRDVVE 312          

HSP 6 Score: 56.6102 bits (135), Expect = 1.938e-7
Identity = 54/234 (23.08%), Postives = 106/234 (45.30%), Query Frame = 3
Query:  519 EQSSEDWLKTHNLDALQLTIEDLISKGKLGNP----------------------RPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVT----KEKSIDE---VLLILGSCPDQEAKMLMYFVQQ 1133
            +++S +WLK + L A +L++  +++     NP                      + +   GT  N  V D  ++ +Y+ +L  A+++Y  R++W    SR+++G V   ++ +L+D S  N  +  +I  Q +L  LL+EQL  K   NI  FG+  +    + + ++   ++        +   G  N++ AL+       K+K+  E   + L  G  PDQ+     + V+ 
Sbjct:  377 DKTSAEWLKINGLKAKKLSLYQVLAPNAF-NPVEEFVPILQKTVAATIHEKAMVQFEWHDGTVKNIHV-DPPVLFEYQKQLGKAVQIYEHRLQWLSLTSRRIWGTVCQRRVVILLDVSVTNSMY--IIHIQHSLRLLLEEQLSNKDYFNIIAFGSTIESWRPEMVAVSHDNLQRAWRWALGLQCQGSRNVLGALRKAIEVDFKDKNKHESQGIYLFTGGIPDQDVTWTEHTVEH 606          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Mouse
Match: Vwa3b (von Willebrand factor A domain containing 3B [Source:MGI Symbol;Acc:MGI:1918103])

HSP 1 Score: 153.68 bits (387), Expect = 1.231e-37
Identity = 174/700 (24.86%), Postives = 298/700 (42.57%), Query Frame = 3
Query: 1857 ENILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQV-EWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLN--------CSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAE-IDLAVEYSRRTQQIINDYKEKYPPSHSKKNEDII---KNAVELCRRNSSDNMVALMPPRQTSLSKARLKYLSDKTEENLKIPKTLAYKSDIDPRKSITNSKPPYRPVIQSAFYTEDKNSKGVVYRDYPGQNMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRY 3917
            + ILS+  +    +++ S+ R+V S   +    Q+    DG + N+ A    + ++   L + V+  +QR+ WL++GSR+IFG I+E++V ++LD     ++ L     +LK+++Q+Q+    +FN+I  S     ++    +V E ++  + SW+  +          SG   LL A K           +   + IY F  G   Q+ + L+      VL     + TV FN               A   +T   ++ L+  T  RFH F E    E ++      E +D ++ ++ R        K + PP    + ED+    +   E CR                    A+++ L DK           A +SD+ P  +   S+P                SK      +  Q    + G+       K + +T  D +   S ++    ++ + + PE    +      +K + AKYC+    I    G+  H+  T  +   Y      AL    +R++WL   S  +FG      + +L+DTS SM   +  +   +   I EQL + K  +N + F+ Q   +RE+L   +E +   A  W   +    +T+T  AL I   D   Q IYLLTDG+PD   E+V+ +V+   +     +PI  ISF+  DE ANEFLK LA ++ G +
Sbjct:   26 KQILSQIGFPQSEDYVTSLRRLVASRYADGLFPQIYTAEDGRLYNLTAKTELICQFVDYLTQAVESYKQRMDWLTSGSRQIFGVILEQRVTIVLDFGDVLMEELNLCRDALKMVLQEQVALITRFNMIWVSAEPVKWQEYAILVTEHSIAAAISWIEKMTFEPKPVREVSGLDALLEAGK-----------DKTIEAIYYFVVGDVPQEFQKLLL---TGVLEIPYPVCTVSFN---------------ARGEETIAFLKDLSTKTHSRFHAFAER--TECEEFSAFSTEGVDGSMTWNSRK------LKGRLPPGAGVR-EDVFLIWREMEEACR------------------ILAQVRSLVDK-----------APQSDVSP--ADCKSRPA--------------ESKENAEDTWESQKWLQKYGL-------KAQKLTFYDVLAHCSFRHAD-GVVDIKAKPENESVQTSADTNKKTIHAKYCSRFIHIPWKDGSLVHVNITKEKYKWYRERIHTALAMIQRRIKWLQNGSHILFGKARGECIYVLIDTSCSMKSRLNLVKDKIIQFIQEQL-RYKSKFNFVTFDGQAIAWREKLAEVNEDNLKQAQSWIRGIKVGSSTNTLNALKIAFADEETQVIYLLTDGRPDQPPEMVMDHVKLFQN-----IPICAISFSYNDEVANEFLKELAALTGGEF 628          

HSP 2 Score: 91.2781 bits (225), Expect = 5.453e-18
Identity = 78/292 (26.71%), Postives = 129/292 (44.18%), Query Frame = 3
Query: 3138 ITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALI------------RYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQ--LFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLV----ACGNTDTTKALLITLEDPRIQGIYLLTDGK-PDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFS 3956
            ++S+ W++ + LK+  L L +++S       E  +  L + V ++Y  GLFP +          YT  +   Y++ AK  LI             Y +R++WL   S++IFGVI E  V I+LD    +   +      LK ++ EQ  L  R   +N+I  +++  +++E  +   E S  +AI W E +              ALL   +D  I+ IY    G  P    +++L  V  I        P+ T+SFN   E    FLK L+  ++ R+H      +   FS
Sbjct:    7 LSSERWLQLHGLKSKKLTLKQILSQIGFPQSEDYVTSLRRLVASRYADGLFPQI----------YTAEDGRLYNLTAKTELICQFVDYLTQAVESYKQRMDWLTSGSRQIFGVILEQRVTIVLDFGDVLMEELNLCRDALKMVLQEQVALITR---FNMIWVSAEPVKWQEYAILVTEHSIAAAISWIEKMTFEPKPVREVSGLDALLEAGKDKTIEAIYYFVVGDVPQEFQKLLLTGVLEI------PYPVCTVSFNARGEETIAFLKDLSTKTHSRFHAFAERTECEEFS 279          

HSP 3 Score: 77.7962 bits (190), Expect = 8.094e-14
Identity = 56/224 (25.00%), Postives = 105/224 (46.88%), Query Frame = 3
Query:  681 YEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSN--DIDLLLLEIERTQEVLEKIE 1346
            Y  ++H A+ M  +RIKW   GS  +FG   G  + VLID+S +     R+   +D ++  + EQL  K   N   F        +    +N   +++ +     +      N + ALK    ++    + L+    PDQ  +M+M  V+   L +++P   +S+    E  +  LK +A ++ G +  Y+   ++ +  +   D++LLL E+E+    LEK++
Sbjct:  447 YRERIHTALAMIQRRIKWLQNGSHILFGKARGECIYVLIDTSCSMK--SRLNLVKDKIIQFIQEQLRYKSKFNFVTFDGQAIAWREKLAEVNEDNLKQAQSWIRGIKVGSSTNTLNALKIAFADEETQVIYLLTDGRPDQPPEMVMDHVK---LFQNIPICAISFSYNDEVANEFLKELAALTGGEFRAYNFGCKDPIQDTQDEDLNLLLQEMEQGHSDLEKMQ 665          

HSP 4 Score: 66.2402 bits (160), Expect = 2.863e-10
Identity = 65/283 (22.97%), Postives = 123/283 (43.46%), Query Frame = 3
Query:  525 SSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDE------------------------QTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDA---NLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNL--------NCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEV-LLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTE 1265
            SSE WL+ H L + +LT++ ++S+  +G P+ ++                        + G  YN     + I    +Y L  A+E Y +R+ W   GSR++FG +   ++ +++D  D     L   R     D L  +L EQ+      N+ +        +Q++  L            IE++      +  + G   + AL    K+K+I+ +   ++G  P +  K+L+  V ++      P   VS+  + EE  + LK ++T +H  +H ++  TE
Sbjct:    8 SSERWLQLHGLKSKKLTLKQILSQ--IGFPQSEDYVTSLRRLVASRYADGLFPQIYTAEDGRLYNLTAKTELICQFVDY-LTQAVESYKQRMDWLTSGSRQIFGVILEQRVTIVLDFGDVLMEELNLCR-----DALKMVLQEQVALITRFNMIWVSAEP-VKWQEYAILVTEHSIAAAISWIEKMTFEPKPVREVSG---LDALLEAGKDKTIEAIYYFVVGDVPQEFQKLLLTGVLEI----PYPVCTVSFNARGEETIAFLKDLSTKTHSRFHAFAERTE 274          
BLAST of von Willebrand factor A domain-containing protein 3A vs. UniProt/SwissProt
Match: sp|Q3UVV9|VWA3A_MOUSE (von Willebrand factor A domain-containing protein 3A OS=Mus musculus OX=10090 GN=Vwa3a PE=2 SV=1)

HSP 1 Score: 493.812 bits (1270), Expect = 1.360e-151
Identity = 301/828 (36.35%), Postives = 451/828 (54.47%), Query Frame = 3
Query: 1710 FSSTISKPVKSRISQILTIDNLKEFSQFGSEFEGIKESTDEKRFIEMFTENILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYPPSHSKKNEDIIKNAVEL--CRRNSSDNMVALMPPRQTSLSKARLKY---LSDKTEENLKIPKTLAYKSDIDPRKSIT-----NSKPPYRPVIQSAFYTEDKNSKGVVYRDYPGQNMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQDRTTVAADLLSIDPHYPPLPNLEGDDLVRLAKEIQLTRENLAKINYFR 4163
            F+S + KP K      +   +L + S    +  G+K         ++    +L+ NA+    EF+P + + V ++++EKAM+Q EW DG+V+N+H D   LFEYQK LG+ V++ E R+ WLS  SRRI+GT+ +R+V+++LD+S++N  Y++HI  SL++L+++QL  KD FNIIAF +TI S++  +  V+  NLQ +W W   L C GSRN+LGAL+   E      +   +QGIYLFT G+PDQ +  L AY+ E   G D++++  LF V +  +  TP P+ YA+ T TA   + +  + +GRFHWF E+GI ESDDI  +++EI+ A+ YS++   ++   K     +HS+K  ++   A+E    R           PP+ T+ S AR+     L  +T   LK  K     +   P K  T      +KP  RP +   FYTE  NS G VY+ Y  Q    RR      +P K+   +S++W     LK + L+L + + GP CR+++++  P      A++C  LFP + + G  +H+Q+T+ E+  Y    +K    Y++RL WL+  S+R+FG I E +V ILLDTSGSM PH+  +   L  LIWEQL K    +N+++F   ++ +++ LV   E++CH A+ W  HL A G+T    AL        +QG+YLLTDGKPD S  ++L  VQ+    R  KV  HTIS    D +A EFL+ LA +S GRYH    D  +          S    L       ++D               P LP  EGDDL  LA+E    R  L +   FR
Sbjct:  355 FTSLLPKPPKHEAPLTIKFPDLDKTSAEWLKINGLKAK-------KLSLYQVLAPNAFNPVEEFVPILQKTVAATIHEKAMVQFEWHDGTVKNIHVDPPVLFEYQKQLGKAVQIYEHRLQWLSLTSRRIWGTVCQRRVVILLDVSVTNSMYIIHIQHSLRLLLEEQLSNKDYFNIIAFGSTIESWRPEMVAVSHDNLQRAWRWALGLQCQGSRNVLGALRKAIEVDFKDKNKHESQGIYLFTGGIPDQDVHILSAYVAEAYGGCDLQLNVCLFYVGEPQMDTTP-PACYASRTDTATAYKEITQAARGRFHWFGETGIYESDDINAIVSEIEKALNYSQKCAFLVASLK-----NHSEK--ELQSGALEKDKPRTLKQSQPKKHYPPKPTAPSVARMSIKDGLDGETSSRLKALKCHPVNAAAQPEKEGTVEQRMKTKPRTRPKL-FLFYTEAGNSVGSVYKRYT-QGKSIRRINSSIQLPRKDTVCSSQEWTATCRLKRLKLELSKCL-GPNCRYQKSVRGP----ALAEHCT-LFPSIEINGVVRHIQWTLWEMETYITCMEKVTRCYVQRLHWLLSGSRRLFGTILERNVCILLDTSGSMGPHLQWIKTELVLLIWEQLRKHCARFNLLSFAEDLQLWQDTLVESTEAACHKAMQWVAHLQAQGSTSVLAALTKAFSFQDVQGLYLLTDGKPDTSCSLILNTVQSFQKERGVKV--HTISLTSADRTATEFLRELASLSGGRYHCPVSDKAL----------SGIQGLLTRGFIKERD---------------PKLPLFEGDDLRLLAEEFTRARNLLKQAQVFR 1132          

HSP 2 Score: 196.052 bits (497), Expect = 2.543e-49
Identity = 117/354 (33.05%), Postives = 191/354 (53.95%), Query Frame = 3
Query:  453 VTSINQAHDLLRVQNNPAVSGDEQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEW 1514
            VT +NQ  DLL++Q     +   + SEDWL  H+L   +LT+ DLIS+G +      E    A   + +    +  ++ +L   IE+Y +R++W  + S+K FG + GS++ +LIDSS  + G  +   FQ++L  L+DEQL  K+ + +  FG     L+ D M ++   ++E+K    T+   G  NL+QALK V   K ++ +++IL SCPDQ ++ L  F+QQ  LGR +  H  +Y+      S++LK +     G YH YS  +E  +YTS D+  L +E  + Q +L +++ +         S  I +I+ E+   P +  LPKP     PL  + P  + +TS+EW
Sbjct:   38 VTHVNQTQDLLQLQGRETQTSALEDSEDWLAMHSLKFEKLTLADLISQGTV----ELEDCNNAVPKVHFTTQTIHHFKSRLSDTIELYQQRMRWLTENSKKAFGLIKGSRVGLLIDSSQVSSG-SQTKEFQNDLTGLIDEQLSLKEKLYVLSFGVTINPLWPDPMEVSTSTLQELKLWVKTLQPEGSSNLLQALKKVFAHKELNSLVIILRSCPDQPSEFLSDFIQQSTLGRSVFIHVTTYKCDDHVPSAVLKNLTDALGGYYHCYSPESE--LYTSRDVVELQVETHKAQGLLSQVQALCHNNPCEELSCMIKEISIEIAKGPFTSLLPKPPKHEAPLTIKFPDLD-KTSAEW 383          

HSP 3 Score: 134.42 bits (337), Expect = 3.147e-30
Identity = 171/769 (22.24%), Postives = 318/769 (41.35%), Query Frame = 3
Query:  519 EQSSEDWLKTHNLDALQLTIEDLISKGKLGNP----------------------RPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVT----KEKSIDE---VLLILGSCPDQEAKMLMYFVQQLLLGRDLPFH-CVSYETQSE-------------EVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPK--------------FEPRTSSEWXXXXXXXXXXXXXYSKNILSATMANNFERNPTSYPVIEMSDVFPLRESNFTRDANISRKSIQG---RRFSSTISKPVKSRISQILTIDNLKEFSQFGSEFEGIKESTDEKRFIEMFTENILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXX-XXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFH 2642
            +++S +WLK + L A +L++  +++     NP                      + +   GT  N  V D  ++ +Y+ +L  A+++Y  R++W    SR+++G V   ++ +L+D S  N  +  +I  Q +L  LL+EQL  K   NI  FG+  +    + + ++   ++        +   G  N++ AL+       K+K+  E   + L  G  PDQ+  +L  +V +   G DL  + C+ Y  + +             + ++  K I   + G +H +    E  +Y S+DI+ ++ EIE+     +K   +         +   N   +EL++    ++ P+ +  + P K   PK               +  TSS                 K     T+    +  P + P      +F           ++ ++  QG   RR +S+I  P K       T+ + +E++           +T   + +++     L  N    KS   P++    T  ++    I     +G VR++   L ++  Y   + +  +   QR+ WL +GSRR+FGTI+ER V ++LD S S   +L  I   L +LI +Q  K   +FN+++F+  +  ++  L    E     +  W+  L   GS ++L AL   F     S  +   QG+YL T G PD     ++  ++       +K+HT+     D   +               E +R LA  + GR+H
Sbjct:  377 DKTSAEWLKINGLKAKKLSLYQVLAPNAF-NPVEEFVPILQKTVAATIHEKAMVQFEWHDGTVKNIHV-DPPVLFEYQKQLGKAVQIYEHRLQWLSLTSRRIWGTVCQRRVVILLDVSVTNSMY--IIHIQHSLRLLLEEQLSNKDYFNIIAFGSTIESWRPEMVAVSHDNLQRAWRWALGLQCQGSRNVLGALRKAIEVDFKDKNKHESQGIYLFTGGIPDQDVHILSAYVAEAYGGCDLQLNVCLFYVGEPQMDTTPPACYASRTDTATAYKEITQAARGRFHWFG---ETGIYESDDINAIVSEIEKALNYSQKCAFL--------VASLKNHSEKELQSGALEKDKPRTLKQSQPKKHYPPKPTAPSVARMSIKDGLDGETSSRLKALKCHPVNAAAQPEKE---GTVEQRMKTKPRTRP-----KLFLFYTEAGNSVGSVYKRYTQGKSIRRINSSIQLPRKD------TVCSSQEWT-----------ATCRLKRLKLELSKCLGPNCRYQKSVRGPALAEHCT--LFPSIEI-----NGVVRHIQWTLWEMETYITCMEKVTRCYVQRLHWLLSGSRRLFGTILERNVCILLDTSGSMGPHLQWIKTELVLLIWEQLRKHCARFNLLSFAEDLQLWQDTLVESTEAACHKAMQWVAHLQAQGSTSVLAALTKAF-----SFQD--VQGLYLLTDGKPDTSCSLILNTVQSFQKERGVKVHTISLTSADRTAT---------------EFLRELASLSGGRYH 1076          

HSP 4 Score: 75.0998 bits (183), Expect = 4.387e-12
Identity = 71/280 (25.36%), Postives = 131/280 (46.79%), Query Frame = 3
Query: 1917 RMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLS-ISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFR-ESGIIESDDIRVLMAEIDLAVEYSRRTQQIIND 2750
            ++  + +  +  +++E  + +V  VH     +  ++  L + ++L +QR+ WL+  S++ FG I   +V L++D S +S+          L  LI +QL  K+K  +++F  TI+        V+ + LQ+   W+++L   GS NLL ALK VF       H +    + +  S  PDQ  E L  +I++  LG  + IH   +  DD+      +PS          +++ L  +  G +H +  ES +  S D+  L  E   A     + Q + ++
Sbjct:   76 KLTLADLISQGTVELEDCNNAVPKVHFTTQTIHHFKSRLSDTIELYQQRMRWLTENSKKAFGLIKGSRVGLLIDSSQVSSGSQTKEFQNDLTGLIDEQLSLKEKLYVLSFGVTINPLWPDPMEVSTSTLQELKLWVKTLQPEGSSNLLQALKKVF------AHKELNSLVIILRS-CPDQPSEFLSDFIQQSTLGRSVFIHVTTYKCDDH------VPS---------AVLKNLTDALGGYYHCYSPESELYTSRDVVELQVETHKAQGLLSQVQALCHN 333          

HSP 5 Score: 67.3958 bits (163), Expect = 9.314e-10
Identity = 68/281 (24.20%), Postives = 120/281 (42.70%), Query Frame = 3
Query: 3144 SKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLD----TSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQR-VIE 3971
            S+DW+  +SLK   L L  L+S              +  VE + C    P V+         +T   ++ +       +  Y +R+ WL  +SK+ FG+I  + V +L+D    +SGS T    E   +L  LI EQL  ++  Y +++F   I       +    S+      W + L   G+++  +AL        +  + ++    PD  +E +   +Q   S+    V IH  ++ C+D   +  LK L     G YH  C+  +  +++ R V+E
Sbjct:   63 SEDWLAMHSLKFEKLTLADLIS--------------QGTVELEDCNNAVPKVH---------FTTQTIHHFKSRLSDTIELYQQRMRWLTENSKKAFGLIKGSRVGLLIDSSQVSSGSQT---KEFQNDLTGLIDEQLSLKEKLY-VLSFGVTINPLWPDPMEVSTSTLQELKLWVKTLQPEGSSNLLQALKKVFAHKELNSLVIILRSCPDQPSEFLSDFIQQ--STLGRSVFIHVTTYKCDDHVPSAVLKNLTDALGGYYH--CYSPESELYTSRDVVE 312          
BLAST of von Willebrand factor A domain-containing protein 3A vs. UniProt/SwissProt
Match: sp|A6NCI4|VWA3A_HUMAN (von Willebrand factor A domain-containing protein 3A OS=Homo sapiens OX=9606 GN=VWA3A PE=2 SV=3)

HSP 1 Score: 488.419 bits (1256), Expect = 3.831e-149
Identity = 292/798 (36.59%), Postives = 446/798 (55.89%), Query Frame = 3
Query: 1860 NILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYPPSHSKK---NEDIIKNAVELCRRNSSDNMVALMPPRQTSLSKARLKYLSDKTEENLKIPKTLAYKSDIDPRKSIT--NSKPPYRPVIQS--------------AFYTEDKNSKGVVYRDYPGQNMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQDRTTVAADLLS---IDPHYPPLPNLEGDDLVRLAKEIQLTRENLAKINYFRQLHIQLQK 4187
             +L+ NA+    EF+P + + V+S+++EKAMIQ EW DG+V+N+H D   L++YQ+ L   +++ E+RI WLS  SRRI+GT+ E++V+++LD+S +N  Y++HI  SL++L+++QL  KD FN+IAF +TI S++  +  V+  NLQ +W W  +L C GSRN+L AL+   E          +QGIYLFT G+PDQ +  L AY+ E   G D++++  LF V +  +  TP P+RYA+ T TA   + +  +  GRFHWF ++GI ESDDI  +M+E++ A+ YS++   ++   K     +HS K   +  + K   +  +  S      L PPR T    AR+    D   E     K+L ++  +  R  I+   ++P    +++                FYTE  N  G VY+ YP Q    RR      +P K+   +S++W+ KY LK + L++ R + GP C H+++     ++   AK+C+ +FP V + G  +H+Q+T  E+  Y    +K L RY++RL+WL+  S+R+FG + E+ V ILLDTSGSM P++ ++   L  LIWEQL K   S+N+++F    + +++ LV   +++CH A+ W  HL A G+T   +ALL       ++G+YLLTDGKPD S  +VL  VQ +   R  KV  HTIS NC D +A EFL++LA  + GRYH                                +D  +    LL+   I+   P LP  EGDDL  LA+EI   R  L +   FR    QLQK
Sbjct:  425 QVLAPNAFSPVEEFVPILQKTVSSTIHEKAMIQFEWHDGTVKNIHVDPPFLYKYQQQLSRAMRMYERRIEWLSLASRRIWGTVCEKRVVVLLDISATNSMYIIHIQHSLRLLLEEQLSNKDCFNLIAFGSTIESWRPEMVPVSHNNLQSAWRWALNLRCRGSRNVLSALRKAVEVDFKDKDKHQSQGIYLFTGGIPDQDMPTLSAYMAEACGGCDLQLNVCLFYVGEPKMDTTP-PARYASHTDTAAAYKEVTRAAGGRFHWFGDTGIYESDDINSIMSEMEKALNYSQKCAFLMASLK-----NHSGKVLGSSALPKEKPKTLQLRSQPK--KLCPPRPTVPLGARMSIKDDPDREKSPPLKSLKWRP-LSSRVGISPAAAQPTKEGMMELRRKTKSREAETSLLLFYTEKGNDVGSVYKKYP-QGRGLRRTSSSIDLPRKDTVCSSQEWVAKYGLKKLKLEISRCM-GPNCTHQKSG----QRSASAKHCS-IFPSVEIHGVVRHIQWTPREMEVYIRHLEKVLRRYVQRLQWLLSGSRRLFGTVLESKVCILLDTSGSMGPYLQQVKTELVLLIWEQLRKCCDSFNLLSFAESFQSWQDTLVETTDAACHEAMQWVTHLQAQGSTSILQALLKAFSFHDLEGLYLLTDGKPDTSCSLVLNEVQKLREKRDVKV--HTISLNCSDRAAVEFLRKLASFTGGRYH----------------------------CPVGEDTLSKIHSLLTKGFINEKDPTLPPFEGDDLRILAQEITKARSFLWQAQSFRS---QLQK 1173          

HSP 2 Score: 227.254 bits (578), Expect = 5.050e-59
Identity = 131/375 (34.93%), Postives = 207/375 (55.20%), Query Frame = 3
Query:  390 KVKNFEIIDRNKKYYPPNQFTVTSINQAHDLLRVQNNPAVSGDEQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEW 1514
            K KN   + +N      N   VT +NQ  DLLR+Q +   S D + SEDWL  H+L   +LT+ DLIS+G        E+       + +   I+  +E KL   IE+Y +RI+W  + S+K FG + G+++++LID S  + G  +   FQ +L+ L+DEQL  K+ + +  FGTN   L+ D M ++   ++E+K    T+   GG NL+QALK +   K +D ++ I+ SCPDQ +++L  ++QQ  +GRDL  H ++Y    +   ++LK +A    G YH YS   E   YTS D+D LL EI++ Q +L  ++ ++        +  + +I+ E+ N P    LPKP   + PL  E P  + +TS+EW
Sbjct:   48 KQKNMNGLGQNSD----NGLLVTHVNQTQDLLRLQGSETQSSDWEDSEDWLSAHSLKCQKLTLADLISQGT----EVLEEGTNVVQKICFSTQIIRHFESKLSDTIEVYQERIQWLTENSKKAFGLIKGARVSILIDVSAISSGPQKE-EFQKDLMSLIDEQLSHKEKLFVLSFGTNAGSLWPDPMEVSASTLQELKLWVKTLQPDGGSNLLQALKKIFTLKGLDSLVAIMRSCPDQPSEILSDYIQQSTMGRDLIIHFITYRCDDQMPPAVLKNLAEAVRGYYHCYSPKMEH--YTSRDMDELLAEIQKAQSLLSHVQALQHSSPCEALTCTMEEISTEITNGPLISLLPKPPKHDAPLTIEFPNLD-KTSAEW 410          

HSP 3 Score: 140.969 bits (354), Expect = 2.689e-32
Identity = 186/782 (23.79%), Postives = 331/782 (42.33%), Query Frame = 3
Query:  633 GTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALK------YVTKEKSIDE-VLLILGSCPDQEAKMLMYFVQQLLLGRDLPFH-CVSYETQSE-------------EVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRG-------IFSNRASPYINQIAEELKNIPQSENLPKP-------ISF-NDPLKFEVPKFEPRTSSEWXXXXXXXXXXXXXYSKNILSATMANNFERNPTSYPVIEMSDVFPLRESN------FTRDAN----ISRKSIQGR---RFSSTISKPVKSRISQILTIDNLKEFSQFGSEFEGIKESTDEKRFIEMFTENILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXX-XXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHW------------FRESGII----------ESDDIRVLMAEIDLAVEYSRRTQQIINDYKEK 2762
            GT  N  V   F+   Y+ +L  A+ MY +RI+W    SR+++G V   ++ VL+D S  N  +  +I  Q +L  LL+EQL  K   N+  FG+  +    + + ++   ++        +   G  N++ AL+      +  K+K   + + L  G  PDQ+   L  ++ +   G DL  + C+ Y  + +             + ++  K +   + G +H +       +Y S+DI+ ++ E+E+     +K   +          +  + A P       +L++ P+    P+P       +S  +DP + + P   P  S +W   S          S+  +S   A      PT   ++E+      RE+       +T   N    + +K  QGR   R SS+I  P K         D +    ++ +++ G+K+       +++     +  N    KS      G+   S+ +      VE   G VR++     ++  Y + L + ++   QR+ WL +GSRR+FGT++E KV ++LD S S   YL  +   L +LI +Q  K  D FN+++F+ +  S++  L    +    ++  W+  L   GS ++L AL   F     S H+   +G+YL T G PD     ++  +++     D+K+HT+  N  D          R A      E +R LA  T GR+H                 G I          E DD+R+L  EI  A  +  + Q   +  ++K
Sbjct:  463 GTVKNIHVDPPFLY-KYQQQLSRAMRMYERRIEWLSLASRRIWGTVCEKRVVVLLDISATNSMY--IIHIQHSLRLLLEEQLSNKDCFNLIAFGSTIESWRPEMVPVSHNNLQSAWRWALNLRCRGSRNVLSALRKAVEVDFKDKDKHQSQGIYLFTGGIPDQDMPTLSAYMAEACGGCDLQLNVCLFYVGEPKMDTTPPARYASHTDTAAAYKEVTRAAGGRFHWFGDTG---IYESDDINSIMSEMEKALNYSQKCAFLMASLKNHSGKVLGSSALPKEKPKTLQLRSQPKKLCPPRPTVPLGARMSIKDDPDREKSP---PLKSLKWRPLS----------SRVGISPAAAQ-----PTKEGMMELRRKTKSREAETSLLLFYTEKGNDVGSVYKKYPQGRGLRRTSSSIDLPRK---------DTVCSSQEWVAKY-GLKK-------LKLEISRCMGPNCTHQKS------GQRSASAKHCSIFPSVE-IHGVVRHIQWTPREMEVYIRHLEKVLRRYVQRLQWLLSGSRRLFGTVLESKVCILLDTSGSMGPYLQQVKTELVLLIWEQLRKCCDSFNLLSFAESFQSWQDTLVETTDAACHEAMQWVTHLQAQGSTSILQALLKAF-----SFHD--LEGLYLLTDGKPDTSCSLVLNEVQKLREKRDVKVHTISLNCSD----------RAA-----VEFLRKLASFTGGRYHCPVGEDTLSKIHSLLTKGFINEKDPTLPPFEGDDLRILAQEITKARSFLWQAQSFRSQLQKK 1174          

HSP 4 Score: 71.633 bits (174), Expect = 5.573e-11
Identity = 55/255 (21.57%), Postives = 113/255 (44.31%), Query Frame = 3
Query:  525 SSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTD--------------YEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFK-KKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYH 1244
            SS++W+  + L  L+L I   +      + +  +++ +A +C ++    +                Y   L   +  Y +R++W L GSR++FG V  SK+ +L+D+S +   + + +  +  L+ L+ EQL K   S N+  F  + +      +        E  +  + + + G  +++QAL        ++ + L+    PD    +++  VQ+L   RD+  H +S           L+ +A+ + G YH
Sbjct:  861 SSQEWVAKYGLKKLKLEISRCMGPN-CTHQKSGQRSASAKHCSIFPSVEIHGVVRHIQWTPREMEVYIRHLEKVLRRYVQRLQWLLSGSRRLFGTVLESKVCILLDTSGSMGPYLQQV--KTELVLLIWEQLRKCCDSFNLLSFAESFQSWQDTLVETTDAACHEAMQWVTHLQAQGSTSILQALLKAFSFHDLEGLYLLTDGKPDTSCSLVLNEVQKLREKRDVKVHTISLNCSDRAAVEFLRKLASFTGGRYH 1112          

HSP 5 Score: 70.0922 bits (170), Expect = 1.450e-10
Identity = 66/283 (23.32%), Postives = 121/283 (42.76%), Query Frame = 3
Query: 3132 EWITSKDWMKKYSLKNMGLDLLRLVS-GPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSG-SMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQ 3974
            +W  S+DW+  +SLK   L L  L+S G E   E   ++        K C                 ++   +  +  +    +  Y +R++WL  +SK+ FG+I    V+IL+D S  S  P   E   +L +LI EQL  ++  + +++F +         +    S+      W + L   G ++  +AL        +  +  +    PD  +EI+   +Q   S+    + IH I++ C+D+     LK LA    G YH  C+   +  ++ R +++
Sbjct:   86 DWEDSEDWLSAHSLKCQKLTLADLISQGTEVLEEGTNVV-------QKIC-----------------FSTQIIRHFESKLSDTIEVYQERIQWLTENSKKAFGLIKGARVSILIDVSAISSGPQKEEFQKDLMSLIDEQLSHKEKLF-VLSFGTNAGSLWPDPMEVSASTLQELKLWVKTLQPDGGSNLLQALKKIFTLKGLDSLVAIMRSCPDQPSEILSDYIQQ--STMGRDLIIHFITYRCDDQMPPAVLKNLAEAVRGYYH--CYSPKMEHYTSRDMDE 339          

HSP 6 Score: 67.0106 bits (162), Expect = 1.523e-9
Identity = 72/286 (25.17%), Postives = 130/286 (45.45%), Query Frame = 3
Query: 2019 YQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLS-ISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFE-NPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIE---SDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYPPSHSKKNEDIIKNAVELCRRNSSDNMVALMP 2861
            ++  L + +++ ++RI WL+  S++ FG I   +V +++D+S IS+        + L  LI +QL  K+K  +++F     S       V+ + LQ+   W+++L   G  NLL ALK +F    +DS        +       PDQ  E L  YI++  +G D+ IH + +  DD       +P           +++ LA + +G +H +  S  +E   S D+  L+AEI  A       Q +           HS   E +     E+    ++  +++L+P
Sbjct:  137 FESKLSDTIEVYQERIQWLTENSKKAFGLIKGARVSILIDVSAISSGPQKEEFQKDLMSLIDEQLSHKEKLFVLSFGTNAGSLWPDPMEVSASTLQELKLWVKTLQPDGGSNLLQALKKIFTLKGLDS--------LVAIMRSCPDQPSEILSDYIQQSTMGRDLIIHFITYRCDDQ------MP---------PAVLKNLAEAVRGYYHCY--SPKMEHYTSRDMDELLAEIQKAQSLLSHVQAL----------QHSSPCEALTCTMEEISTEITNGPLISLLP 387          
BLAST of von Willebrand factor A domain-containing protein 3A vs. UniProt/SwissProt
Match: sp|A1A5Q7|VWA3A_RAT (von Willebrand factor A domain-containing protein 3A OS=Rattus norvegicus OX=10116 GN=Vwa3a PE=2 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 5.431e-73
Identity = 147/395 (37.22%), Postives = 232/395 (58.73%), Query Frame = 3
Query: 1710 FSSTISKPVKSRISQILTIDNLKEFSQFGSEFEGIKESTDEKRFIEMFTENILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYPPSHSKKNEDIIKNAVELCRRNSSDNMVALMPPRQTSLSKARL 2894
            F+S + KP K      +   +L + S    +  G+K         ++    +L+ NA+    EF+P + + V ++++EKAM+Q EW DG+V+N+H D   LFEYQK LG+ V++ E+R+ WLS  SRR +GT+ +R+V+++LD+S++N  +++HI  SL++L+++QL  KD FNIIAF +T+ S++  +  V+  NLQ +W W   L C GSRN+LGAL+   E          +QGIYLFT GVPDQ +  L AY+ E   G D++++  LF V +  ++ TP P+ YA+ T TA   + +  +  GRFHWF E+GI ESDD   +++EI+ A+ YS++   ++   K     +HS K         +  R         L PP+ T+ S AR+
Sbjct:  355 FTSLLPKPPKHEAPLTIKFPDLDKTSAEWLKINGLKAK-------KLGLYQVLAPNAFNPVEEFVPILQKTVGATIHEKAMVQFEWHDGTVKNIHVDPPVLFEYQKQLGKAVQIYEKRLQWLSLTSRRFWGTVCQRRVVILLDVSVTNSMFIIHIQHSLRLLLEEQLSNKDYFNIIAFGSTVESWRPEMVAVSHDNLQRAWRWALGLQCQGSRNVLGALRKAIEVDFKDKTKHESQGIYLFTGGVPDQDVHILSAYVAEACGGCDLQLNVCLFYVGEPQMNTTP-PACYASRTDTAAAYKEVTQAACGRFHWFGETGIYESDDSNAIVSEIEKALNYSQKCAFLVASLK-----NHSGKELLTAALQKDKPRTLQQSQPKKLYPPKPTAPSVARM 736          

HSP 2 Score: 207.994 bits (528), Expect = 1.732e-54
Identity = 123/354 (34.75%), Postives = 194/354 (54.80%), Query Frame = 3
Query:  453 VTSINQAHDLLRVQNNPAVSGDEQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEW 1514
            VT +NQ  DLLR+Q +   +   + SEDWL  H+L   +LT+ DLIS+G +      E    A   + +    +  +  +L   IE+Y +R++W  + S+K FG + GS++ +LIDSS  + G  +   FQ++L  L+DEQL  K+ + +  FG  T FL+ D + ++   ++E+K    T+   G  NL+QALK V   K ++ ++ IL SCPDQ ++ L  F+QQ  LGR L  H V+Y+      S+ILK +     G+YH YS  +E  +YTS D+D LL E  + Q +  +++ +         S  I +I+ E+   P +  LPKP     PL  + P  + +TS+EW
Sbjct:   38 VTHVNQTQDLLRLQRSETQTSALEDSEDWLAMHSLKFEKLTLADLISQGTV----ELEDQNNAVPKVHFTTQTIYHFTSRLSDTIELYQQRMRWLTENSKKAFGLIKGSRVGLLIDSSQVSSG-PQTEEFQNDLTSLIDEQLSLKEKLYVLTFGGTTNFLWPDPVEVSASTLQELKLWVKTLQPEGSSNLLQALKKVLARKELNSLVAILRSCPDQPSEFLSDFIQQSTLGRSLFIHIVTYKCDDHVPSAILKNLTDALGGHYHCYSPESE--LYTSRDVDELLAETHKAQGLFSQLQALCHNNPCEELSCMIEEISTEIAKGPFTSLLPKPPKHEAPLTIKFPDLD-KTSAEW 383          

HSP 3 Score: 82.0333 bits (201), Expect = 2.444e-14
Identity = 66/223 (29.60%), Postives = 104/223 (46.64%), Query Frame = 3
Query: 3141 TSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAK-YCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLE-------DPRIQGIYLLTDGKPDNSTEIV 3785
            TS +W+K   LK   L L ++++       E  +  L+K V A  +   +       GT K++      L +Y  +  KA+  Y KRL+WL ++S+R +G + +  V ILLD S + +  +  +  +L+ L+ EQL   K  +NIIAF S +  +R  +V     +   A  W   L   G+ +   AL   +E           QGIYL T G PD    I+
Sbjct:  379 TSAEWLKINGLKAKKLGLYQVLAPNAFNPVEEFVPILQKTVGATIHEKAMVQFEWHDGTVKNIHVDPPVLFEYQKQLGKAVQIYEKRLQWLSLTSRRFWGTVCQRRVVILLDVSVTNSMFIIHIQHSLRLLLEEQL-SNKDYFNIIAFGSTVESWRPEMVAVSHDNLQRAWRWALGLQCQGSRNVLGALRKAIEVDFKDKTKHESQGIYLFTGGVPDQDVHIL 600          

HSP 4 Score: 76.2554 bits (186), Expect = 1.500e-12
Identity = 72/306 (23.53%), Postives = 136/306 (44.44%), Query Frame = 3
Query:  633 GTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVT----KEKSIDE---VLLILGSCPDQEAKMLMYFVQQLLLGRDLPFH-CVSYETQSE-------------EVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPK 1487
            GT  N  V D  ++ +Y+ +L  A+++Y KR++W    SR+ +G V   ++ +L+D S  N  F  +I  Q +L  LL+EQL  K   NI  FG+  +    + + ++   ++        +   G  N++ AL+       K+K+  E   + L  G  PDQ+  +L  +V +   G DL  + C+ Y  + +             + ++  K +   + G +H +    E  +Y S+D + ++ EIE+     +K   +         +   N   +EL      ++ P+ +  + P K   PK
Sbjct:  436 GTVKNIHV-DPPVLFEYQKQLGKAVQIYEKRLQWLSLTSRRFWGTVCQRRVVILLDVSVTNSMF--IIHIQHSLRLLLEEQLSNKDYFNIIAFGSTVESWRPEMVAVSHDNLQRAWRWALGLQCQGSRNVLGALRKAIEVDFKDKTKHESQGIYLFTGGVPDQDVHILSAYVAEACGGCDLQLNVCLFYVGEPQMNTTPPACYASRTDTAAAYKEVTQAACGRFHWFG---ETGIYESDDSNAIVSEIEKALNYSQKCAFL--------VASLKNHSGKELLTAALQKDKPRTLQQSQPKKLYPPK 727          

HSP 5 Score: 74.7146 bits (182), Expect = 4.748e-12
Identity = 68/263 (25.86%), Postives = 121/263 (46.01%), Query Frame = 3
Query: 1917 RMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLS-ISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFR-ESGIIESDDIRVLMAE 2699
            ++  + +  +  +++E  + +V  VH     ++ +   L + ++L +QR+ WL+  S++ FG I   +V L++D S +S+          L  LI +QL  K+K  ++ F  T +        V+ + LQ+   W+++L   GS NLL ALK V               +       PDQ  E L  +I++  LG  + IH V +  DD+      +PS          I++ L  +  G +H +  ES +  S D+  L+AE
Sbjct:   76 KLTLADLISQGTVELEDQNNAVPKVHFTTQTIYHFTSRLSDTIELYQQRMRWLTENSKKAFGLIKGSRVGLLIDSSQVSSGPQTEEFQNDLTSLIDEQLSLKEKLYVLTFGGTTNFLWPDPVEVSASTLQELKLWVKTLQPEGSSNLLQALKKVLA-------RKELNSLVAILRSCPDQPSEFLSDFIQQSTLGRSLFIHIVTYKCDDH------VPS---------AILKNLTDALGGHYHCYSPESELYTSRDVDELLAE 316          

HSP 6 Score: 67.781 bits (164), Expect = 6.850e-10
Identity = 61/278 (21.94%), Postives = 115/278 (41.37%), Query Frame = 3
Query: 3144 SKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSG-SMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQ 3974
            S+DW+  +SLK   L L  L+S                        G   + +       + +T   +  ++      +  Y +R+ WL  +SK+ FG+I  + V +L+D+S  S  P   E   +L +LI EQL  ++  Y ++ F           V    S+      W + L   G+++  +AL   L    +  +  +    PD  +E +   +Q   S+    + IH +++ C+D   +  LK L     G YH  C+  +  +++ R +++
Sbjct:   63 SEDWLAMHSLKFEKLTLADLIS-----------------------QGTVELEDQNNAVPKVHFTTQTIYHFTSRLSDTIELYQQRMRWLTENSKKAFGLIKGSRVGLLIDSSQVSSGPQTEEFQNDLTSLIDEQLSLKEKLY-VLTFGGTTNFLWPDPVEVSASTLQELKLWVKTLQPEGSSNLLQALKKVLARKELNSLVAILRSCPDQPSEFLSDFIQQ--STLGRSLFIHIVTYKCDDHVPSAILKNLTDALGGHYH--CYSPESELYTSRDVDE 312          
BLAST of von Willebrand factor A domain-containing protein 3A vs. UniProt/SwissProt
Match: sp|Q502W6|VWA3B_HUMAN (von Willebrand factor A domain-containing protein 3B OS=Homo sapiens OX=9606 GN=VWA3B PE=1 SV=3)

HSP 1 Score: 137.502 bits (345), Expect = 3.875e-31
Identity = 89/274 (32.48%), Postives = 133/274 (48.54%), Query Frame = 3
Query: 3144 SKDWMKKYSLKNMGLDLLRLVSGPECRHEEALII---------------PLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYH 3920
            SK W++KY LK   L L  +++    RH + ++                  +K V AKYC+         G+  H+  T  +   YS     AL R  +R++WL   S+ +FG +    + IL+DTS SM   +  +   +   I EQL K K  +N + F+ Q   +RE+L   +E +   A  W   +    +T+T  AL     D   Q IYLLTDG+PD   E V+  V+     R  ++PI+TISFN  DE AN FLK +A ++ G +H
Sbjct:  390 SKTWLQKYGLKAQKLSLYDVLADCSFRHADGVVDIKAKPENESVQTSAETNKKTVHAKYCSRFVHAPWKDGSLVHVNITKEKCKWYSERIHTALARIRRRIKWLQDGSQSLFGRLHNDCIYILIDTSHSMKSKLDLVKDKIIQFIQEQL-KYKSKFNFVKFDGQAVAWREQLAEVNEDNLEQAQSWIRDIKIGSSTNTLSALKTAFADKETQAIYLLTDGRPDQPPETVIDQVK-----RFQEIPIYTISFNYNDEIANRFLKEVAALTGGEFH 657          

HSP 2 Score: 99.7525 bits (247), Expect = 1.568e-19
Identity = 76/267 (28.46%), Postives = 128/267 (47.94%), Query Frame = 3
Query: 3138 ITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFP-IVNVKGTRKHLQYTVTELNKYSVEA-KKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHL---VACGNTDTTKALLITLEDPRIQGIYLLTDGK-PDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYH 3920
            I+S+ W++ + LK+  L L +++S     H E  +  L + V ++Y  GLFP +   +  R +     +EL    VE   +A+  Y +R++WL   S++IFGVI E  V I+LD  G +   + +L      ++ ++       +NII  + +  +++E      E S  +AI W E L   +         ALL    D  I+ IY    G  P+ S E++L+    I        P++T+SFN   E    FLK L+  ++ R+H
Sbjct:   34 ISSEKWLQLHGLKSNKLTLKQILSQIGFPHCEDYVASLGRPVASRYADGLFPQLYRAEDGRVYNLTAKSELIYQFVEHLTQAVESYKQRMDWLTSKSRQIFGVILEQCVTIVLDFGGILEGEL-DLCREALTMVLQEQVAHITEFNIIRVSQEPVKWQENATPVTEQSIATAISWVEKLTVELTVSEAGRLDALLEAGRDKTIESIYYFVVGDVPEESKELLLQRALEI------PCPVYTVSFNARGEGTIAFLKDLSAKTHSRFH 293          

HSP 3 Score: 91.6633 bits (226), Expect = 3.820e-17
Identity = 125/524 (23.85%), Postives = 223/524 (42.56%), Query Frame = 3
Query: 1938 YEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFR-------ESGIIESDDIRVLMAEI-----DLAVEYSRRTQQIINDY---KEKYPPSHSKKNEDIIKNAVELCRRNSSD-------NMVALMPPRQTSLSKARLKYL--SDKTEENLKIPKTLAYKSD-IDPRKSITNSKPPYR--------PVIQSAFYTEDKNSKGVVYRDYPGQNMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQY---TVTELNKYSVEAKKALIRYMKRL 3401
            Y    +   W DGS+ +V+    +   Y + +   +  + +RI WL  GS+ +FG +    + +++D S S    L  +   +   IQ+QLK K KFN + F     +++  L  VNE NL+ + SW+R +    S N L ALK  F        +   Q IYL T G PDQ   P    I++     +I I+T+ FN +D       I +R+         ++ +A  T G FH++            ++++D+ +L+ E+     DL       ++ +I D+    EK   S  +K    + +  E C +  SD       ++  L  P   S  K + K +  ++ T+ +L   +  + +S     RK   ++    R         ++ +  + +DK+S+ V                G  V       ++S++W+K Y L    L L+  +S     H    +  L+K+V +K    +FP+ +V      +        +LN Y  + ++A+  Y KRL
Sbjct:  448 YCSRFVHAPWKDGSLVHVNITKEKCKWYSERIHTALARIRRRIKWLQDGSQSLFGRLHNDCIYILIDTSHSMKSKLDLVKDKIIQFIQEQLKYKSKFNFVKFDGQAVAWREQLAEVNEDNLEQAQSWIRDIKIGSSTNTLSALKTAFA-------DKETQAIYLLTDGRPDQ---PPETVIDQVKRFQEIPIYTISFNYND------EIANRF---------LKEVAALTGGEFHFYNFGCKDPTPPEAVQNEDLTLLVKEMEQGHSDLEKMQDLYSESLIMDWWYNAEKDGDSKHQKEICSMISTPEKCAKPQSDVDSTQTSSLNMLKGPWGLSDQKVQKKKVLHAESTKTSLLRSQMSSLRSSACSERKDGLSNASSRRTALSDKEMSILLAEEWLDDKSSEKVTRE-------------GSQVYDHDSSDVSSENWLKTYGLVAKKLTLMDALSVAAVPHSSTYVPVLDKHVVSKVFDEVFPLAHVCNDTNKMTLINPQGAKLNIYKRKVEQAIQSYEKRL 933          

HSP 4 Score: 76.6406 bits (187), Expect = 1.448e-12
Identity = 86/321 (26.79%), Postives = 148/321 (46.11%), Query Frame = 3
Query: 1713 SSTIS-KPVKSRISQILTIDNLKEFSQFGSE----FEGIKESTDEKRFIEMFTENILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQV-EWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSG-VPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRE 2654
            SSTIS + ++ +   I T  +L E S   SE      G+K +       ++  + ILS+  +    +++ S+GR V S   +    Q+    DG V N+ A    ++++ + L + V+  +QR+ WL++ SR+IFG I+E+ V ++LD        L    ++L +++Q+Q+    +FNII  S     ++   T V E ++  + SW+  L    + +  G L  + E   D       + IY F  G VP++  E L+    +R L     ++TV FN               A    T   ++ L+  T  RFH F E
Sbjct:    7 SSTISEQQLQRQEGWINTKTDLAEQSLISSEKWLQLHGLKSN-------KLTLKQILSQIGFPHCEDYVASLGRPVASRYADGLFPQLYRAEDGRVYNLTAKSELIYQFVEHLTQAVESYKQRMDWLTSKSRQIFGVILEQCVTIVLDFGGILEGELDLCREALTMVLQEQVAHITEFNIIRVSQEPVKWQENATPVTEQSIATAISWVEKLTVELTVSEAGRLDALLEAGRDKT----IESIYYFVVGDVPEESKELLL----QRALEIPCPVYTVSFN---------------ARGEGTIAFLKDLSAKTHSRFHAFAE 297          

HSP 5 Score: 72.4034 bits (176), Expect = 2.724e-11
Identity = 52/226 (23.01%), Postives = 103/226 (45.58%), Query Frame = 3
Query:  681 YEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYS----SMTEELMYTSNDIDLLLLEIERTQEVLEKIE 1346
            Y  ++H A+    +RIKW   GS+ +FG +    + +LID+S +     ++   +D ++  + EQL  K   N   F        +    +N   +E+ +     +      N + ALK    +K    + L+    PDQ  + ++  V++    +++P + +S+    E  +  LK +A ++ G +H Y+      T      + D+ LL+ E+E+    LEK++
Sbjct:  475 YSERIHTALARIRRRIKWLQDGSQSLFGRLHNDCIYILIDTSHSMK--SKLDLVKDKIIQFIQEQLKYKSKFNFVKFDGQAVAWREQLAEVNEDNLEQAQSWIRDIKIGSSTNTLSALKTAFADKETQAIYLLTDGRPDQPPETVIDQVKRF---QEIPIYTISFNYNDEIANRFLKEVAALTGGEFHFYNFGCKDPTPPEAVQNEDLTLLVKEMEQGHSDLEKMQ 695          

HSP 6 Score: 60.8474 bits (146), Expect = 9.415e-8
Identity = 56/278 (20.14%), Postives = 115/278 (41.37%), Query Frame = 3
Query:  525 SSEDWLKTHNLDALQLTIEDLISK----------GKLGNPRPDE------------QTGTAYNCLVYDDFIVTDYEYKLHM--AIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSS---DANLGFGR---VISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEV-LLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTE 1265
            SSE WL+ H L + +LT++ ++S+            LG P                + G  YN     + I   Y++  H+  A+E Y +R+ W    SR++FG +    + +++D     +  L   R    +  Q+ + H+ +  + +     + +    T    Q        V     E  +   ++     + AL    ++K+I+ +   ++G  P++  ++L+    Q  L    P + VS+  + E   + LK ++  +H  +H ++  TE
Sbjct:   35 SSEKWLQLHGLKSNKLTLKQILSQIGFPHCEDYVASLGRPVASRYADGLFPQLYRAEDGRVYNLTAKSELI---YQFVEHLTQAVESYKQRMDWLTSKSRQIFGVILEQCVTIVLDFGGILEGELDLCREALTMVLQEQVAHITEFNIIRVSQEPVKWQENATPVTEQSIATAISWV-----EKLTVELTVSEAGRLDALLEAGRDKTIESIYYFVVGDVPEESKELLL----QRALEIPCPVYTVSFNARGEGTIAFLKDLSAKTHSRFHAFAERTE 300          
BLAST of von Willebrand factor A domain-containing protein 3A vs. TrEMBL
Match: A0A267FB75 (VWFA domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018061g1 PE=4 SV=1)

HSP 1 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 378/811 (46.61%), Postives = 515/811 (63.50%), Query Frame = 3
Query: 1860 NILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIIN----DYKEKYPPSHSKK-------------NEDIIKNAVELCRRNSSDNMVALMPPRQTSLSKARLKYLSDKTEENLKIPKTLAYKSDI------DPRKSITNSKPPYRPVIQSAFYTEDKNSKGVVYRDYPGQNMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKAL--LITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQDRTTVAADLLSIDPHYPPLPNLEGDDLVRLAKEIQLTRENLAKINYFRQLHIQLQKYQ-EQIKAEE 4214
             IL+ NAY     F+P I + V S V+EK M Q  W DGSV+NVH DLAQLFEYQK LG  VKL EQRI WL++ SR+IFGTI+ER ++ +LD+S +N+ YLVHI  S+++L++QQ+  KD FN++AF + +  F   +  V+E +LQ  W W+  L C+GSRNLLGAL+ V EN  +  H  Y +G+YLFTSG+PDQ  E + AY+EE+ +G D+++H VLFNVDDYD  G  IP RYA+ITKTA+ +R LAH T GRFHWFRE+GIIESDDIR++M+EID AV +SRR + +I+     Y+E +P  + K              + D                  AL PP+ T+ S AR  ++ D  +    +PK L  +         +P +S+  +    R  ++SAFYT ++N KG V  DY G     R+ +G+A IPDKE+ +TSK W K+YSL  +GLDL RLVSGP+CRHEE L+ PL K V AKYC+GLFP VNV+G  KHLQYT  EL  Y  E  +AL RY++RL WL+  S+R+FGV+ ET    L+D SGSM P+M EL L LKAL+WEQL+K ++++N+IAF+S +R +   L   +E SCH+A+ W + L + GNT T +AL      ++P +  IYLLTDGKPD ST  +L+++  + + R   + IHTISFNC D +AN FL+ LA  + GRYHKV  ++D ++F+ R++E+S+                         DP YP LP  EGDDL RLAKEI   R  LAK  YF+ L+ + ++ + E + A E
Sbjct:  497 QILAPNAYSYCEGFVPIIRKTVQSQVHEKVMAQFPWHDGSVKNVHVDLAQLFEYQKQLGHLVKLYEQRINWLASSSRKIFGTIVERNMLFLLDMSAANVNYLVHIQHSMRMLMEQQMSNKDYFNLVAFGSEVRFFSKTMVKVSEASLQAGWKWILGLECAGSRNLLGALRKVLENEEEEKHRVYPEGLYLFTSGIPDQGAEQVSAYLEEKAVGRDLRLHCVLFNVDDYDKDGA-IPGRYASITKTADSLRFLAHCTGGRFHWFRETGIIESDDIRLIMSEIDKAVNFSRRAKTLIDAVRSKYEEMFPDKYPKALGGGSGPESGGDDDPDGGSGGDGGGGGGGGAKPKALPPPKPTAKSLARQSFVRDALDSEPPVPKALGLRPGAASSVKAEPLESVRLN----RRCVKSAFYTGERNRKGQVISDYQG-GKSVRKAVGRAEIPDKEDQVTSKAWFKRYSLAKLGLDLYRLVSGPDCRHEEKLVKPLGKTVSAKYCSGLFPTVNVRGVTKHLQYTPVELQSYDAECVRALKRYLQRLHWLLSGSRRLFGVVVETRAVFLVDVSGSMAPYMEELKLALKALVWEQLYKFRVAFNLIAFSSGLRAWSPGLEPAEEDSCHAAVAWIDRLESMGNTATLEALEAAFATKEP-VDAIYLLTDGKPDTSTSTILRSINRLDAGR--NIAIHTISFNCCDATANNFLQCLASETGGRYHKVVEEFDAKLFAHRLLEESQLD-----------------------DPEYPNLPAFEGDDLSRLAKEIDSARRFLAKSKYFKDLYYETKRLRTENLGARE 1275          

HSP 2 Score: 343.199 bits (879), Expect = 4.920e-94
Identity = 157/360 (43.61%), Postives = 246/360 (68.33%), Query Frame = 3
Query:  435 PPNQFTVTSINQAHDLLRVQNNPAVSGDEQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEW 1514
            PP++  VT I+Q HDLLRV      + ++QS+++WL+ H+++AL+LT++DL+  GKL  P+PD +TG     L +D   V  +EY+LH A++ Y++RIKW L+GSRK+FG V G ++AV +D SDAN+ FGR  + Q  LLHL+DEQL  K+S+ +  FGT  + L+ + M++NCR +EE K    T  + GGCNL++AL+++++ + +D +L+++GS PDQ A +L  F  QL  GRDL  H V+++  S+  +S L+ +A ++ G +H YS+ ++EL+Y S+DI  LL EI+ TQEVL+KI  MR+G+  +     +N+I+ E+  +PQS  LP+P   ++PLK E  KF+P +S +W
Sbjct:  123 PPHELMVTQIDQTHDLLRVSGLEVGAAEQQSTQEWLQRHSVEALRLTVKDLVQLGKLTKPKPDAETGKPMPHLQFDAADVIQFEYRLHQAVQAYTERIKWCLRGSRKLFGLVQGERVAVCVDCSDANMSFGRAETLQQALLHLIDEQLSSKQSVYMMSFGTELQLLWPNVMDVNCRTLEEAKMFAMTRQAAGGCNLLKALRHLSRLRGVDSILIVVGSTPDQPADILEDFALQLSAGRDLRLHTVAFDCASQISNSGLRRLAEVTGGRFHCYSATSDELIYASSDISGLLQEIDTTQEVLKKIGEMRQGMLDSTLVSIMNEISMEVDKLPQSRFLPRPPGHDEPLKVEPAKFQPASSIDW 482          

HSP 3 Score: 96.2857 bits (238), Expect = 4.913e-16
Identity = 75/293 (25.60%), Postives = 139/293 (47.44%), Query Frame = 3
Query: 3114 VIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKY---CAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDP-----RI--QGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESAN--------------EFLKRLARMSNGRYH 3920
            V P K +  +S DW+ +  LK   +DL ++++     + E  +  + K V+++        FP  +  G+ K++   + +L +Y  +    +  Y +R+ WL  SS++IFG I E ++  LLD S +   ++  +  +++ L+ EQ    K  +N++AF S++R F + +V   E+S  +   W   L   G+ +   AL   LE+      R+  +G+YL T G PD   E V   ++     R  +  +H + FN +D   +              + L+ LA  + GR+H
Sbjct:  469 VEPAKFQPASSIDWLMENGLKANKMDLYQILAPNAYSYCEGFVPIIRKTVQSQVHEKVMAQFPWHD--GSVKNVHVDLAQLFEYQKQLGHLVKLYEQRINWLASSSRKIFGTIVERNMLFLLDMSAANVNYLVHIQHSMRMLM-EQQMSNKDYFNLVAFGSEVRFFSKTMVKVSEASLQAGWKWILGLECAGSRNLLGALRKVLENEEEEKHRVYPEGLYLFTSGIPDQGAEQVSAYLEEKAVGRDLR--LHCVLFNVDDYDKDGAIPGRYASITKTADSLRFLAHCTGGRFH 756          

HSP 4 Score: 82.4185 bits (202), Expect = 8.734e-12
Identity = 56/236 (23.73%), Postives = 114/236 (48.31%), Query Frame = 3
Query:  678 DYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYV------TKEKSIDEVLLILGS-CPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQS--------------EEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERT 1322
            +Y+ +L   +++Y +RI W    SRK+FG +    +  L+D S AN+ +  ++  Q ++  L+++Q+  K   N+  FG+  +F  +  + ++   ++   +    +   G  NL+ AL+ V       K +   E L +  S  PDQ A+ +  ++++  +GRDL  HCV +                   + +  L+++A  + G +H +    E  +  S+DI L++ EI++ 
Sbjct:  549 EYQKQLGHLVKLYEQRINWLASSSRKIFGTIVERNMLFLLDMSAANVNY--LVHIQHSMRMLMEQQMSNKDYFNLVAFGSEVRFFSKTMVKVSEASLQAGWKWILGLECAGSRNLLGALRKVLENEEEEKHRVYPEGLYLFTSGIPDQGAEQVSAYLEEKAVGRDLRLHCVLFNVDDYDKDGAIPGRYASITKTADSLRFLAHCTGGRFHWFR---ETGIIESDDIRLIMSEIDKA 779          

HSP 5 Score: 72.7886 bits (177), Expect = 7.846e-9
Identity = 64/296 (21.62%), Postives = 136/296 (45.95%), Query Frame = 3
Query: 3141 TSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTS-GSMTPHMPELILN-LKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQD 4022
            ++++W++++S++ + L +  LV              L K  + K      P         HLQ+   ++ ++     +A+  Y +R++W +  S+++FG++    VA+ +D S  +M+    E +   L  LI EQL  ++  Y +++F ++++     ++  +  +   A  +     A G  +  KAL        +  I ++    PD   +I+      + + R  +  +HT++F+C  + +N  L+RLA ++ GR+H  C+       S  +I  S   +    +IDT Q+
Sbjct:  153 STQEWLQRHSVEALRLTVKDLVQ-------------LGKLTKPK------PDAETGKPMPHLQFDAADVIQFEYRLHQAVQAYTERIKWCLRGSRKLFGLVQGERVAVCVDCSDANMSFGRAETLQQALLHLIDEQLSSKQSVY-MMSFGTELQLLWPNVMDVNCRTLEEAKMFAMTRQAAGGCNLLKALRHLSRLRGVDSILIVVGSTPDQPADILEDFALQLSAGRDLR--LHTVAFDCASQISNSGLRRLAEVTGGRFH--CYSAT----SDELIYASSDISGLLQEIDTTQE 420          

HSP 6 Score: 68.5514 bits (166), Expect = 1.356e-7
Identity = 62/261 (23.75%), Postives = 113/261 (43.30%), Query Frame = 3
Query: 1998 DLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKY---------LVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFE-NPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESG---IIESDDIRVLMAEIDLAVEYSRRTQQI 2741
            D A + +++  L + V+   +RI W   GSR++FG +   +V + +D S +N+ +         L+H++       Q          +++F   +      +  VN   L+++  +  +   +G  NLL AL+H+     VDS        I +     PDQ  + L  +  +   G D+++HTV F+               + I+ +   +R LA  T GRFH +  +    I  S DI  L+ EID   E  ++  ++
Sbjct:  198 DAADVIQFEYRLHQAVQAYTERIKWCLRGSRKLFGLVQGERVAVCVDCSDANMSFGRAETLQQALLHLIDEQLSSKQSVY-------MMSFGTELQLLWPNVMDVNCRTLEEAKMFAMTRQAAGGCNLLKALRHLSRLRGVDS--------ILIVVGSTPDQPADILEDFALQLSAGRDLRLHTVAFDC-------------ASQISNSG--LRRLAEVTGGRFHCYSATSDELIYASSDISGLLQEIDTTQEVLKKIGEM 428          

HSP 7 Score: 67.781 bits (164), Expect = 2.104e-7
Identity = 59/266 (22.18%), Postives = 116/266 (43.61%), Query Frame = 3
Query:  516 DEQSSEDWLKTHNLDALQLTIEDLISKGKLGNP----RPDEQTGTAYNC---------------LVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFK-KKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALK--YVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHR 1247
            D+ +S+ W K ++L  L L +  L+S     +     +P  +T +A  C               L Y    +  Y+ +   A++ Y +R+ W L GSR++FG V  ++   L+D S +   +   +     L  L+ EQL+K + + N+  F +  +                       + S+G    ++AL+  + TKE  +D + L+    PD     ++  + +L  GR++  H +S+       ++ L+ +A+ + G YH+
Sbjct:  938 DQVTSKAWFKRYSLAKLGLDLYRLVSGPDCRHEEKLVKPLGKTVSAKYCSGLFPTVNVRGVTKHLQYTPVELQSYDAECVRALKRYLQRLHWLLSGSRRLFGVVVETRAVFLVDVSGSMAPYMEELKLA--LKALVWEQLYKFRVAFNLIAFSSGLRAWSPGLEPAEEDSCHAAVAWIDRLESMGNTATLEALEAAFATKE-PVDAIYLLTDGKPDTSTSTILRSINRLDAGRNIAIHTISFNCCDATANNFLQCLASETGGRYHK 1200          
BLAST of von Willebrand factor A domain-containing protein 3A vs. TrEMBL
Match: A0A267GGY9 (VWFA domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018061g3 PE=4 SV=1)

HSP 1 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 378/811 (46.61%), Postives = 513/811 (63.26%), Query Frame = 3
Query: 1860 NILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIIN----DYKEKYPPSHSKK-------------NEDIIKNAVELCRRNSSDNMVALMPPRQTSLSKARLKYLSDKTEENLKIPKTLAYKSDIDPRKSITNSKPPY------RPVIQSAFYTEDKNSKGVVYRDYPGQNMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKAL--LITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQDRTTVAADLLSIDPHYPPLPNLEGDDLVRLAKEIQLTRENLAKINYFRQLHIQLQKYQ-EQIKAEE 4214
             IL+ NAY     F+P I + V S V+EK M Q  W DGSV+NVH DLAQLFEYQK LG  VKL EQRI WL++ SR+IFGTI+ER ++ +LD+S +N+ YLVHI  S+++L++QQ+  KD FN++AF + +  F   +  V+E +LQ  W W+  L C+GSRNLLGAL+ V EN  +  H  Y +G+YLFTSG+PDQ  E + AY+EE+ +G D+++H VLFNVDDYD  G  IP RYA+ITKTA+ +R LAH T GRFHWFRE+GIIESDDIR++M+EID AV +SRR + +I+     Y+E +P  + K              + D                  AL PP+ T+ S AR  ++ D  +    +PK L  +    P  + +    P       R  ++SAFYT ++N KG V  DY G     R+ +G+A IPDKE+ +TSK W K+YSL  +GLDL RLVSGP+CRHEE L+ PL K V AKYC+GLFP VNV+G  KHLQYT  EL  Y  E  +AL RY++RL WL+  S+R+FGV+ ET    L+D SGSM P+M EL L LKAL+WEQL+K ++++N+IAF+S +R +   L   +E SCH+A+ W + L + GNT T +AL      ++P +  IYLLTDGKPD ST  +L+++  + + R   + IHTISFNC D +AN FL+ LA  + GRYHKV  ++D ++F+ R++E+S+                         DP YP LP  EGDDL RLAKEI   R  LAK  YF+ L+ + ++ + E + A E
Sbjct:  370 QILAPNAYSYCEGFVPIIRKTVQSQVHEKVMAQFPWHDGSVKNVHVDLAQLFEYQKQLGHLVKLYEQRINWLASSSRKIFGTIVERNMLFLLDMSAANVNYLVHIQHSMRMLMEQQMSNKDYFNLVAFGSEVRFFSKTMVKVSEASLQAGWKWILGLECAGSRNLLGALRKVLENEEEEKHRVYPEGLYLFTSGIPDQGAEQVSAYLEEKAVGRDLRLHCVLFNVDDYDKDGA-IPGRYASITKTADSLRFLAHCTGGRFHWFRETGIIESDDIRLIMSEIDKAVNFSRRAKTLIDAVRSKYEEMFPDKYPKALGGGSGPESGGDDDPDGGGGGDGGGGGGGGAKPKALPPPKPTAKSLARQSFVRDALDSEPPVPKALGLR----PGAASSVKAEPLESVRLNRRCVKSAFYTGERNRKGQVISDYQG-GKSVRKAVGRAEIPDKEDQVTSKAWFKRYSLAKLGLDLYRLVSGPDCRHEEKLVKPLGKTVSAKYCSGLFPTVNVRGVTKHLQYTPVELQSYDAECVRALKRYLQRLHWLLSGSRRLFGVVVETRAVFLVDVSGSMAPYMEELKLALKALVWEQLYKFRVAFNLIAFSSGLRAWSPGLEPAEEDSCHAAVAWIDRLESMGNTATLEALEAAFATKEP-VDAIYLLTDGKPDTSTSTILRSINRLDAGR--NIAIHTISFNCCDATANNFLQCLASETGGRYHKVVEEFDAKLFAHRLLEESQLD-----------------------DPEYPNLPAFEGDDLSRLAKEIDSARRFLAKSKYFKDLYYETKRLRTENLGARE 1148          

HSP 2 Score: 335.109 bits (858), Expect = 4.538e-92
Identity = 155/354 (43.79%), Postives = 242/354 (68.36%), Query Frame = 3
Query:  453 VTSINQAHDLLRVQNNPAVSGDEQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEW 1514
            VT I+Q HDLLRV      + ++QS+++WL+ H+++AL+LT++DL+  GKL  P+PD +TG     L +D   V  +EY+LH A++ Y++RIKW L+GSRK+FG V G ++AV +D SDAN+ FGR  + Q  LLHL+DEQL  K+S+ +  FGT  + L+ + M++NCR +EE K    T  + GGCNL++AL+++++ + +D +L+++GS PDQ A +L  F  QL  GRDL  H V+++  S+  +S L+ +A ++ G +H YS+ ++EL+Y S+DI  LL EI+ TQEVL+KI  MR+G+  +     +N+I+ E+  +PQS  LP+P   ++PLK E  KF+P +S +W
Sbjct:    2 VTQIDQTHDLLRVSGLEVGAAEQQSTQEWLQRHSVEALRLTVKDLVQLGKLTKPKPDAETGKPMPHLQFDAADVIQFEYRLHQAVQAYTERIKWCLRGSRKLFGLVQGERVAVCVDCSDANMSFGRAETLQQALLHLIDEQLSSKQSVYMMSFGTELQLLWPNVMDVNCRTLEEAKMFAMTRQAAGGCNLLKALRHLSRLRGVDSILIVVGSTPDQPADILEDFALQLSAGRDLRLHTVAFDCASQISNSGLRRLAEVTGGRFHCYSATSDELIYASSDISGLLQEIDTTQEVLKKIGEMRQGMLDSTLVSIMNEISMEVDKLPQSRFLPRPPGHDEPLKVEPAKFQPASSIDW 355          

HSP 3 Score: 96.2857 bits (238), Expect = 4.498e-16
Identity = 75/293 (25.60%), Postives = 139/293 (47.44%), Query Frame = 3
Query: 3114 VIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKY---CAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDP-----RI--QGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESAN--------------EFLKRLARMSNGRYH 3920
            V P K +  +S DW+ +  LK   +DL ++++     + E  +  + K V+++        FP  +  G+ K++   + +L +Y  +    +  Y +R+ WL  SS++IFG I E ++  LLD S +   ++  +  +++ L+ EQ    K  +N++AF S++R F + +V   E+S  +   W   L   G+ +   AL   LE+      R+  +G+YL T G PD   E V   ++     R  +  +H + FN +D   +              + L+ LA  + GR+H
Sbjct:  342 VEPAKFQPASSIDWLMENGLKANKMDLYQILAPNAYSYCEGFVPIIRKTVQSQVHEKVMAQFPWHD--GSVKNVHVDLAQLFEYQKQLGHLVKLYEQRINWLASSSRKIFGTIVERNMLFLLDMSAANVNYLVHIQHSMRMLM-EQQMSNKDYFNLVAFGSEVRFFSKTMVKVSEASLQAGWKWILGLECAGSRNLLGALRKVLENEEEEKHRVYPEGLYLFTSGIPDQGAEQVSAYLEEKAVGRDLR--LHCVLFNVDDYDKDGAIPGRYASITKTADSLRFLAHCTGGRFH 629          

HSP 4 Score: 81.6481 bits (200), Expect = 1.440e-11
Identity = 56/236 (23.73%), Postives = 114/236 (48.31%), Query Frame = 3
Query:  678 DYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVT------KEKSIDEVLLILGS-CPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQS--------------EEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERT 1322
            +Y+ +L   +++Y +RI W    SRK+FG +    +  L+D S AN+ +  ++  Q ++  L+++Q+  K   N+  FG+  +F  +  + ++   ++   +    +   G  NL+ AL+ V       K +   E L +  S  PDQ A+ +  ++++  +GRDL  HCV +                   + +  L+++A  + G +H +    E  +  S+DI L++ EI++ 
Sbjct:  422 EYQKQLGHLVKLYEQRINWLASSSRKIFGTIVERNMLFLLDMSAANVNY--LVHIQHSMRMLMEQQMSNKDYFNLVAFGSEVRFFSKTMVKVSEASLQAGWKWILGLECAGSRNLLGALRKVLENEEEEKHRVYPEGLYLFTSGIPDQGAEQVSAYLEEKAVGRDLRLHCVLFNVDDYDKDGAIPGRYASITKTADSLRFLAHCTGGRFHWFR---ETGIIESDDIRLIMSEIDKA 652          

HSP 5 Score: 72.4034 bits (176), Expect = 8.533e-9
Identity = 64/296 (21.62%), Postives = 136/296 (45.95%), Query Frame = 3
Query: 3141 TSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTS-GSMTPHMPELILN-LKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQD 4022
            ++++W++++S++ + L +  LV              L K  + K      P         HLQ+   ++ ++     +A+  Y +R++W +  S+++FG++    VA+ +D S  +M+    E +   L  LI EQL  ++  Y +++F ++++     ++  +  +   A  +     A G  +  KAL        +  I ++    PD   +I+      + + R  +  +HT++F+C  + +N  L+RLA ++ GR+H  C+       S  +I  S   +    +IDT Q+
Sbjct:   26 STQEWLQRHSVEALRLTVKDLVQ-------------LGKLTKPK------PDAETGKPMPHLQFDAADVIQFEYRLHQAVQAYTERIKWCLRGSRKLFGLVQGERVAVCVDCSDANMSFGRAETLQQALLHLIDEQLSSKQSVY-MMSFGTELQLLWPNVMDVNCRTLEEAKMFAMTRQAAGGCNLLKALRHLSRLRGVDSILIVVGSTPDQPADILEDFALQLSAGRDLR--LHTVAFDCASQISNSGLRRLAEVTGGRFH--CYSAT----SDELIYASSDISGLLQEIDTTQE 293          

HSP 6 Score: 68.1662 bits (165), Expect = 1.678e-7
Identity = 62/261 (23.75%), Postives = 113/261 (43.30%), Query Frame = 3
Query: 1998 DLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKY---------LVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFE-NPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESG---IIESDDIRVLMAEIDLAVEYSRRTQQI 2741
            D A + +++  L + V+   +RI W   GSR++FG +   +V + +D S +N+ +         L+H++       Q          +++F   +      +  VN   L+++  +  +   +G  NLL AL+H+     VDS        I +     PDQ  + L  +  +   G D+++HTV F+               + I+ +   +R LA  T GRFH +  +    I  S DI  L+ EID   E  ++  ++
Sbjct:   71 DAADVIQFEYRLHQAVQAYTERIKWCLRGSRKLFGLVQGERVAVCVDCSDANMSFGRAETLQQALLHLIDEQLSSKQSVY-------MMSFGTELQLLWPNVMDVNCRTLEEAKMFAMTRQAAGGCNLLKALRHLSRLRGVDS--------ILIVVGSTPDQPADILEDFALQLSAGRDLRLHTVAFDC-------------ASQISNSG--LRRLAEVTGGRFHCYSATSDELIYASSDISGLLQEIDTTQEVLKKIGEM 301          

HSP 7 Score: 67.0106 bits (162), Expect = 3.912e-7
Identity = 59/266 (22.18%), Postives = 116/266 (43.61%), Query Frame = 3
Query:  516 DEQSSEDWLKTHNLDALQLTIEDLISKGKLGNP----RPDEQTGTAYNC---------------LVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFK-KKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALK--YVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHR 1247
            D+ +S+ W K ++L  L L +  L+S     +     +P  +T +A  C               L Y    +  Y+ +   A++ Y +R+ W L GSR++FG V  ++   L+D S +   +   +     L  L+ EQL+K + + N+  F +  +                       + S+G    ++AL+  + TKE  +D + L+    PD     ++  + +L  GR++  H +S+       ++ L+ +A+ + G YH+
Sbjct:  811 DQVTSKAWFKRYSLAKLGLDLYRLVSGPDCRHEEKLVKPLGKTVSAKYCSGLFPTVNVRGVTKHLQYTPVELQSYDAECVRALKRYLQRLHWLLSGSRRLFGVVVETRAVFLVDVSGSMAPYMEELKLA--LKALVWEQLYKFRVAFNLIAFSSGLRAWSPGLEPAEEDSCHAAVAWIDRLESMGNTATLEALEAAFATKE-PVDAIYLLTDGKPDTSTSTILRSINRLDAGRNIAIHTISFNCCDATANNFLQCLASETGGRYHK 1073          
BLAST of von Willebrand factor A domain-containing protein 3A vs. TrEMBL
Match: A0A267FB83 (VWFA domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018061g2 PE=4 SV=1)

HSP 1 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 378/811 (46.61%), Postives = 515/811 (63.50%), Query Frame = 3
Query: 1860 NILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIIN----DYKEKYPPSHSKK-------------NEDIIKNAVELCRRNSSDNMVALMPPRQTSLSKARLKYLSDKTEENLKIPKTLAYKSDI------DPRKSITNSKPPYRPVIQSAFYTEDKNSKGVVYRDYPGQNMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKAL--LITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQDRTTVAADLLSIDPHYPPLPNLEGDDLVRLAKEIQLTRENLAKINYFRQLHIQLQKYQ-EQIKAEE 4214
             IL+ NAY     F+P I + V S V+EK M Q  W DGSV+NVH DLAQLFEYQK LG  VKL EQRI WL++ SR+IFGTI+ER ++ +LD+S +N+ YLVHI  S+++L++QQ+  KD FN++AF + +  F   +  V+E +LQ  W W+  L C+GSRNLLGAL+ V EN  +  H  Y +G+YLFTSG+PDQ  E + AY+EE+ +G D+++H VLFNVDDYD  G  IP RYA+ITKTA+ +R LAH T GRFHWFRE+GIIESDDIR++M+EID AV +SRR + +I+     Y+E +P  + K              + D                  AL PP+ T+ S AR  ++ D  +    +PK L  +         +P +S+  +    R  ++SAFYT ++N KG V  DY G     R+ +G+A IPDKE+ +TSK W K+YSL  +GLDL RLVSGP+CRHEE L+ PL K V AKYC+GLFP VNV+G  KHLQYT  EL  Y  E  +AL RY++RL WL+  S+R+FGV+ ET    L+D SGSM P+M EL L LKAL+WEQL+K ++++N+IAF+S +R +   L   +E SCH+A+ W + L + GNT T +AL      ++P +  IYLLTDGKPD ST  +L+++  + + R   + IHTISFNC D +AN FL+ LA  + GRYHKV  ++D ++F+ R++E+S+                         DP YP LP  EGDDL RLAKEI   R  LAK  YF+ L+ + ++ + E + A E
Sbjct:  497 QILAPNAYSYCEGFVPIIRKTVQSQVHEKVMAQFPWHDGSVKNVHVDLAQLFEYQKQLGHLVKLYEQRINWLASSSRKIFGTIVERNMLFLLDMSAANVNYLVHIQHSMRMLMEQQMSNKDYFNLVAFGSEVRFFSKTMVKVSEASLQAGWKWILGLECAGSRNLLGALRKVLENEEEEKHRVYPEGLYLFTSGIPDQGAEQVSAYLEEKAVGRDLRLHCVLFNVDDYDKDGA-IPGRYASITKTADSLRFLAHCTGGRFHWFRETGIIESDDIRLIMSEIDKAVNFSRRAKTLIDAVRSKYEEMFPDKYPKALGGGSGPESGGDDDPDGGGGGDGGGGGGGGAKPKALPPPKPTAKSLARQSFVRDALDSEPPVPKALGLRPGAASSVKAEPLESVRLN----RRCVKSAFYTGERNRKGQVISDYQG-GKSVRKAVGRAEIPDKEDQVTSKAWFKRYSLAKLGLDLYRLVSGPDCRHEEKLVKPLGKTVSAKYCSGLFPTVNVRGVTKHLQYTPVELQSYDAECVRALKRYLQRLHWLLSGSRRLFGVVVETRAVFLVDVSGSMAPYMEELKLALKALVWEQLYKFRVAFNLIAFSSGLRAWSPGLEPAEEDSCHAAVAWIDRLESMGNTATLEALEAAFATKEP-VDAIYLLTDGKPDTSTSTILRSINRLDAGR--NIAIHTISFNCCDATANNFLQCLASETGGRYHKVVEEFDAKLFAHRLLEESQLD-----------------------DPEYPNLPAFEGDDLSRLAKEIDSARRFLAKSKYFKDLYYETKRLRTENLGARE 1275          

HSP 2 Score: 343.199 bits (879), Expect = 4.874e-94
Identity = 157/360 (43.61%), Postives = 246/360 (68.33%), Query Frame = 3
Query:  435 PPNQFTVTSINQAHDLLRVQNNPAVSGDEQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEW 1514
            PP++  VT I+Q HDLLRV      + ++QS+++WL+ H+++AL+LT++DL+  GKL  P+PD +TG     L +D   V  +EY+LH A++ Y++RIKW L+GSRK+FG V G ++AV +D SDAN+ FGR  + Q  LLHL+DEQL  K+S+ +  FGT  + L+ + M++NCR +EE K    T  + GGCNL++AL+++++ + +D +L+++GS PDQ A +L  F  QL  GRDL  H V+++  S+  +S L+ +A ++ G +H YS+ ++EL+Y S+DI  LL EI+ TQEVL+KI  MR+G+  +     +N+I+ E+  +PQS  LP+P   ++PLK E  KF+P +S +W
Sbjct:  123 PPHELMVTQIDQTHDLLRVSGLEVGAAEQQSTQEWLQRHSVEALRLTVKDLVQLGKLTKPKPDAETGKPMPHLQFDAADVIQFEYRLHQAVQAYTERIKWCLRGSRKLFGLVQGERVAVCVDCSDANMSFGRAETLQQALLHLIDEQLSSKQSVYMMSFGTELQLLWPNVMDVNCRTLEEAKMFAMTRQAAGGCNLLKALRHLSRLRGVDSILIVVGSTPDQPADILEDFALQLSAGRDLRLHTVAFDCASQISNSGLRRLAEVTGGRFHCYSATSDELIYASSDISGLLQEIDTTQEVLKKIGEMRQGMLDSTLVSIMNEISMEVDKLPQSRFLPRPPGHDEPLKVEPAKFQPASSIDW 482          

HSP 3 Score: 96.2857 bits (238), Expect = 4.709e-16
Identity = 75/293 (25.60%), Postives = 139/293 (47.44%), Query Frame = 3
Query: 3114 VIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKY---CAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDP-----RI--QGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESAN--------------EFLKRLARMSNGRYH 3920
            V P K +  +S DW+ +  LK   +DL ++++     + E  +  + K V+++        FP  +  G+ K++   + +L +Y  +    +  Y +R+ WL  SS++IFG I E ++  LLD S +   ++  +  +++ L+ EQ    K  +N++AF S++R F + +V   E+S  +   W   L   G+ +   AL   LE+      R+  +G+YL T G PD   E V   ++     R  +  +H + FN +D   +              + L+ LA  + GR+H
Sbjct:  469 VEPAKFQPASSIDWLMENGLKANKMDLYQILAPNAYSYCEGFVPIIRKTVQSQVHEKVMAQFPWHD--GSVKNVHVDLAQLFEYQKQLGHLVKLYEQRINWLASSSRKIFGTIVERNMLFLLDMSAANVNYLVHIQHSMRMLM-EQQMSNKDYFNLVAFGSEVRFFSKTMVKVSEASLQAGWKWILGLECAGSRNLLGALRKVLENEEEEKHRVYPEGLYLFTSGIPDQGAEQVSAYLEEKAVGRDLR--LHCVLFNVDDYDKDGAIPGRYASITKTADSLRFLAHCTGGRFH 756          

HSP 4 Score: 82.4185 bits (202), Expect = 8.025e-12
Identity = 56/236 (23.73%), Postives = 114/236 (48.31%), Query Frame = 3
Query:  678 DYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYV------TKEKSIDEVLLILGS-CPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQS--------------EEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERT 1322
            +Y+ +L   +++Y +RI W    SRK+FG +    +  L+D S AN+ +  ++  Q ++  L+++Q+  K   N+  FG+  +F  +  + ++   ++   +    +   G  NL+ AL+ V       K +   E L +  S  PDQ A+ +  ++++  +GRDL  HCV +                   + +  L+++A  + G +H +    E  +  S+DI L++ EI++ 
Sbjct:  549 EYQKQLGHLVKLYEQRINWLASSSRKIFGTIVERNMLFLLDMSAANVNY--LVHIQHSMRMLMEQQMSNKDYFNLVAFGSEVRFFSKTMVKVSEASLQAGWKWILGLECAGSRNLLGALRKVLENEEEEKHRVYPEGLYLFTSGIPDQGAEQVSAYLEEKAVGRDLRLHCVLFNVDDYDKDGAIPGRYASITKTADSLRFLAHCTGGRFHWFR---ETGIIESDDIRLIMSEIDKA 779          

HSP 5 Score: 72.7886 bits (177), Expect = 7.846e-9
Identity = 64/296 (21.62%), Postives = 136/296 (45.95%), Query Frame = 3
Query: 3141 TSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTS-GSMTPHMPELILN-LKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQD 4022
            ++++W++++S++ + L +  LV              L K  + K      P         HLQ+   ++ ++     +A+  Y +R++W +  S+++FG++    VA+ +D S  +M+    E +   L  LI EQL  ++  Y +++F ++++     ++  +  +   A  +     A G  +  KAL        +  I ++    PD   +I+      + + R  +  +HT++F+C  + +N  L+RLA ++ GR+H  C+       S  +I  S   +    +IDT Q+
Sbjct:  153 STQEWLQRHSVEALRLTVKDLVQ-------------LGKLTKPK------PDAETGKPMPHLQFDAADVIQFEYRLHQAVQAYTERIKWCLRGSRKLFGLVQGERVAVCVDCSDANMSFGRAETLQQALLHLIDEQLSSKQSVY-MMSFGTELQLLWPNVMDVNCRTLEEAKMFAMTRQAAGGCNLLKALRHLSRLRGVDSILIVVGSTPDQPADILEDFALQLSAGRDLR--LHTVAFDCASQISNSGLRRLAEVTGGRFH--CYSAT----SDELIYASSDISGLLQEIDTTQE 420          

HSP 6 Score: 68.5514 bits (166), Expect = 1.367e-7
Identity = 62/261 (23.75%), Postives = 113/261 (43.30%), Query Frame = 3
Query: 1998 DLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKY---------LVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFE-NPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESG---IIESDDIRVLMAEIDLAVEYSRRTQQI 2741
            D A + +++  L + V+   +RI W   GSR++FG +   +V + +D S +N+ +         L+H++       Q          +++F   +      +  VN   L+++  +  +   +G  NLL AL+H+     VDS        I +     PDQ  + L  +  +   G D+++HTV F+               + I+ +   +R LA  T GRFH +  +    I  S DI  L+ EID   E  ++  ++
Sbjct:  198 DAADVIQFEYRLHQAVQAYTERIKWCLRGSRKLFGLVQGERVAVCVDCSDANMSFGRAETLQQALLHLIDEQLSSKQSVY-------MMSFGTELQLLWPNVMDVNCRTLEEAKMFAMTRQAAGGCNLLKALRHLSRLRGVDS--------ILIVVGSTPDQPADILEDFALQLSAGRDLRLHTVAFDC-------------ASQISNSG--LRRLAEVTGGRFHCYSATSDELIYASSDISGLLQEIDTTQEVLKKIGEM 428          

HSP 7 Score: 68.1662 bits (165), Expect = 1.983e-7
Identity = 59/266 (22.18%), Postives = 116/266 (43.61%), Query Frame = 3
Query:  516 DEQSSEDWLKTHNLDALQLTIEDLISKGKLGNP----RPDEQTGTAYNC---------------LVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFK-KKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALK--YVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHR 1247
            D+ +S+ W K ++L  L L +  L+S     +     +P  +T +A  C               L Y    +  Y+ +   A++ Y +R+ W L GSR++FG V  ++   L+D S +   +   +     L  L+ EQL+K + + N+  F +  +                       + S+G    ++AL+  + TKE  +D + L+    PD     ++  + +L  GR++  H +S+       ++ L+ +A+ + G YH+
Sbjct:  938 DQVTSKAWFKRYSLAKLGLDLYRLVSGPDCRHEEKLVKPLGKTVSAKYCSGLFPTVNVRGVTKHLQYTPVELQSYDAECVRALKRYLQRLHWLLSGSRRLFGVVVETRAVFLVDVSGSMAPYMEELKLA--LKALVWEQLYKFRVAFNLIAFSSGLRAWSPGLEPAEEDSCHAAVAWIDRLESMGNTATLEALEAAFATKE-PVDAIYLLTDGKPDTSTSTILRSINRLDAGRNIAIHTISFNCCDATANNFLQCLASETGGRYHK 1200          
BLAST of von Willebrand factor A domain-containing protein 3A vs. TrEMBL
Match: A0A2B4SKJ8 (von Willebrand factor A domain-containing protein 3A OS=Stylophora pistillata OX=50429 GN=Vwa3a PE=4 SV=1)

HSP 1 Score: 696.427 bits (1796), Expect = 0.000e+0
Identity = 444/1319 (33.66%), Postives = 676/1319 (51.25%), Query Frame = 3
Query:  435 PPNQFTVTSINQAHDLLRVQNNPAVSGDEQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTDYEYKL-HMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFN--------DPLKFEVPKFEPRTSSEWXXXXXXXXXXXXXYSKNILSATMANNFERNPTSYPVIEMSDVFPLRESNFTRDANISRKSIQGRRFSSTISKPVKSRISQILTIDNLKEFSQFGSEFEGIKE-STDEKRFIEMFTENILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKEKY---PPSHSKKNEDIIKNAVELCRRNSSDNMVALMPPRQTSLSKARLKYLSD-------KTEENLKI-PKT-------------------------------LAYK-SDIDPRKSITNSKPPYRPV-------------IQSAFYTEDKNSKGVVYRDYPGQNMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQDRTTVAADLLSIDPHYPPLPNLEGDDLVRLAKEIQLTRENLAKINYFRQLHIQLQKYQ 4193
            PP   TVTS++QA+DL  V    A   + QSS DWL  H++ A  L+  +++   K G P                         KL H  + ++ K            FG V G  +A+L+D+SD+N G+GR+  FQ++L  L+DEQL  K+ +    FGT  K L+    ++NCR++EE      ++   GGCN++ ALK V K K ID ++L+LGSCPDQ  K++  +V++ L GR  P H V+Y+      +  LK +A  S G YH Y S ++E + T  D+ L+  E+++ QE+L+KI  M+ G+  ++       +   L  + QS  L +  S +         PL  E P F  RTS+EWL + GLKAK L LY   +L+          P S+  ++      +   N    + +  +S+   ++     K V   +   L  D           ++G+ + S ++K+   +    +L+ N++     +I +I R V S VYE++M Q +W DGSV+NVH D   LF+YQ+ L   V L ++R+ WLS G RRIFGT++E++VI++LD+SI     +  +   L++L++QQ+  K  +N I F +    F+  +   +   L+ +W WL    C GSRN L A +   EN  +  H    +GIY+ TSGVPD+  E +  ++ E + GTD  +HT+ + VDD D     IP +YA+   TAE +R +AH+  GRFHW+R   I+ESDD+  ++ E+D A  YS++    I    ++    PPS  K                   + + L PPR T+L+KAR+K            T E+L I P+T                               L +K   ++   S+  + PP + V             +Q AFYTE KN  G V+  YP +    RR I    IPDKEE +++++WM+ YS+  + LDL  +V   EC H +  +  L + V A+YC+ +FP V VKG  KHL     EL  Y  + +K L RY+KRL+WL+  S+R+FG + E +V +L+DTSGSM   M EL   + AL+W+Q+  +   +N+I F S++  ++  L++  + SC  A+ W     A G+T T +AL +  EDP +QGIYLLTDGKPDNST +VL+ V  + S R  +V  H ISFNC+D  AN+FL+ LA  + GRYH+   D +  MF+ R++ +      P +                        +P  EGDDL RLA EI L R+ L +   +R +    +K Q
Sbjct:   83 PPKALTVTSVSQAYDLQAVIGLEAAHAEGQSSSDWLGRHSVKAEALSFNEIM---KCGVP------------------------IKLIHSFVGIFCKF---------DAFGLVKGQNVALLVDASDSNCGYGRLQLFQESLGELIDEQLANKERLFFLSFGTQPKPLWTVVRDVNCRIVEESHWWADSLHPQGGCNVLSALKQVVKRKEIDSIVLVLGSCPDQNPKVICEYVRESLAGRHAPLHTVAYDCSISATNMFLKELAEQSGGRYHCYVSTSDEQIMTGTDLSLIADEMKKAQEILKKIHEMKNGVIGDKKIVMQTGVDTTLSTVQQSLELMRIPSEDGEILKTDSSPLVVEHPSFPARTSAEWLRQHGLKAKGLNLY--QVLA----------PNSFSYVDGY----ISAINRNVHSLVYERSMAQFKWHDGSVKNV--HVDPTLLFD-----------YQGVFQLSVEKKQAKGLNLYQVLAPNSFSYVDGYISAINRNVHSLVYERSMAQFKWHDGSVKNVHVDPTLLFDYQRHLESAVHLYKRRVDWLSVGCRRIFGTVVEKRVIVLLDMSICMSPAVPKLQDHLRLLLEQQMANKTSYNFICFGDKTEMFRPVMLEPSPEYLEATWKWLLQRGCGGSRNFLDAFRKAVENDEEKAHGIEVEGIYVITSGVPDEPKEVVSGFLREALAGTDTGVHTIYYEVDDED-GLIAIPGKYADRGNTAECLRQMAHAVNGRFHWYRSGAIVESDDLGAVLNEMDKAFNYSQKIGDSIESENQQLVPRPPSAGK-------------------SRLPLTPPRHTALTKARMKKKGGCALPPIKATNEDLSIRPQTAGSSRPSSSTRGKKTRPQSASSQTKESTLKALQWKPPTVNSTSSLIPAPPPAKNVVKERRPSSGGVKAVQQAFYTEFKNETGAVFTQYPSKK-KLRRPIKHPFIPDKEESVSTREWMRHYSISKLKLDLNNIVGTAECSHAKGKVSSLGQSVTARYCS-IFPSVEVKGVVKHLHLLPHELEDYEDQVEKVLRRYVKRLQWLLSGSRRVFGTVVEKNVVVLIDTSGSMVSSMDELKREVAALVWDQIRHQATKFNLIRFASEVVSWKPSLMSTSDDSCQDAVEWVSGFDANGSTRTLQALQMAFEDPEVQGIYLLTDGKPDNSTTMVLREVAKLNSGRNVRV--HCISFNCDDSVANKFLQLLASQAGGRYHRCQGDPNGHMFTHRLLAEGFHEDEPLS------------------------MPVFEGDDLRRLASEIALCRKFLLQSRSYRTIADPTKKLQ 1288          
BLAST of von Willebrand factor A domain-containing protein 3A vs. TrEMBL
Match: A0A1S3KGN7 (von Willebrand factor A domain-containing protein 3A OS=Lingula unguis OX=7574 GN=LOC106181528 PE=4 SV=1)

HSP 1 Score: 632.869 bits (1631), Expect = 0.000e+0
Identity = 352/805 (43.73%), Postives = 491/805 (60.99%), Query Frame = 3
Query: 1806 EGIKESTDEKRFIEMFTENILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYPPSHSKKNEDIIKNAVELCRRNSSDNMVALMPPRQTSLSKARLKYLSDKTEENLKIPKTLAY-----KSDIDPR----KSITNSKPP-------YRPVIQSAFYTEDKNSKGVVYRDYPGQNMHS-RRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQDRTTVAADLLSIDPHYPPLPNLEGDDLVRLAKEIQLTRENLAKINYFRQL 4169
            E +K++  + + ++++   +LS NAY  K EFIP I + V S V+EKAM Q  W DG+VRNVH DL Q+FEYQK LG  VK+ E+RI WLS+GSR+IFG+I+E+ V+L++DLS+ N  YL+HI  SL++L++QQ+  ++ FNII F++    ++  +      NLQ +W W+  L C GSRN L A +   EN  +  H+   +G+YLFTSGVPDQ  +    Y+EE   G  IK+HT LFNVDDYD +G  IP RYANITKTAE +R LAHST GRFHWFRE+G+IESDD++ ++AEID A+ +S++   ++   K+KY     +  E+ ++          S N   L PP+  +LS ARLK +S+  +E+  +PK L +     K  I P        T++K P       Y+      FYT+DKN  GVV++ YP  NM S R+ I  A+IP+KEE +T+K+W++ Y L  + LDL +LV   +CRH +  +  L K V AKYC  +FP VN+ GT KHLQ    E+ +Y    +K L RY+KRL++L+  S+R+FGVI    VAIL+DTSGSM  HM EL   L +LIW+QL+K    +N+I F+    ++ E++V   ES+CH AI W   LVA GNT T  AL    ED  ++ IYLLTDGKPD+ST +VL+ V  + + R   V ++TISFNC D +AN FLK LA  ++GRYH+V  D+D   F+ +++ +    A                         YP LP  +GDDL RL  EI   R  L +   F +L
Sbjct:  428 EWLKQNGLKAKHLDLY--QVLSPNAYSFKEEFIPVIRKTVQSQVHEKAMAQFHWQDGTVRNVHVDLTQMFEYQKHLGSTVKVFEKRIEWLSSGSRKIFGSIVEKNVVLLIDLSLPNANYLIHIQHSLRLLLEQQISNREYFNIIGFTSRAEMWRPTMVKPTPENLQSAWRWVLGLQCGGSRNFLEAYRMTVENEEELKHHIEVEGVYLFTSGVPDQPHDVCAQYVEESCSGRGIKLHTALFNVDDYDSAGA-IPGRYANITKTAESLRNLAHSTGGRFHWFRETGVIESDDVQEILAEIDRAINFSQKCAMLVESVKKKYKAKELEYYEEQLQALPSSV--TPSKNKNTLPPPKMNALSLARLK-ISESQDES--VPKALTWRPSSAKDSIAPSPPKGNRPTSAKDPMMKVKSTYKKTTTQQFYTDDKNGIGVVFKRYP--NMKSVRKEIKLAMIPEKEEIMTTKEWLRLYGLSKLKLDLTKLVGSQDCRHVQGEVRTLNKIVPAKYC-DIFPHVNIGGTIKHLQLLPHEILEYQEMLEKVLRRYLKRLQFLLSGSRRVFGVICHKRVAILIDTSGSMDQHMEELRKELASLIWDQLYKLGAKFNLIRFSHTCEKWEEKMVDATESACHDAIRWVSKLVASGNTCTLDALDRAFEDEDLEAIYLLTDGKPDHSTSMVLREVAKMNTDR--HVAVNTISFNCTDSTANNFLKMLAAETSGRYHRVHSDFDAHRFAHKLLTEGFKEA------------------------EYPHLPEFDGDDLRRLGTEIAQARRFLTQARSFMEL 1195          

HSP 2 Score: 327.405 bits (838), Expect = 7.378e-89
Identity = 151/359 (42.06%), Postives = 245/359 (68.25%), Query Frame = 3
Query:  438 PNQFTVTSINQAHDLLRVQNNPAVSGDEQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEW 1514
            P++ TVT +NQ   L + +NN A   +EQ+SE+WL+ H+++  +LT++DL++KGK G P  D  TG     L +D   + ++EY+LHM IE Y+KRIKW L GS++MFG V G+K+AV+IDSSDAN GFGR+ +FQ+ L+HL+DEQL  K+ + +  FG++ +  +Q   ++N R ++E K+  + +   GGCNL++A+K++ + + I++++LILGS PDQ +++L  ++ Q+ +G+  P H V+++  +   +  LK +A  S G YH Y+S +EE +YT +DI LLL EI+  Q+V+ KI+ MR+G+  +      N+I+ E+  +PQS+ LP+P   ++PL+ E+PKF  +TS EW
Sbjct:   71 PHELTVTHVNQTWSLNKGKNNTASKAEEQTSEEWLQNHSVEESKLTMKDLVAKGKPGKPTYDRTTGKVQQHLTFDAKDINEFEYRLHMQIEHYTKRIKWMLNGSKRMFGLVKGNKVAVVIDSSDANCGFGRLSNFQEALIHLIDEQLSGKQKLYLVKFGSDMEKCWQHVRDINHRTLDEAKDFVANLRPSGGCNLLKAMKHIYRLQDINQIVLILGSVPDQSSEVLTDYILQMGVGKHEPLHTVAFDCSNHLTNLTLKTLAAESRGRYHCYTSTSEEQIYTGSDISLLLKEIKNAQDVINKIKEMRKGMMGDALVSIENEISMEVTQVPQSQFLPRPPGHSNPLRIEMPKFLAKTSEEW 429          

HSP 3 Score: 107.071 bits (266), Expect = 2.610e-19
Identity = 78/282 (27.66%), Postives = 140/282 (49.65%), Query Frame = 3
Query: 3141 TSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVK-GTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDP-------RIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCED-ESAN-------------EFLKRLARMSNGRYH 3920
            TS++W+K+  LK   LDL +++S      +E  I  + K V+++         + + GT +++   +T++ +Y       +  + KR+EWL   S++IFG I E +V +L+D S     ++  +  +L+ L+ +Q+  R+  +NII F S+   +R  +V P   +  SA  W   L   G+ +  +A  +T+E+         ++G+YL T G PD   ++  + V+   S R  K  +HT  FN +D +SA              E L+ LA  + GR+H
Sbjct:  425 TSEEWLKQNGLKAKHLDLYQVLSPNAYSFKEEFIPVIRKTVQSQVHEKAMAQFHWQDGTVRNVHVDLTQMFEYQKHLGSTVKVFEKRIEWLSSGSRKIFGSIVEKNVVLLIDLSLPNANYLIHIQHSLRLLLEQQISNREY-FNIIGFTSRAEMWRPTMVKPTPENLQSAWRWVLGLQCGGSRNFLEAYRMTVENEEELKHHIEVEGVYLFTSGVPDQPHDVCAQYVEESCSGRGIK--LHTALFNVDDYDSAGAIPGRYANITKTAESLRNLAHSTGGRFH 703          

HSP 4 Score: 81.6481 bits (200), Expect = 1.353e-11
Identity = 71/281 (25.27%), Postives = 128/281 (45.55%), Query Frame = 3
Query: 3105 GKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKG-TRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTS------GSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKAL--LITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYH 3920
            GK     K E  TS++W++ +S++   L +  LV                    AK   G        G  ++HL +   ++N++       +  Y KR++W++  SKR+FG++    VA+++D+S      G ++     LI     LI EQL  ++  Y ++ F S + +  + +   +  +   A  +  +L   G  +  KA+  +  L+D  I  I L+    PD S+E++   +  +   +    P+HT++F+C +   N  LK LA  S GRYH
Sbjct:   88 GKNNTASKAEEQTSEEWLQNHSVEESKLTMKDLV--------------------AKGKPGKPTYDRTTGKVQQHLTFDAKDINEFEYRLHMQIEHYTKRIKWMLNGSKRMFGLVKGNKVAVVIDSSDANCGFGRLSNFQEALI----HLIDEQLSGKQKLY-LVKFGSDMEKCWQHVRDINHRTLDEAKDFVANLRPSGGCNLLKAMKHIYRLQD--INQIVLILGSVPDQSSEVLTDYILQMGVGKHE--PLHTVAFDCSNHLTNLTLKTLAAESRGRYH 339          

HSP 5 Score: 77.7962 bits (190), Expect = 1.834e-10
Identity = 73/259 (28.19%), Postives = 123/259 (47.49%), Query Frame = 3
Query: 1998 DLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKY--LVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWF---RESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKE 2759
            D   + E++  L  Q++   +RI W+  GS+R+FG +   KV +++D S +N  +  L +  ++L  LI +QL  K K  ++ F + +      +  +N   L ++  ++ +L  SG  NLL A+KH++         D  Q I L    VPDQ  E L  YI +  +G    +HTV F+  ++            N+T     ++ LA  ++GR+H +    E  I    DI +L+ EI       +  Q +IN  KE
Sbjct:  145 DAKDINEFEYRLHMQIEHYTKRIKWMLNGSKRMFGLVKGNKVAVVIDSSDANCGFGRLSNFQEALIHLIDEQLSGKQKLYLVKFGSDMEKCWQHVRDINHRTLDEAKDFVANLRPSGGCNLLKAMKHIYR------LQDINQ-IVLILGSVPDQSSEVLTDYILQMGVGKHEPLHTVAFDCSNH----------LTNLT-----LKTLAAESRGRYHCYTSTSEEQIYTGSDISLLLKEI-------KNAQDVINKIKE 374          

HSP 6 Score: 68.9366 bits (167), Expect = 1.026e-7
Identity = 70/344 (20.35%), Postives = 141/344 (40.99%), Query Frame = 3
Query:  522 QSSEDWLKTHNLDALQLTIEDLISKG-------------KLGNPRPDE--------QTGTAYNCLVYDDFIVTDYEYKLHMA--IEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEK-------SIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEE-----------VSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQS 1430
            ++SE+WLK + L A  L +  ++S               K    +  E        Q GT  N  V+ D +   +EY+ H+   ++++ KRI+W   GSRK+FG +    + +LID S  N  +  +I  Q +L  LL++Q+  ++  NI  F +  +      +      ++        +   G  N ++A +   + +        ++ V L     PDQ   +   +V++   GR +  H   +     +           ++   + +  ++H    R+    E  +  S+D+  +L EI+R     +K  ++   +     +  +    E+L+ +P S
Sbjct:  424 KTSEEWLKQNGLKAKHLDLYQVLSPNAYSFKEEFIPVIRKTVQSQVHEKAMAQFHWQDGTVRN--VHVD-LTQMFEYQKHLGSTVKVFEKRIEWLSSGSRKIFGSIVEKNVVLLIDLSLPNANY--LIHIQHSLRLLLEQQISNREYFNIIGFTSRAEMWRPTMVKPTPENLQSAWRWVLGLQCGGSRNFLEAYRMTVENEEELKHHIEVEGVYLFTSGVPDQPHDVCAQYVEESCSGRGIKLHTALFNVDDYDSAGAIPGRYANITKTAESLRNLAHSTGGRFHWFRETGVIESDDVQEILAEIDRAINFSQKCAMLVESVKKKYKAKELEYYEEQLQALPSS 762          

HSP 7 Score: 63.5438 bits (153), Expect = 4.647e-6
Identity = 52/263 (19.77%), Postives = 110/263 (41.83%), Query Frame = 3
Query:  525 SSEDWLKTHNLDALQLTIEDLISK------------------GKLGNPRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFK-KKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSS 1256
            ++++WL+ + L  L+L +  L+                     K  +  P    G     L      + +Y+  L   +  Y KR+++ L GSR++FG +   ++A+LID+S +      +   +  L  L+ +QL+K     N+  F    +   +  ++       +     S + + G    + AL    +++ ++ + L+    PD    M++  V ++   R +  + +S+       ++ LK +A  + G YHR  S
Sbjct:  880 TTKEWLRLYGLSKLKLDLTKLVGSQDCRHVQGEVRTLNKIVPAKYCDIFPHVNIGGTIKHLQLLPHEILEYQEMLEKVLRRYLKRLQFLLSGSRRVFGVICHKRVAILIDTSGSM--DQHMEELRKELASLIWDQLYKLGAKFNLIRFSHTCEKWEEKMVDATESACHDAIRWVSKLVASGNTCTLDALDRAFEDEDLEAIYLLTDGKPDHSTSMVLREVAKMNTDRHVAVNTISFNCTDSTANNFLKMLAAETSGRYHRVHS 1140          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Cavefish
Match: ENSAMXT00000000373.2 (von Willebrand factor A domain containing 3A [Source:NCBI gene;Acc:103035332])

HSP 1 Score: 475.707 bits (1223), Expect = 9.885e-146
Identity = 274/786 (34.86%), Postives = 433/786 (55.09%), Query Frame = 3
Query: 1860 NILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLS-TGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDV-SGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYPPSHSKKNEDIIKNAVELCRRNSSDNMVA----LMPPRQTSLSKARLKYLSDKTEENLK-------IPKTLAYKSDIDPRKSITNSKPPYRPVIQSAFYTEDKNSKGVVYRDYPGQNMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQDRTTVAADLLSID---PHYPPLPNLEGDDLVRLAKEIQLTRENLAKINYFRQL 4169
             +L+ N Y  K  F+P + + V S+V+EKAM+Q EW DG+V+NVH DL  L  YQK L E  +++E R  WLS TGSR+I+G + E++V ++LD+S  N  Y +HI  ++ +L+Q+QL +   FNI AF + I  +K  +      NLQD W W++ L C G R  L A++H  E  + S  +    G+YLFT+G+PDQ    +  Y+ E      +KIH +LF  ++    S TP   RY    +TA+++R LAH++KGRFHW  ++GI+ESDD+  L+ E++ A  Y ++  ++++   ++   S S+ + +  ++  E C              L PPR T LS ARL+    K  +  +       IP      S   P + + ++K     + QS FY ED N  G V++ Y  +    ++ I    IP +E+  ++K W+K + +++  LDL +LVSGPEC H + L+  + K V AKYCA +FP V V G+ +HL  +  EL +Y ++ +K L RY +R++WL+  S+R+FG + E  V ++LD SGSM P +PEL   L +LIWEQL    + ++++AF+ ++R ++  LV   E  C  A+ W   L   G T + +AL          G+YL+TDG+ D S  +VLK  + + + +   + IHTI+FNC+D +A EFL++LA  + GR+H+                               +  T  A++LL+          LP+ EGDDL RL++E++  R    +   FR++
Sbjct:  398 QVLAPNVYSPKESFVPILRKTVHSTVHEKAMVQFEWHDGTVKNVHVDLPLLQNYQKRLLEAEQVLEDRAAWLSSTGSRQIWGAVCEQRVHVLLDMSAMNNHYQLHIQHAVHLLLQEQLPSTHSFNITAFGSDIKQWKEQMVPPTSENLQDVWQWIQGLECGGDRYTLAAIQHAAEAEL-STDSSLTSGVYLFTTGMPDQDPVTVSTYMSEVCNNPRLKIHVILFAGENMLARSLTP---RYVTWAETAQVLRGLAHASKGRFHWITDTGIVESDDVIALIGEMETAANYWQKCCELLDSLVQR---SSSRMDAEEAQSQ-ECCNPVQCSQTWTRGHKLPPPRPTQLSLARLESKEGKRSQTWRPSSAKAVIPPAHPVDS-WKPARQVNSAKQRKTKITQSVFYLEDGN-LGTVFKKYL-KPKSVQKYISTVTIPKQEDICSTKQWLKSFGIRSQKLDLHKLVSGPECTHRKKLVRTVHKSVSAKYCA-IFPSVQVNGSVRHLLLSPAELKQYLIQVEKVLQRYAQRMQWLLSGSRRVFGCVVERAVCVVLDVSGSMAPCVPELQKELASLIWEQLHANSVRFSMVAFSGEVRVWQVELVEASEERCKEAVQWLGQLSTHGGTSSLQALQAGCAFGDSLGVYLITDGRNDCSCSLVLKEAERLTAGK--HITIHTIAFNCQDRTAKEFLRKLAHKTGGRFHEA----------------------------PSESHTAAASELLTSSFSVGEDSELPSFEGDDLRRLSEEMEKLRMFQKQARAFREI 1141          

HSP 2 Score: 166.777 bits (421), Expect = 3.742e-41
Identity = 107/341 (31.38%), Postives = 174/341 (51.03%), Query Frame = 3
Query:  516 DEQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTD--------YEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEW 1514
            D +SS +WL+  +L++  LT+  L S              TA      DD + T         +E +L+   ++Y  RI+W  QGSRKMFG V GS+L VLID SD N    R+   Q +LL L++EQ   KK ++   FGT    L+     +    ++E ++    +   G CNL+QALK       +D +L+ILGSCPDQ+   +  ++ Q +  +    H V+Y T ++     +K IA ++ G YH +S+    ++ +S+D++ L  EI+  ++VL+ I  M  G   +   P +++I+E+L  +  S+    P   +  L  + P   P TS+EW
Sbjct:   56 DWRSSVEWLEECSLNSYGLTLTHLFS-----------HCSTAATS-SRDDGVSTQLEIDSKKLFETQLYQVTDLYHSRIQWLNQGSRKMFGIVKGSRLGVLIDVSDVNCSEERLEDLQHHLLLLIEEQFRMKKVLHFMSFGTELSSLWTGPKEVTPLRLKESQQWVLQLEPSGSCNLLQALKTACSHTQLDSLLIILGSCPDQDTDSIFNYMTQEVQEKVTSIHVVAYNTCNQVAIENVKNIAKVTEGRYHIFSAAL-GVVDSSSDLEPLWAEIKSARDVLDHIHCMSHGQLEDLTVPVMSEISEDLDCLSLSDLKSDPHDGSAALCIQPPTLLPTTSAEW 383          

HSP 3 Score: 117.472 bits (293), Expect = 5.324e-26
Identity = 169/715 (23.64%), Postives = 297/715 (41.54%), Query Frame = 3
Query:  633 GTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQ-GSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTK-EKSIDE-----VLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQS-------------EEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEK-IELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFND------------PLKFEVPKFEPRT---SSEWXXXXXXXXXXXXXYSKNILSATMANNFERNPTSYPVIEMSDVFPLRESNFTR--DANISRKSIQGRRFSSTISKPVKSRISQILTIDNLKEFSQFGSEFEGIK-----ESTDEKRFIEMFTENILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXX-XXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTA-EIMRMLAHSTKGRFH 2642
            GT  N  V D  ++ +Y+ +L  A ++   R  W    GSR+++G V   ++ VL+D S  N  +   I    +L  LL EQL    S NI  FG++ K   +  +      ++++ +    +   G    + A+++  + E S D      V L     PDQ+   +  ++ ++     L  H + +  ++              E + +L+ +A  S G +H    +T+  +  S+D+  L+ E+E      +K  EL+   +   R+S  ++  AEE     QS+    P+  +             P +  + + E +    S  W   S            +   A   N+ ++  T         VF L + N        +  KS+Q  ++ ST++ P +  I    T   LK F     + +  K     E T  K+ +    +++ +K          PS              +QV   +GSVR++    A+L +Y   + + ++   QR+ WL +GSRR+FG ++ER V ++LD+S S    +  + + L  LI +Q      +F+++AFS  +  ++  L   +E   +++  WL  L+  G  + L AL+            D + G+YL T G  D     ++   E    G  I IHT+ FN  D                +TA E +R LAH T GRFH
Sbjct:  436 GTVKNVHV-DLPLLQNYQKRLLEAEQVLEDRAAWLSSTGSRQIWGAVCEQRVHVLLDMSAMNNHYQLHIQHAVHL--LLQEQLPSTHSFNITAFGSDIKQWKEQMVPPTSENLQDVWQWIQGLECGGDRYTLAAIQHAAEAELSTDSSLTSGVYLFTTGMPDQDPVTVSTYMSEVCNNPRLKIHVILFAGENMLARSLTPRYVTWAETAQVLRGLAHASKGRFHW---ITDTGIVESDDVIALIGEMETAANYWQKCCELLDSLV--QRSSSRMD--AEE----AQSQECCNPVQCSQTWTRGHKLPPPRPTQLSLARLESKEGKRSQTWRPSSAKAVIPPAHPVDSWKPARQVNSAKQRKTKI----TQSVFYLEDGNLGTVFKKYLKPKSVQ--KYISTVTIPKQEDICS--TKQWLKSFGIRSQKLDLHKLVSGPECTHRKKLVRTVHKSVSAKYC-----AIFPS--------------VQV---NGSVRHLLLSPAELKQYLIQVEKVLQRYAQRMQWLLSGSRRVFGCVVERAVCVVLDVSGSMAPCVPELQKELASLIWEQLHANSVRFSMVAFSGEVRVWQVELVEASEERCKEAVQWLGQLSTHGGTSSLQALQ------AGCAFGD-SLGVYLITDGRNDCSCSLVLKEAERLTAGKHITIHTIAFNCQD----------------RTAKEFLRKLAHKTGGRFH 1083          

HSP 4 Score: 72.0182 bits (175), Expect = 5.013e-12
Identity = 101/408 (24.75%), Postives = 172/408 (42.16%), Query Frame = 3
Query: 1971 DGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNI--KYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRES-GIIE-SDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYP-PSHSKKNEDIIKNAVELCRRNSSDNMVALM--PPRQTSLSKARLKYLSDKTEENLKIPKTLAYKSDIDPRKSITNSKPPYRPVIQSA--------FYTEDKNSKGVVYRDYP-GQNMHSRRGIGKAVIPDKEEWITS 3146
            DG    +  D  +LFE Q  L +   L   RI WL+ GSR++FG +   ++ +++D+S  N   + L  +   L +LI++Q + K   + ++F   +SS   G   V    L++S  W+  L  SGS NLL ALK        +  +     + +     PDQ  + +  Y+ + V      IH V +N  +                   E ++ +A  T+GR+H F  + G+++ S D+  L AEI  A +       + +   E    P  S+ +ED+   ++   + +  D   AL   PP     + A     +    + L + + LA  +   P++S     P  R  + S         F   D   K  V+ D P  QN   R    + V+ D+  W++S
Sbjct:   93 DGVSTQLEIDSKKLFETQ--LYQVTDLYHSRIQWLNQGSRKMFGIVKGSRLGVLIDVSDVNCSEERLEDLQHHLLLLIEEQFRMKKVLHFMSFGTELSSLWTGPKEVTPLRLKESQQWVLQLEPSGSCNLLQALK-------TACSHTQLDSLLIILGSCPDQDTDSIFNYMTQEVQEKVTSIHVVAYNTCN---------------QVAIENVKNIAKVTEGRYHIFSAALGVVDSSSDLEPLWAEIKSARDVLDHIHCMSHGQLEDLTVPVMSEISEDLDCLSLSDLKSDPHDGSAALCIQPPTLLPTTSAEWLKTNGMKAKKLSLYQVLA-PNVYSPKESFV---PILRKTVHSTVHEKAMVQFEWHDGTVKN-VHVDLPLLQNYQKRLLEAEQVLEDRAAWLSS 471          

HSP 5 Score: 62.3882 bits (150), Expect = 4.220e-9
Identity = 62/309 (20.06%), Postives = 131/309 (42.39%), Query Frame = 3
Query:  525 SSEDWLKTHNLDALQLTIEDLISKGKLGN----PRPDEQTGTAYNCLVYDDFIVT--------------DYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKK-SINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHR-----YSSMTEELMYTS----NDIDLLLLE---IERTQEVLEKIELMRR 1358
            S++ WLK+  + + +L +  L+S  +  +     R   ++ +A  C ++    V                Y  ++   ++ Y++R++W L GSR++FG V    + V++D S +      V   Q  L  L+ EQL       ++  F    +    + +  +    +E  +    +S+ GG + +QAL+          V LI     D    +++   ++L  G+ +  H +++  Q       L+ +A  + G +H      +++   EL+ +S     D +L   E   + R  E +EK+ + ++
Sbjct:  827 STKQWLKSFGIRSQKLDLHKLVSGPECTHRKKLVRTVHKSVSAKYCAIFPSVQVNGSVRHLLLSPAELKQYLIQVEKVLQRYAQRMQWLLSGSRRVFGCVVERAVCVVLDVSGSMAPC--VPELQKELASLIWEQLHANSVRFSMVAFSGEVRVWQVELVEASEERCKEAVQWLGQLSTHGGTSSLQALQAGCAFGDSLGVYLITDGRNDCSCSLVLKEAERLTAGKHITIHTIAFNCQDRTAKEFLRKLAHKTGGRFHEAPSESHTAAASELLTSSFSVGEDSELPSFEGDDLRRLSEEMEKLRMFQK 1133          

HSP 6 Score: 62.003 bits (149), Expect = 5.214e-9
Identity = 58/271 (21.40%), Postives = 118/271 (43.54%), Query Frame = 3
Query: 3129 EEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTS--GSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRF--RERLVTP---DESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYH 3920
            ++W +S +W+++ SL + GL L  L S                     +C+         G    L+    +L  +  +  +    Y  R++WL   S+++FG++  + + +L+D S        + +L  +L  LI EQ F+ K   + ++F +++       + VTP    ES       W   L   G+ +  +AL       ++  + ++    PD  T+ +   +   +  + T   IH +++N  ++ A E +K +A+++ GRYH
Sbjct:   55 DDWRSSVEWLEECSLNSYGLTLTHLFS---------------------HCSTAATSSRDDGVSTQLEIDSKKL--FETQLYQVTDLYHSRIQWLNQGSRKMFGIVKGSRLGVLIDVSDVNCSEERLEDLQHHLLLLIEEQ-FRMKKVLHFMSFGTELSSLWTGPKEVTPLRLKESQ-----QWVLQLEPSGSCNLLQALKTACSHTQLDSLLIILGSCPDQDTDSIFNYMTQEVQEKVTS--IHVVAYNTCNQVAIENVKNIAKVTEGRYH 294          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Cavefish
Match: ENSAMXT00000042735.1 (von Willebrand factor A domain containing 3A [Source:NCBI gene;Acc:103035332])

HSP 1 Score: 456.062 bits (1172), Expect = 4.030e-139
Identity = 264/776 (34.02%), Postives = 416/776 (53.61%), Query Frame = 3
Query: 1860 NILSKNAYESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLS-TGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDV-SGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYPPSHSKKNEDIIKNAVELCRRNSSDNMVALMPPRQTSLSKARLKYLSDKTEENLKIPKTLAYKSD-IDPRKSITNSKPPYRPVIQSAFYTEDKNSKGVVYRDYPGQNMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQDRTTVAADLLSID---PHYPPLPNLEGDDLVRLAKEIQLTRENLAKINYFRQL 4169
             +L+ N Y  K  F+P + + V S+V+EKAM+Q EW DG+V+NVH DL  L  YQK L E  +++E R  WLS TGSR+I+G + E++V ++LD+S  N  Y +HI  ++ +L+Q+QL +   FNI AF + I  +K  +      NLQD W W++ L C G R  L A++H  E  + S  +    G+YLFT+G+PDQ    +  Y+ E      +KIH +LF  ++    S TP   RY    +TA+++R LAH++KGRFHW  ++GI+ESDD+  L+ E++ A  Y ++  +      + + PS +K                      A++PP                           A+  D   P + + ++K     + QS FY ED N  G V++ Y  +    ++ I    IP +E+  ++K W+K + +++  LDL +LVSGPEC H + L+  + K V AKYCA +FP V V G+ +HL  +  EL +Y ++ +K L RY +R++WL+  S+R+FG + E  V ++LD SGSM P +PEL   L +LIWEQL    + ++++AF+ ++R ++  LV   E  C  A+ W   L   G T + +AL          G+YL+TDG+ D S  +VLK  + + + +   + IHTI+FNC+D +A EFL++LA  + GR+H+                               +  T  A++LL+          LP+ EGDDL RL++E++  R    +   FR++
Sbjct:  398 QVLAPNVYSPKESFVPILRKTVHSTVHEKAMVQFEWHDGTVKNVHVDLPLLQNYQKRLLEAEQVLEDRAAWLSSTGSRQIWGAVCEQRVHVLLDMSAMNNHYQLHIQHAVHLLLQEQLPSTHSFNITAFGSDIKQWKEQMVPPTSENLQDVWQWIQGLECGGDRYTLAAIQHAAEAEL-STDSSLTSGVYLFTTGMPDQDPVTVSTYMSEVCNNPRLKIHVILFAGENMLARSLTP---RYVTWAETAQVLRGLAHASKGRFHWITDTGIVESDDVIALIGEMETAANYWQKESKE-GKRSQTWRPSSAK----------------------AVIPP---------------------------AHPVDSWKPARQVNSAKQRKTKITQSVFYLEDGN-LGTVFKKYL-KPKSVQKYISTVTIPKQEDICSTKQWLKSFGIRSQKLDLHKLVSGPECTHRKKLVRTVHKSVSAKYCA-IFPSVQVNGSVRHLLLSPAELKQYLIQVEKVLQRYAQRMQWLLSGSRRVFGCVVERAVCVVLDVSGSMAPCVPELQKELASLIWEQLHANSVRFSMVAFSGEVRVWQVELVEASEERCKEAVQWLGQLSTHGGTSSLQALQAGCAFGDSLGVYLITDGRNDCSCSLVLKEAERLTAGK--HITIHTIAFNCQDRTAKEFLRKLAHKTGGRFHEA----------------------------PSESHTAAASELLTSSFSVGEDSELPSFEGDDLRRLSEEMEKLRMFQKQARAFREI 1086          

HSP 2 Score: 166.392 bits (420), Expect = 3.862e-41
Identity = 107/341 (31.38%), Postives = 174/341 (51.03%), Query Frame = 3
Query:  516 DEQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTD--------YEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEW 1514
            D +SS +WL+  +L++  LT+  L S              TA      DD + T         +E +L+   ++Y  RI+W  QGSRKMFG V GS+L VLID SD N    R+   Q +LL L++EQ   KK ++   FGT    L+     +    ++E ++    +   G CNL+QALK       +D +L+ILGSCPDQ+   +  ++ Q +  +    H V+Y T ++     +K IA ++ G YH +S+    ++ +S+D++ L  EI+  ++VL+ I  M  G   +   P +++I+E+L  +  S+    P   +  L  + P   P TS+EW
Sbjct:   56 DWRSSVEWLEECSLNSYGLTLTHLFS-----------HCSTAATS-SRDDGVSTQLEIDSKKLFETQLYQVTDLYHSRIQWLNQGSRKMFGIVKGSRLGVLIDVSDVNCSEERLEDLQHHLLLLIEEQFRMKKVLHFMSFGTELSSLWTGPKEVTPLRLKESQQWVLQLEPSGSCNLLQALKTACSHTQLDSLLIILGSCPDQDTDSIFNYMTQEVQEKVTSIHVVAYNTCNQVAIENVKNIAKVTEGRYHIFSAAL-GVVDSSSDLEPLWAEIKSARDVLDHIHCMSHGQLEDLTVPVMSEISEDLDCLSLSDLKSDPHDGSAALCIQPPTLLPTTSAEW 383          

HSP 3 Score: 73.559 bits (179), Expect = 1.406e-12
Identity = 72/286 (25.17%), Postives = 126/286 (44.06%), Query Frame = 3
Query: 3141 TSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAK-YCAGLFPIVNVKGTRKHLQYTVTELNKYS---VEAKKALIRYMKRLEWLM-ISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALL------ITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESAN-------------EFLKRLARMSNGRYHKV 3926
            TS +W+K   +K   L L ++++      +E+ +  L K V +  +   +       GT K++   +  L  Y    +EA++ L     R  WL    S++I+G + E  V +LLD S +M  H    I +   L+ ++      S+NI AF S I++++E++V P   +      W + L   G+  T  A+       ++ +     G+YL T G PD     V   +  + ++ + K  IH I F  E+  A              + L+ LA  S GR+H +
Sbjct:  379 TSAEWLKTNGMKAKKLSLYQVLAPNVYSPKESFVPILRKTVHSTVHEKAMVQFEWHDGTVKNVHVDLPLLQNYQKRLLEAEQVL---EDRAAWLSSTGSRQIWGAVCEQRVHVLLDMS-AMNNHYQLHIQHAVHLLLQEQLPSTHSFNITAFGSDIKQWKEQMVPPTSENLQDVWQWIQGLECGGDRYTLAAIQHAAEAELSTDSSLTSGVYLFTTGMPDQDPVTVSTYMSEVCNNPRLK--IHVILFAGENMLARSLTPRYVTWAETAQVLRGLAHASKGRFHWI 658          

HSP 4 Score: 71.633 bits (174), Expect = 6.349e-12
Identity = 101/408 (24.75%), Postives = 172/408 (42.16%), Query Frame = 3
Query: 1971 DGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNI--KYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRES-GIIE-SDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYP-PSHSKKNEDIIKNAVELCRRNSSDNMVALM--PPRQTSLSKARLKYLSDKTEENLKIPKTLAYKSDIDPRKSITNSKPPYRPVIQSA--------FYTEDKNSKGVVYRDYP-GQNMHSRRGIGKAVIPDKEEWITS 3146
            DG    +  D  +LFE Q  L +   L   RI WL+ GSR++FG +   ++ +++D+S  N   + L  +   L +LI++Q + K   + ++F   +SS   G   V    L++S  W+  L  SGS NLL ALK        +  +     + +     PDQ  + +  Y+ + V      IH V +N  +                   E ++ +A  T+GR+H F  + G+++ S D+  L AEI  A +       + +   E    P  S+ +ED+   ++   + +  D   AL   PP     + A     +    + L + + LA  +   P++S     P  R  + S         F   D   K  V+ D P  QN   R    + V+ D+  W++S
Sbjct:   93 DGVSTQLEIDSKKLFETQ--LYQVTDLYHSRIQWLNQGSRKMFGIVKGSRLGVLIDVSDVNCSEERLEDLQHHLLLLIEEQFRMKKVLHFMSFGTELSSLWTGPKEVTPLRLKESQQWVLQLEPSGSCNLLQALK-------TACSHTQLDSLLIILGSCPDQDTDSIFNYMTQEVQEKVTSIHVVAYNTCN---------------QVAIENVKNIAKVTEGRYHIFSAALGVVDSSSDLEPLWAEIKSARDVLDHIHCMSHGQLEDLTVPVMSEISEDLDCLSLSDLKSDPHDGSAALCIQPPTLLPTTSAEWLKTNGMKAKKLSLYQVLA-PNVYSPKESFV---PILRKTVHSTVHEKAMVQFEWHDGTVKN-VHVDLPLLQNYQKRLLEAEQVLEDRAAWLSS 471          

HSP 5 Score: 62.003 bits (149), Expect = 5.054e-9
Identity = 63/316 (19.94%), Postives = 135/316 (42.72%), Query Frame = 3
Query:  525 SSEDWLKTHNLDALQLTIEDLISKGKLGN----PRPDEQTGTAYNCLVYDDFIVT--------------DYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKK-SINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHR-----YSSMTEELMYTS----NDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPY 1388
            S++ WLK+  + + +L +  L+S  +  +     R   ++ +A  C ++    V                Y  ++   ++ Y++R++W L GSR++FG V    + V++D S +      V   Q  L  L+ EQL       ++  F    +    + +  +    +E  +    +S+ GG + +QAL+          V LI     D    +++   ++L  G+ +  H +++  Q       L+ +A  + G +H      +++   EL+ +S     D +L   E +  + + E++E +R  +F  +A  +
Sbjct:  772 STKQWLKSFGIRSQKLDLHKLVSGPECTHRKKLVRTVHKSVSAKYCAIFPSVQVNGSVRHLLLSPAELKQYLIQVEKVLQRYAQRMQWLLSGSRRVFGCVVERAVCVVLDVSGSMAPC--VPELQKELASLIWEQLHANSVRFSMVAFSGEVRVWQVELVEASEERCKEAVQWLGQLSTHGGTSSLQALQAGCAFGDSLGVYLITDGRNDCSCSLVLKEAERLTAGKHITIHTIAFNCQDRTAKEFLRKLAHKTGGRFHEAPSESHTAAASELLTSSFSVGEDSELPSFEGDDLRRLSEEMEKLR--MFQKQARAF 1083          

HSP 6 Score: 62.003 bits (149), Expect = 5.097e-9
Identity = 58/271 (21.40%), Postives = 118/271 (43.54%), Query Frame = 3
Query: 3129 EEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTS--GSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRF--RERLVTP---DESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYH 3920
            ++W +S +W+++ SL + GL L  L S                     +C+         G    L+    +L  +  +  +    Y  R++WL   S+++FG++  + + +L+D S        + +L  +L  LI EQ F+ K   + ++F +++       + VTP    ES       W   L   G+ +  +AL       ++  + ++    PD  T+ +   +   +  + T   IH +++N  ++ A E +K +A+++ GRYH
Sbjct:   55 DDWRSSVEWLEECSLNSYGLTLTHLFS---------------------HCSTAATSSRDDGVSTQLEIDSKKL--FETQLYQVTDLYHSRIQWLNQGSRKMFGIVKGSRLGVLIDVSDVNCSEERLEDLQHHLLLLIEEQ-FRMKKVLHFMSFGTELSSLWTGPKEVTPLRLKESQ-----QWVLQLEPSGSCNLLQALKTACSHTQLDSLLIILGSCPDQDTDSIFNYMTQEVQEKVTS--IHVVAYNTCNQVAIENVKNIAKVTEGRYH 294          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Cavefish
Match: si:dkey-8l13.5 (chromosome 18 C11orf16 homolog [Source:NCBI gene;Acc:103047275])

HSP 1 Score: 61.6178 bits (148), Expect = 4.552e-9
Identity = 49/181 (27.07%), Postives = 84/181 (46.41%), Query Frame = 3
Query: 3411 MISSKRIFGVITETD--VAILLDTSGSMTPHMPELILNLKALIWEQLFK----RKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISF---NCEDESANEFLKRLARMSNGRYHKV 3926
            M SS+ +  V+   D  V ++LDTS +MT     ++  +K LI + L      R   +NII F+ ++  + + +V     + + A+GW   L      D   AL     DP  Q ++L+T+  PDN      +N  + +S+  T+ P+HT         D    +FLK L   + G  +++
Sbjct:    1 MDSSRGVIPVLMGKDRNVTLILDTSEAMT----AVLGTVKNLIVQTLLAKASLRNSLFNIITFSYKVTPWSDHMVPCAPDTVYEALGWIHTLTTSPGKDLLTALTTAFSDPACQSVHLVTNSLPDNP-----ENCLSALSTCGTR-PVHTFHIAEKQALDSDTLDFLKCLTSATRGSCYRL 171          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Cavefish
Match: ENSAMXT00000037803.1 (inter-alpha-trypsin inhibitor heavy chain H3-like [Source:NCBI gene;Acc:103044542])

HSP 1 Score: 53.9138 bits (128), Expect = 1.508e-6
Identity = 47/192 (24.48%), Postives = 87/192 (45.31%), Query Frame = 3
Query: 3453 DVAILLDTSGSMTP----HMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLE-------DPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALP 3995
            +V  ++D SGSM+        E +L +   + E  +     + +I F+S+I  +R  LV   +S+  SA  + + +   G TD   A+L  +E       +     + LLTDG P+       +   N+  +   K P++ + F  +     +FL+++A  ++GR  ++  D D  +  Q      KT A+P
Sbjct:  270 NVVFVIDRSGSMSGKKIQQTREALLKILGDVAEDDY-----FGLITFDSKIEVWRPELVQATDSNLKSAKNFVKEITDRGATDINAAVLKGVEMINRHQREGSASILILLTDGAPNTGVSHPPRIQANVKEAIGGKFPLYCLGFGFDVNY--DFLEKMALENSGRAFRIYEDSDADLQLQGFY---KTVAVP 451          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Cavefish
Match: ENSAMXT00000057721.1 (inter-alpha-trypsin inhibitor heavy chain H3-like [Source:NCBI gene;Acc:103044542])

HSP 1 Score: 53.5286 bits (127), Expect = 1.680e-6
Identity = 47/192 (24.48%), Postives = 87/192 (45.31%), Query Frame = 3
Query: 3453 DVAILLDTSGSMTP----HMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLE-------DPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALP 3995
            +V  ++D SGSM+        E +L +   + E  +     + +I F+S+I  +R  LV   +S+  SA  + + +   G TD   A+L  +E       +     + LLTDG P+       +   N+  +   K P++ + F  +     +FL+++A  ++GR  ++  D D  +  Q      KT A+P
Sbjct:  270 NVVFVIDRSGSMSGKKIQQTREALLKILGDVAEDDY-----FGLITFDSKIEVWRPELVQATDSNLKSAKNFVKEITDRGATDINAAVLKGVEMINRHQREGSASILILLTDGAPNTGVSHPPRIQANVKEAIGGKFPLYCLGFGFDVNY--DFLEKMALENSGRAFRIYEDSDADLQLQGFY---KTVAVP 451          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008921.1 (pep scaffold:Pmarinus_7.0:GL477596:1845:16253:1 gene:ENSPMAG00000008072.1 transcript:ENSPMAT00000008921.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 168.703 bits (426), Expect = 1.849e-47
Identity = 106/242 (43.80%), Postives = 153/242 (63.22%), Query Frame = 3
Query: 1941 EKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLF--NVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESG 2660
            +KAM Q EW +G+V+N+H DL  L  YQK LG+ V+  EQR++WLS+GSRRI+GT+ E ++ +++DLS  N  YLVH+  S+++L+Q QL  K+ FNII F   I +F+      +  NLQ +WSW+    C G R+LLGAL+ + E+P         +GIY+FTSGVPDQ +  +  Y+EE  LG ++++H  LF          GT  P+ YA+  +TAE +R LA + +GR H F E G
Sbjct:    1 QKAMTQFEWHNGTVKNMHVDLPTLHNYQKQLGQAVRTYEQRVSWLSSGSRRIWGTVCEMRLAVLVDLSEMNANYLVHVQHSMRLLLQTQLTGKESFNIITFGMDIQAFRPSPVPPSPENLQAAWSWVLEWRCGGGRDLLGALRLLLEDP-----EGPPEGIYVFTSGVPDQDLVAVCGYVEEANLGQEVRLHACLFSAGGSGSGGGGTSGPACYASGAETAEALRALARAGRGRLHCFSEQG 237          

HSP 2 Score: 77.0258 bits (188), Expect = 1.089e-15
Identity = 49/155 (31.61%), Postives = 80/155 (51.61%), Query Frame = 3
Query: 3309 GTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPR--IQGIYLLTDGKPD 3767
            GT K++   +  L+ Y  +  +A+  Y +R+ WL   S+RI+G + E  +A+L+D S     ++  +  +++ L+  QL  ++ S+NII F   I+ FR   V P   +  +A  W       G  D   AL + LEDP    +GIY+ T G PD
Sbjct:   12 GTVKNMHVDLPTLHNYQKQLGQAVRTYEQRVSWLSSGSRRIWGTVCEMRLAVLVDLSEMNANYLVHVQHSMRLLLQTQLTGKE-SFNIITFGMDIQAFRPSPVPPSPENLQAAWSWVLEWRCGGGRDLLGALRLLLEDPEGPPEGIYVFTSGVPD 165          

HSP 3 Score: 56.9954 bits (136), Expect = 5.954e-9
Identity = 29/83 (34.94%), Postives = 49/83 (59.04%), Query Frame = 3
Query:  678 DYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTK 926
            +Y+ +L  A+  Y +R+ W   GSR+++G V   +LAVL+D S+ N  +  ++  Q ++  LL  QL  K+S NI  FG + +
Sbjct:   26 NYQKQLGQAVRTYEQRVSWLSSGSRRIWGTVCEMRLAVLVDLSEMNANY--LVHVQHSMRLLLQTQLTGKESFNIITFGMDIQ 106          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008919.1 (pep scaffold:Pmarinus_7.0:GL477596:1845:16253:1 gene:ENSPMAG00000008072.1 transcript:ENSPMAT00000008919.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.466 bits (415), Expect = 7.364e-46
Identity = 109/246 (44.31%), Postives = 156/246 (63.41%), Query Frame = 3
Query: 1941 EKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQ-IEPLMA---YIEERVLGTDIKIHTVLF--NVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESG 2660
            +KAM Q EW +G+V+N+H DL  L  YQK LG+ V+  EQR++WLS+GSRRI+GT+ E ++ +++DLS  N  YLVH+  S+++L+Q QL  K+ FNII F   I +F+      +  NLQ +WSW+    C G R+LLGAL+ + E+P         +GIY+FTSGVPDQ  I+ L+A   Y+EE  LG ++++H  LF          GT  P+ YA+  +TAE +R LA + +GR H F E G
Sbjct:    1 QKAMTQFEWHNGTVKNMHVDLPTLHNYQKQLGQAVRTYEQRVSWLSSGSRRIWGTVCEMRLAVLVDLSEMNANYLVHVQHSMRLLLQTQLTGKESFNIITFGMDIQAFRPSPVPPSPENLQAAWSWVLEWRCGGGRDLLGALRLLLEDP-----EGPPEGIYVFTSGVPDQDLIKHLVAVCGYVEEANLGQEVRLHACLFSAGGSGSGGGGTSGPACYASGAETAEALRALARAGRGRLHCFSEQG 241          

HSP 2 Score: 77.0258 bits (188), Expect = 1.151e-15
Identity = 49/155 (31.61%), Postives = 80/155 (51.61%), Query Frame = 3
Query: 3309 GTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPR--IQGIYLLTDGKPD 3767
            GT K++   +  L+ Y  +  +A+  Y +R+ WL   S+RI+G + E  +A+L+D S     ++  +  +++ L+  QL  ++ S+NII F   I+ FR   V P   +  +A  W       G  D   AL + LEDP    +GIY+ T G PD
Sbjct:   12 GTVKNMHVDLPTLHNYQKQLGQAVRTYEQRVSWLSSGSRRIWGTVCEMRLAVLVDLSEMNANYLVHVQHSMRLLLQTQLTGKE-SFNIITFGMDIQAFRPSPVPPSPENLQAAWSWVLEWRCGGGRDLLGALRLLLEDPEGPPEGIYVFTSGVPD 165          

HSP 3 Score: 56.9954 bits (136), Expect = 6.259e-9
Identity = 29/83 (34.94%), Postives = 49/83 (59.04%), Query Frame = 3
Query:  678 DYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTK 926
            +Y+ +L  A+  Y +R+ W   GSR+++G V   +LAVL+D S+ N  +  ++  Q ++  LL  QL  K+S NI  FG + +
Sbjct:   26 NYQKQLGQAVRTYEQRVSWLSSGSRRIWGTVCEMRLAVLVDLSEMNANY--LVHVQHSMRLLLQTQLTGKESFNIITFGMDIQ 106          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001432.1 (pep scaffold:Pmarinus_7.0:GL485617:3236:10216:1 gene:ENSPMAG00000001295.1 transcript:ENSPMAT00000001432.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.079 bits (279), Expect = 3.519e-26
Identity = 76/233 (32.62%), Postives = 109/233 (46.78%), Query Frame = 3
Query: 3111 AVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEK--------------YVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPD 3767
            A +   E   +S+ W+ +Y L+  GL L   +     RH + ++                    V A+YC+     +   G   H+         Y+V    AL     RLEWL   S+ +FG I E  V IL+DTS SM   +  L   L  LI EQL + K  +N++ F S+   +R ++V   ES    A  W E L A G+TDT  AL + L DP  +G+YLL+DG+PD
Sbjct:  198 ASVRSAEAEQSSRAWLARYGLEARGLALHTALGRCAFRHADGVVDSAHGDCACACAQGRRRRVLVNARYCSCFVHTLWADGALVHVYVPERVYRDYAVRLTAALRLIQSRLEWLQRGSRALFGSIVEDRVYILIDTSLSMEDKLDLLKEKLYLLIDEQL-RYKSGFNLVRFGSRAGAWRRQIVDTTESHLDDARAWVESLEAGGSTDTLGALRLALGDPATEGVYLLSDGRPD 429          

HSP 2 Score: 88.1965 bits (217), Expect = 2.433e-18
Identity = 53/179 (29.61%), Postives = 99/179 (55.31%), Query Frame = 3
Query: 1917 RMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQ 2453
            R++ ++ Y    +   W DG++ +V+       +Y   L   ++L++ R+ WL  GSR +FG+I+E +V +++D S+S    L  + + L +LI +QL+ K  FN++ F +   +++  +    E++L D+ +W+ SL   GS + LGAL+    +P         +G+YL + G PDQ
Sbjct:  259 RVLVNARYCSCFVHTLWADGALVHVYVPERVYRDYAVRLTAALRLIQSRLEWLQRGSRALFGSIVEDRVYILIDTSLSMEDKLDLLKEKLYLLIDEQLRYKSGFNLVRFGSRAGAWRRQIVDTTESHLDDARAWVESLEAGGSTDTLGALRLALGDPA-------TEGVYLLSDGRPDQ 430          

HSP 3 Score: 54.6842 bits (130), Expect = 1.075e-7
Identity = 33/144 (22.92%), Postives = 71/144 (49.31%), Query Frame = 3
Query:  669 IVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQ 1100
            +  DY  +L  A+ +   R++W  +GSR +FG +   ++ +LID+S +     ++   ++ L  L+DEQL  K   N+  FG+      +  ++     +++ +    ++ + G  + + AL+    + + + V L+    PDQ
Sbjct:  289 VYRDYAVRLTAALRLIQSRLEWLQRGSRALFGSIVEDRVYILIDTSLSME--DKLDLLKEKLYLLIDEQLRYKSGFNLVRFGSRAGAWRRQIVDTTESHLDDARAWVESLEAGGSTDTLGALRLALGDPATEGVYLLSDGRPDQ 430          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Nematostella
Match: EDO28327 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6S8])

HSP 1 Score: 108.612 bits (270), Expect = 4.780e-24
Identity = 57/143 (39.86%), Postives = 87/143 (60.84%), Query Frame = 3
Query: 3519 LKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHD-YDI 3944
            L  L+ EQL + K+ +N++ ++++++ +R+RLV  +  +  +A  W + L   G+T+T  AL + L DP+ + IYLLTDG+PD     +L  V  +       VPIHTISFNC D  ANEFL +LA  +N R+H    D YD+
Sbjct:   12 LYRLMQEQL-RHKVKFNLMKYDTRVQAWRDRLVDCNSHNLDNAWQWVKGLSTGGSTNTLAALKLALTDPQCRAIYLLTDGRPDQPPSSILAQVHLL-----NPVPIHTISFNCADTEANEFLCKLAADTNARFHYFSEDGYDV 148          

HSP 2 Score: 85.1149 bits (209), Expect = 1.022e-16
Identity = 51/167 (30.54%), Postives = 77/167 (46.11%), Query Frame = 3
Query: 2226 FNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGI-------IESDDIRVLMAEID 2705
            FN++ +   + +++  L   N  NL ++W W++ L+  GS N L ALK    +P         + IYL T G PDQ    ++A +    L   + IHT+ FN  D               T+  E +  LA  T  RFH+F E G         ES+D+R+L  EI+
Sbjct:   26 FNLMKYDTRVQAWRDRLVDCNSHNLDNAWQWVKGLSTGGSTNTLAALKLALTDP-------QCRAIYLLTDGRPDQPPSSILAQVH---LLNPVPIHTISFNCAD---------------TEANEFLCKLAADTNARFHYFSEDGYDVNGPKPFESEDLRLLREEIE 167          

HSP 3 Score: 57.7658 bits (138), Expect = 2.887e-8
Identity = 42/181 (23.20%), Postives = 80/181 (44.20%), Query Frame = 3
Query:  825 GRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEEL----MYTSNDIDLLLLEIERTQEVLEKIELMR 1355
             R+   +D L  L+ EQL  K   N+  + T  +      ++ N   ++   +    +S+ G  N + ALK    +     + L+    PDQ    ++    Q+ L   +P H +S+     E +  L  +A  ++  +H +S    ++     + S D+ LL  EIE+  + L+K+ L+R
Sbjct:    3 SRLFLVKDKLYRLMQEQLRHKVKFNLMKYDTRVQAWRDRLVDCNSHNLDNAWQWVKGLSTGGSTNTLAALKLALTDPQCRAIYLLTDGRPDQPPSSIL---AQVHLLNPVPIHTISFNCADTEANEFLCKLAADTNARFHYFSEDGYDVNGPKPFESEDLRLLREEIEKGLKDLKKVALLR 180          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Nematostella
Match: EDO41655 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3S3])

HSP 1 Score: 93.2041 bits (230), Expect = 1.390e-21
Identity = 60/169 (35.50%), Postives = 91/169 (53.85%), Query Frame = 3
Query: 3429 IFGVITETDVAILLDTSGSMTPHMPELILN--LKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNC---EDESANEFLKRLARMSNGRYH 3920
            IFG I E +V  LLDTSGSM  H  +++    ++ L +     R   +N+I FN ++ ++ +R+V     +   A  W   L    +T+T  ALL   +D  +Q IYL+TDG PD    I+++NV+ +   R    PIH I + C    D +A EFL+ LA+ +NG  H
Sbjct:   15 IFGNILERNVVFLLDTSGSMY-HCLDVVREHLIEILFFRATSGRDTMFNVIEFNEEVTKWADRMVQCTPRTVSVASEWINKLQCGTSTNTMGALLEAYDDDGMQAIYLVTDGMPDQRPGIIMENVRKLHKGR----PIHAI-YLCGAKADVAAVEFLEDLAKETNGSLH 177          

HSP 2 Score: 57.3806 bits (137), Expect = 3.236e-9
Identity = 48/185 (25.95%), Postives = 73/185 (39.46%), Query Frame = 3
Query: 2094 IFGTIIERKVILILDLSISNIKYL--VHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFH 2642
            IFG I+ER V+ +LD S S    L  V       +  +        FN+I F+  ++ +   +       +  +  W+  L C  S N +GAL   ++       +D  Q IYL T G+PDQ+   +M  +  R L     IH +       DV+               E +  LA  T G  H
Sbjct:   15 IFGNILERNVVFLLDTSGSMYHCLDVVREHLIEILFFRATSGRDTMFNVIEFNEEVTKWADRMVQCTPRTVSVASEWINKLQCGTSTNTMGALLEAYD-------DDGMQAIYLVTDGMPDQRPGIIMENV--RKLHKGRPIHAIYLCGAKADVAAV-------------EFLEDLAKETNGSLH 177          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Planmine SMEST
Match: SMESG000022332.1 (SMESG000022332.1)

HSP 1 Score: 1564.28 bits (4049), Expect = 0.000e+0
Identity = 771/771 (100.00%), Postives = 771/771 (100.00%), Query Frame = 3
Query: 1920 MVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYPPSHSKKNEDIIKNAVELCRRNSSDNMVALMPPRQTSLSKARLKYLSDKTEENLKIPKTLAYKSDIDPRKSITNSKPPYRPVIQSAFYTEDKNSKGVVYRDYPGQNMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQDRTTVAADLLSIDPHYPPLPNLEGDDLVRLAKEIQLTRENLAKINYFRQLHIQLQKYQEQIKAEEIKAHLI 4232
            MVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHILQSLKILIQQQLKAKDKFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYPPSHSKKNEDIIKNAVELCRRNSSDNMVALMPPRQTSLSKARLKYLSDKTEENLKIPKTLAYKSDIDPRKSITNSKPPYRPVIQSAFYTEDKNSKGVVYRDYPGQNMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQDRTTVAADLLSIDPHYPPLPNLEGDDLVRLAKEIQLTRENLAKINYFRQLHIQLQKYQEQIKAEEIKAHLI
Sbjct:    1 MVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHILQSLKILIQQQLKAKDKFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYPPSHSKKNEDIIKNAVELCRRNSSDNMVALMPPRQTSLSKARLKYLSDKTEENLKIPKTLAYKSDIDPRKSITNSKPPYRPVIQSAFYTEDKNSKGVVYRDYPGQNMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSKTTALPQNDIDTKQDRTTVAADLLSIDPHYPPLPNLEGDDLVRLAKEIQLTRENLAKINYFRQLHIQLQKYQEQIKAEEIKAHLI 771          

HSP 2 Score: 74.7146 bits (182), Expect = 4.110e-13
Identity = 61/263 (23.19%), Postives = 120/263 (45.63%), Query Frame = 3
Query:  525 SSEDWLKTHNLDALQLTIEDLISKGKLGNPR----PDEQTGTAYNC---------------LVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKK-SINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGR--DLPFHCVSYETQSEEVSSILKYIATISHGNYHR 1247
            +S+DW+K ++L  + L +  L+S  +  +      P E+   A  C               L Y    +  Y  +   A+  Y KR++W +  S+++FG ++ + +A+L+D+S +       +    NL  L+ EQLFK+K S NI  F +  +   +  +  +             + + G  +  +AL    ++  I  + L+    PD   ++++  VQ ++  R   +P H +S+  + E  +  LK +A +S+G YH+
Sbjct:  408 TSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELIL--NLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHK 668          

HSP 3 Score: 74.7146 bits (182), Expect = 4.326e-13
Identity = 60/249 (24.10%), Postives = 115/249 (46.18%), Query Frame = 3
Query:  678 DYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEV--------LLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSS---------------ILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIE-------RTQEVL 1334
            +Y+  L   +++  +RI W   GSR++FG +   K+ +++D S +N+ +  ++    +L  L+ +QL  K   NI  F             +N   +++      +++  G  NL+ ALK+V  E  +D V         L     PDQ+ + LM ++++ +LG D+  H V +     +VS                I++ +A  + G +H +    E  +  S+DI +L+ EI+       RTQ+++
Sbjct:   33 EYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKY--LVHILQSLKILIQQQLKAKDKFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVF-ENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFR---ESGIIESDDIRVLMAEIDLAVEYSRRTQQII 275          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Planmine SMEST
Match: SMESG000022334.1 (SMESG000022334.1)

HSP 1 Score: 1114.75 bits (2882), Expect = 0.000e+0
Identity = 593/595 (99.66%), Postives = 595/595 (100.00%), Query Frame = 3
Query:   81 MYRKDKVAVAVDSYKRKYSDDENEDSLQXXXXXXXXXXXXXXXXXXXXXXIIEDNKTKAIKSVKAANRATNLIEKKQVEGFNMFLNKIKPTDXXXXXXXXXXXKVKNFEIIDRNKKYYPPNQFTVTSINQAHDLLRVQNNPAVSGDEQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEWXXXXXXXXXXXXXYSKNILSATMANNFERNPTSYPVIEMSDVFPLRESNFTRDANISRKSIQGRRFSSTISKPVKSRISQILTIDNLKEFSQFGSEFEGIKESTDEKRFIEMFTENI 1865
            MYRKDKVAVAVDSYKRKYSDDENEDSLQNNSNNIDKENESEKSSSDERNEIIEDNKTKAIKSVKAANRATNLIEKKQVEGFNMFLNKIKPTDNRNSNNQNSSNKVKNFEIIDRNKKYYPPNQFTVTSINQAHDLLRVQNNPAVSGDEQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEWLGKSGLKAKKLGLYSKNILSATMANNFERNPTSYP+IEMSDVFPLRESNFTRDANISRKSIQGRRFSSTISKPVKSRISQILTIDNLKEFSQFGSEFEGIKESTDEKRFIEMFTEN+
Sbjct:    1 MYRKDKVAVAVDSYKRKYSDDENEDSLQNNSNNIDKENESEKSSSDERNEIIEDNKTKAIKSVKAANRATNLIEKKQVEGFNMFLNKIKPTDNRNSNNQNSSNKVKNFEIIDRNKKYYPPNQFTVTSINQAHDLLRVQNNPAVSGDEQSSEDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEWLGKSGLKAKKLGLYSKNILSATMANNFERNPTSYPLIEMSDVFPLRESNFTRDANISRKSIQGRRFSSTISKPVKSRISQILTIDNLKEFSQFGSEFEGIKESTDEKRFIEMFTENV 595          

HSP 2 Score: 74.7146 bits (182), Expect = 2.907e-13
Identity = 61/263 (23.19%), Postives = 120/263 (45.63%), Query Frame = 3
Query: 3141 TSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELIL--NLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHK 3923
            +S+DW+K ++L  + L +  L+S  +  +      P E+   A  C               L Y    +  Y  +   A+  Y KR++W +  S+++FG ++ + +A+L+D+S +       +    NL  L+ EQLFK+K S NI  F +  +   +  +  +             + + G  +  +AL    ++  I  + L+    PD   ++++  VQ ++  R   +P H +S+  + E  +  LK +A +S+G YH+
Sbjct:  149 SSEDWLKTHNLDALQLTIEDLISKGKLGNPR----PDEQTGTAYNC---------------LVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKK-SINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGR--DLPFHCVSYETQSEEVSSILKYIATISHGNYHR 389          

HSP 3 Score: 63.5438 bits (153), Expect = 8.479e-10
Identity = 67/254 (26.38%), Postives = 125/254 (49.21%), Query Frame = 3
Query: 2016 EYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKY--LVHXXXXXXXXXXXXXXXXXXFNIIAF-SNTISSFKAGLT----VVNETNLQDSWSWLRSLNCSGSRNLLGALKHVF-ENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFR---ESGIIESDDIRVLMAEIDLAVEYSRRTQQII 2744
            +Y+  L   +++  +RI W   GSR++FG +   K+ +++D S +N+ +  ++    +L  L+ +QL  K   NI  F +NT   ++  +     V+ E  +++S+S + SL   G  NL+ ALK+V  E  +D V         L     PDQ+ + LM ++++ +LG D+  H V +     +VS                I++ +A  + G +H +    E  +  S+DI +L+ EI+       RTQ+++
Sbjct:  200 DYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEE--IKESFSTMSSL---GGCNLMQALKYVTKEKSIDEV--------LLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSS---------------ILKYIATISHGNYHRYSSMTEELMYTSNDIDLLLLEIE-------RTQEVL 418          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Planmine SMEST
Match: SMESG000047774.1 (SMESG000047774.1)

HSP 1 Score: 183.341 bits (464), Expect = 1.212e-46
Identity = 109/289 (37.72%), Postives = 156/289 (53.98%), Query Frame = 3
Query: 3111 AVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLE-------------------KYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYH 3920
            AV   +EE+++S++W+ KY LK+  LD   ++SG   RH + ++  LE                   K + AKYC     +    G+  H+Q +      YS   K  L+   +R+EWL   S+ +FG I E  V IL+D S SM PH+  +   L  LI EQL + K   N +AFN++   +R+RLV   E++  SA  W E L   G+T+T  AL   ++D   QGIYLLTDG+PD  T+ VL  ++      + ++PIHTISFNC D  AN FL  LAR + GR+H
Sbjct:  399 AVHIPREEYMSSQEWLAKYGLKSRKLDFFDVLSGVCFRHCDGVVDVLEPPPVDKLDFMEQQNATLHQKLINAKYCDKFAHVKWKDGSLVHVQMSSDVHRLYSERMKLCLLAITRRIEWLRQGSRELFGTIMEDQVYILIDISASMEPHISFVKDKLYTLIQEQL-RHKSKINFVAFNTKALPWRDRLVDVTEANLKSAWQWLEGLTCQGSTNTLSALQFAIKDRNCQGIYLLTDGRPDQPTKTVLSQIR-----LQYRLPIHTISFNCADLEANTFLCELARETGGRFH 681          

HSP 2 Score: 119.013 bits (297), Expect = 1.285e-26
Identity = 91/286 (31.82%), Postives = 144/286 (50.35%), Query Frame = 3
Query: 1908 SIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKL----MEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRE-SG-----------IIESDDIRVLMAEIDLAVE 2717
            ++ + + ++ Y      V+W DGS+  VH  ++   +  +L  E++KL    + +RI WL  GSR +FGTI+E +V +++D+S S   ++  +   L  LIQ+QL+ K K N +AF+     ++  L  V E NL+ +W WL  L C GS N L AL+        ++ +   QGIYL T G PDQ  + +++ I    L   + IHT+ FN  D + +                 +  LA  T GRFH+F E SG             ES+DI++L +E  L  +
Sbjct:  462 TLHQKLINAKYCDKFAHVKWKDGSL--VHVQMSS--DVHRLYSERMKLCLLAITRRIEWLRQGSRELFGTIMEDQVYILIDISASMEPHISFVKDKLYTLIQEQLRHKSKINFVAFNTKALPWRDRLVDVTEANLKSAWQWLEGLTCQGSTNTLSALQF-------AIKDRNCQGIYLLTDGRPDQPTKTVLSQIR---LQYRLPIHTISFNCADLEANT---------------FLCELARETGGRFHYFNEISGGADCTNENELEAWESEDIKLLKSEYRLGFD 718          

HSP 3 Score: 88.9669 bits (219), Expect = 1.764e-17
Identity = 74/291 (25.43%), Postives = 132/291 (45.36%), Query Frame = 3
Query: 3120 PDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFP--------IVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKIS-YNIIAFNSQIRRFRERLVTPDESSCHSAIGW---TEHLVACGNTDTTKALLITLEDPRIQGIYLLT-DGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMF 3953
            PD +  ++S+ W+ K+ LK   LD   L         E     L+K + ++Y   LFP          NV   ++ L     EL       + A+  Y +RLEWL   S+R+FGVI E  V I++D          + I  ++  + EQ+  R I+ +N+I       +    L+   + +  + I W    +   A  + +  +AL+    +   + +YL+T D   D S E++ + V+ +      K+P++ IS+NC+D     +LK L  M+ GR+H    + ++  +
Sbjct:   50 PDAKLQVSSEQWLNKFGLKASNLDSSSLYPRLGFARLEGFNDVLKKPIHSRYGDNLFPKHFREDGLTFNVVAKKEKLLQVQQEL-------ENAVQLYQQRLEWLSSESRRLFGVIEEHCVTIIIDIKNKNKRDFDQFICAIERFLNEQI--RCIAKFNLIRVQENKCQLSNNLLPVSKDNLANGIDWLWQIDRTSATNSANLVEALIRASNNKENEALYLITEDLSSDGSREVLREKVKQL------KIPLNIISYNCKDPEFISYLKCLVLMTGGRFHSYLFNLEVDAY 325          

HSP 4 Score: 80.4925 bits (197), Expect = 8.022e-15
Identity = 60/235 (25.53%), Postives = 110/235 (46.81%), Query Frame = 3
Query:  681 YEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISF-QDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMT---------EELMYTSNDIDLLLLEIERTQEVLEKIELMR 1355
            Y  ++ + +   ++RI+W  QGSR++FG +   ++ +LID S +       ISF +D L  L+ EQL  K  IN   F T         +++    ++   +    ++  G  N + AL++  K+++   + L+    PDQ  K ++    Q+ L   LP H +S+     E ++ L  +A  + G +H ++ ++         E   + S DI LL  E     + LEK+  +R
Sbjct:  499 YSERMKLCLLAITRRIEWLRQGSRELFGTIMEDQVYILIDISAS---MEPHISFVKDKLYTLIQEQLRHKSKINFVAFNTKALPWRDRLVDVTEANLKSAWQWLEGLTCQGSTNTLSALQFAIKDRNCQGIYLLTDGRPDQPTKTVL---SQIRLQYRLPIHTISFNCADLEANTFLCELARETGGRFHYFNEISGGADCTNENELEAWESEDIKLLKSEYRLGFDSLEKVTKLR 727          

HSP 5 Score: 63.929 bits (154), Expect = 9.265e-10
Identity = 74/293 (25.26%), Postives = 129/293 (44.03%), Query Frame = 3
Query: 1971 DGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLN---CSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPD-----------QQIE-PL------------MAYIEERVLGTDIKIHTVLFN--VDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKEK 2762
            DG   NV A   +L + Q+ L   V+L +QR+ WLS+ SRR+FG I E  V +I+D+   N +     + +++  + +Q++   KFN+I            L  V++ NL +   WL  ++    + S NL+ AL       + + +N   + +YL T  +             +Q++ PL            ++Y++  VL T  + H+ LFN  VD Y+ S     +  AN+              K + +     GI   +D   + +EI+ A     + + +IN   EK
Sbjct:  113 DGLTFNVVAKKEKLLQVQQELENAVQLYQQRLEWLSSESRRLFGVIEEHCVTIIIDIKNKNKRDFDQFICAIERFLNEQIRCIAKFNLIRVQENKCQLSNNLLPVSKDNLANGIDWLWQIDRTSATNSANLVEAL-------IRASNNKENEALYLITEDLSSDGSREVLREKVKQLKIPLNIISYNCKDPEFISYLKCLVLMTGGRFHSYLFNLEVDAYESSPLDSENPKANLL------------LKKKVYGGSIGGIGTRNDCVAVFSEIEEAKALINQIKSLINQIPEK 386          

HSP 6 Score: 52.373 bits (124), Expect = 2.768e-6
Identity = 87/370 (23.51%), Postives = 156/370 (42.16%), Query Frame = 3
Query:  525 SSEDWL-----KTHNLDALQL----------TIEDLISK---GKLGN---PRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDAN-LGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFM-----NLNCRV--IEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGS-CPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDL------LLLEIERTQEVLEKIELMRR--GIFS--NRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEW 1514
            SSE WL     K  NLD+  L             D++ K    + G+   P+   + G  +N +   + ++   + +L  A+++Y +R++W    SR++FG +    + ++ID  + N   F + I     +   L+EQ+      N+     N   L  + +     NL   +  + +I  + +T S+    NL++AL   +  K  + + LI      D   ++L   V+QL     +P + +SY  +  E  S LK +  ++ G +H Y    E   Y S+ +D       LLL+ +     +  I        +FS    A   INQI   +  IP+ + +    S    L   +P+ E  +S EW
Sbjct:   57 SSEQWLNKFGLKASNLDSSSLYPRLGFARLEGFNDVLKKPIHSRYGDNLFPKHFREDGLTFNVVAKKEKLL-QVQQELENAVQLYQQRLEWLSSESRRLFGVIEEHCVTIIIDIKNKNKRDFDQFIC---AIERFLNEQIRCIAKFNLIRVQENKCQLSNNLLPVSKDNLANGIDWLWQIDRTSATNSA----NLVEALIRASNNKENEALYLITEDLSSDGSREVLREKVKQL----KIPLNIISYNCKDPEFISYLKCLVLMTGGRFHSYLFNLEVDAYESSPLDSENPKANLLLKKKVYGGSIGGIGTRNDCVAVFSEIEEAKALINQIKSLINQIPEKKGIYDDNS-QSKLAVHIPREEYMSSQEW 413          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Planmine SMEST
Match: SMESG000047774.1 (SMESG000047774.1)

HSP 1 Score: 183.341 bits (464), Expect = 1.255e-46
Identity = 109/289 (37.72%), Postives = 156/289 (53.98%), Query Frame = 3
Query: 3111 AVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLE-------------------KYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYH 3920
            AV   +EE+++S++W+ KY LK+  LD   ++SG   RH + ++  LE                   K + AKYC     +    G+  H+Q +      YS   K  L+   +R+EWL   S+ +FG I E  V IL+D S SM PH+  +   L  LI EQL + K   N +AFN++   +R+RLV   E++  SA  W E L   G+T+T  AL   ++D   QGIYLLTDG+PD  T+ VL  ++      + ++PIHTISFNC D  AN FL  LAR + GR+H
Sbjct:  396 AVHIPREEYMSSQEWLAKYGLKSRKLDFFDVLSGVCFRHCDGVVDVLEPPPVDKLDFMEQQNATLHQKLINAKYCDKFAHVKWKDGSLVHVQMSSDVHRLYSERMKLCLLAITRRIEWLRQGSRELFGTIMEDQVYILIDISASMEPHISFVKDKLYTLIQEQL-RHKSKINFVAFNTKALPWRDRLVDVTEANLKSAWQWLEGLTCQGSTNTLSALQFAIKDRNCQGIYLLTDGRPDQPTKTVLSQIR-----LQYRLPIHTISFNCADLEANTFLCELARETGGRFH 678          

HSP 2 Score: 118.627 bits (296), Expect = 1.618e-26
Identity = 91/286 (31.82%), Postives = 144/286 (50.35%), Query Frame = 3
Query: 1908 SIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKL----MEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRE-SG-----------IIESDDIRVLMAEIDLAVE 2717
            ++ + + ++ Y      V+W DGS+  VH  ++   +  +L  E++KL    + +RI WL  GSR +FGTI+E +V +++D+S S   ++  +   L  LIQ+QL+ K K N +AF+     ++  L  V E NL+ +W WL  L C GS N L AL+        ++ +   QGIYL T G PDQ  + +++ I    L   + IHT+ FN  D + +                 +  LA  T GRFH+F E SG             ES+DI++L +E  L  +
Sbjct:  459 TLHQKLINAKYCDKFAHVKWKDGSL--VHVQMSS--DVHRLYSERMKLCLLAITRRIEWLRQGSRELFGTIMEDQVYILIDISASMEPHISFVKDKLYTLIQEQLRHKSKINFVAFNTKALPWRDRLVDVTEANLKSAWQWLEGLTCQGSTNTLSALQF-------AIKDRNCQGIYLLTDGRPDQPTKTVLSQIR---LQYRLPIHTISFNCADLEANT---------------FLCELARETGGRFHYFNEISGGADCTNENELEAWESEDIKLLKSEYRLGFD 715          

HSP 3 Score: 88.9669 bits (219), Expect = 1.972e-17
Identity = 74/291 (25.43%), Postives = 132/291 (45.36%), Query Frame = 3
Query: 3120 PDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFP--------IVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKIS-YNIIAFNSQIRRFRERLVTPDESSCHSAIGW---TEHLVACGNTDTTKALLITLEDPRIQGIYLLT-DGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMF 3953
            PD +  ++S+ W+ K+ LK   LD   L         E     L+K + ++Y   LFP          NV   ++ L     EL       + A+  Y +RLEWL   S+R+FGVI E  V I++D          + I  ++  + EQ+  R I+ +N+I       +    L+   + +  + I W    +   A  + +  +AL+    +   + +YL+T D   D S E++ + V+ +      K+P++ IS+NC+D     +LK L  M+ GR+H    + ++  +
Sbjct:   47 PDAKLQVSSEQWLNKFGLKASNLDSSSLYPRLGFARLEGFNDVLKKPIHSRYGDNLFPKHFREDGLTFNVVAKKEKLLQVQQEL-------ENAVQLYQQRLEWLSSESRRLFGVIEEHCVTIIIDIKNKNKRDFDQFICAIERFLNEQI--RCIAKFNLIRVQENKCQLSNNLLPVSKDNLANGIDWLWQIDRTSATNSANLVEALIRASNNKENEALYLITEDLSSDGSREVLREKVKQL------KIPLNIISYNCKDPEFISYLKCLVLMTGGRFHSYLFNLEVDAY 322          

HSP 4 Score: 80.4925 bits (197), Expect = 7.494e-15
Identity = 60/235 (25.53%), Postives = 110/235 (46.81%), Query Frame = 3
Query:  681 YEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISF-QDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMT---------EELMYTSNDIDLLLLEIERTQEVLEKIELMR 1355
            Y  ++ + +   ++RI+W  QGSR++FG +   ++ +LID S +       ISF +D L  L+ EQL  K  IN   F T         +++    ++   +    ++  G  N + AL++  K+++   + L+    PDQ  K ++    Q+ L   LP H +S+     E ++ L  +A  + G +H ++ ++         E   + S DI LL  E     + LEK+  +R
Sbjct:  496 YSERMKLCLLAITRRIEWLRQGSRELFGTIMEDQVYILIDISAS---MEPHISFVKDKLYTLIQEQLRHKSKINFVAFNTKALPWRDRLVDVTEANLKSAWQWLEGLTCQGSTNTLSALQFAIKDRNCQGIYLLTDGRPDQPTKTVL---SQIRLQYRLPIHTISFNCADLEANTFLCELARETGGRFHYFNEISGGADCTNENELEAWESEDIKLLKSEYRLGFDSLEKVTKLR 724          

HSP 5 Score: 63.5438 bits (153), Expect = 1.094e-9
Identity = 74/293 (25.26%), Postives = 129/293 (44.03%), Query Frame = 3
Query: 1971 DGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLN---CSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPD-----------QQIE-PL------------MAYIEERVLGTDIKIHTVLFN--VDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKEK 2762
            DG   NV A   +L + Q+ L   V+L +QR+ WLS+ SRR+FG I E  V +I+D+   N +     + +++  + +Q++   KFN+I            L  V++ NL +   WL  ++    + S NL+ AL       + + +N   + +YL T  +             +Q++ PL            ++Y++  VL T  + H+ LFN  VD Y+ S     +  AN+              K + +     GI   +D   + +EI+ A     + + +IN   EK
Sbjct:  110 DGLTFNVVAKKEKLLQVQQELENAVQLYQQRLEWLSSESRRLFGVIEEHCVTIIIDIKNKNKRDFDQFICAIERFLNEQIRCIAKFNLIRVQENKCQLSNNLLPVSKDNLANGIDWLWQIDRTSATNSANLVEAL-------IRASNNKENEALYLITEDLSSDGSREVLREKVKQLKIPLNIISYNCKDPEFISYLKCLVLMTGGRFHSYLFNLEVDAYESSPLDSENPKANLL------------LKKKVYGGSIGGIGTRNDCVAVFSEIEEAKALINQIKSLINQIPEK 383          

HSP 6 Score: 52.7582 bits (125), Expect = 2.687e-6
Identity = 87/370 (23.51%), Postives = 156/370 (42.16%), Query Frame = 3
Query:  525 SSEDWL-----KTHNLDALQL----------TIEDLISK---GKLGN---PRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDAN-LGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFM-----NLNCRV--IEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGS-CPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDL------LLLEIERTQEVLEKIELMRR--GIFS--NRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEW 1514
            SSE WL     K  NLD+  L             D++ K    + G+   P+   + G  +N +   + ++   + +L  A+++Y +R++W    SR++FG +    + ++ID  + N   F + I     +   L+EQ+      N+     N   L  + +     NL   +  + +I  + +T S+    NL++AL   +  K  + + LI      D   ++L   V+QL     +P + +SY  +  E  S LK +  ++ G +H Y    E   Y S+ +D       LLL+ +     +  I        +FS    A   INQI   +  IP+ + +    S    L   +P+ E  +S EW
Sbjct:   54 SSEQWLNKFGLKASNLDSSSLYPRLGFARLEGFNDVLKKPIHSRYGDNLFPKHFREDGLTFNVVAKKEKLL-QVQQELENAVQLYQQRLEWLSSESRRLFGVIEEHCVTIIIDIKNKNKRDFDQFIC---AIERFLNEQIRCIAKFNLIRVQENKCQLSNNLLPVSKDNLANGIDWLWQIDRTSATNSA----NLVEALIRASNNKENEALYLITEDLSSDGSREVLREKVKQL----KIPLNIISYNCKDPEFISYLKCLVLMTGGRFHSYLFNLEVDAYESSPLDSENPKANLLLKKKVYGGSIGGIGTRNDCVAVFSEIEEAKALINQIKSLINQIPEKKGIYDDNS-QSKLAVHIPREEYMSSQEW 410          
BLAST of von Willebrand factor A domain-containing protein 3A vs. Planmine SMEST
Match: SMESG000047774.1 (SMESG000047774.1)

HSP 1 Score: 183.341 bits (464), Expect = 1.301e-46
Identity = 109/289 (37.72%), Postives = 156/289 (53.98%), Query Frame = 3
Query: 3111 AVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLE-------------------KYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACGNTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYH 3920
            AV   +EE+++S++W+ KY LK+  LD   ++SG   RH + ++  LE                   K + AKYC     +    G+  H+Q +      YS   K  L+   +R+EWL   S+ +FG I E  V IL+D S SM PH+  +   L  LI EQL + K   N +AFN++   +R+RLV   E++  SA  W E L   G+T+T  AL   ++D   QGIYLLTDG+PD  T+ VL  ++      + ++PIHTISFNC D  AN FL  LAR + GR+H
Sbjct:  399 AVHIPREEYMSSQEWLAKYGLKSRKLDFFDVLSGVCFRHCDGVVDVLEPPPVDKLDFMEQQNATLHQKLINAKYCDKFAHVKWKDGSLVHVQMSSDVHRLYSERMKLCLLAITRRIEWLRQGSRELFGTIMEDQVYILIDISASMEPHISFVKDKLYTLIQEQL-RHKSKINFVAFNTKALPWRDRLVDVTEANLKSAWQWLEGLTCQGSTNTLSALQFAIKDRNCQGIYLLTDGRPDQPTKTVLSQIR-----LQYRLPIHTISFNCADLEANTFLCELARETGGRFH 681          

HSP 2 Score: 118.627 bits (296), Expect = 1.609e-26
Identity = 91/286 (31.82%), Postives = 144/286 (50.35%), Query Frame = 3
Query: 1908 SIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKLLGEQVKL----MEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLNCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYIEERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRE-SG-----------IIESDDIRVLMAEIDLAVE 2717
            ++ + + ++ Y      V+W DGS+  VH  ++   +  +L  E++KL    + +RI WL  GSR +FGTI+E +V +++D+S S   ++  +   L  LIQ+QL+ K K N +AF+     ++  L  V E NL+ +W WL  L C GS N L AL+        ++ +   QGIYL T G PDQ  + +++ I    L   + IHT+ FN  D + +                 +  LA  T GRFH+F E SG             ES+DI++L +E  L  +
Sbjct:  462 TLHQKLINAKYCDKFAHVKWKDGSL--VHVQMSS--DVHRLYSERMKLCLLAITRRIEWLRQGSRELFGTIMEDQVYILIDISASMEPHISFVKDKLYTLIQEQLRHKSKINFVAFNTKALPWRDRLVDVTEANLKSAWQWLEGLTCQGSTNTLSALQF-------AIKDRNCQGIYLLTDGRPDQPTKTVLSQIR---LQYRLPIHTISFNCADLEANT---------------FLCELARETGGRFHYFNEISGGADCTNENELEAWESEDIKLLKSEYRLGFD 718          

HSP 3 Score: 88.9669 bits (219), Expect = 2.044e-17
Identity = 74/291 (25.43%), Postives = 132/291 (45.36%), Query Frame = 3
Query: 3120 PDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHEEALIIPLEKYVEAKYCAGLFP--------IVNVKGTRKHLQYTVTELNKYSVEAKKALIRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKALIWEQLFKRKIS-YNIIAFNSQIRRFRERLVTPDESSCHSAIGW---TEHLVACGNTDTTKALLITLEDPRIQGIYLLT-DGKPDNSTEIVLKNVQNIMSSRKTKVPIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMF 3953
            PD +  ++S+ W+ K+ LK   LD   L         E     L+K + ++Y   LFP          NV   ++ L     EL       + A+  Y +RLEWL   S+R+FGVI E  V I++D          + I  ++  + EQ+  R I+ +N+I       +    L+   + +  + I W    +   A  + +  +AL+    +   + +YL+T D   D S E++ + V+ +      K+P++ IS+NC+D     +LK L  M+ GR+H    + ++  +
Sbjct:   50 PDAKLQVSSEQWLNKFGLKASNLDSSSLYPRLGFARLEGFNDVLKKPIHSRYGDNLFPKHFREDGLTFNVVAKKEKLLQVQQEL-------ENAVQLYQQRLEWLSSESRRLFGVIEEHCVTIIIDIKNKNKRDFDQFICAIERFLNEQI--RCIAKFNLIRVQENKCQLSNNLLPVSKDNLANGIDWLWQIDRTSATNSANLVEALIRASNNKENEALYLITEDLSSDGSREVLREKVKQL------KIPLNIISYNCKDPEFISYLKCLVLMTGGRFHSYLFNLEVDAY 325          

HSP 4 Score: 80.4925 bits (197), Expect = 8.523e-15
Identity = 60/235 (25.53%), Postives = 110/235 (46.81%), Query Frame = 3
Query:  681 YEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGRVISF-QDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMT---------EELMYTSNDIDLLLLEIERTQEVLEKIELMR 1355
            Y  ++ + +   ++RI+W  QGSR++FG +   ++ +LID S +       ISF +D L  L+ EQL  K  IN   F T         +++    ++   +    ++  G  N + AL++  K+++   + L+    PDQ  K ++    Q+ L   LP H +S+     E ++ L  +A  + G +H ++ ++         E   + S DI LL  E     + LEK+  +R
Sbjct:  499 YSERMKLCLLAITRRIEWLRQGSRELFGTIMEDQVYILIDISAS---MEPHISFVKDKLYTLIQEQLRHKSKINFVAFNTKALPWRDRLVDVTEANLKSAWQWLEGLTCQGSTNTLSALQFAIKDRNCQGIYLLTDGRPDQPTKTVL---SQIRLQYRLPIHTISFNCADLEANTFLCELARETGGRFHYFNEISGGADCTNENELEAWESEDIKLLKSEYRLGFDSLEKVTKLR 727          

HSP 5 Score: 63.5438 bits (153), Expect = 1.077e-9
Identity = 74/293 (25.26%), Postives = 129/293 (44.03%), Query Frame = 3
Query: 1971 DGSVRNVHADLAQLFEYQKLLGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHXXXXXXXXXXXXXXXXXXFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSLN---CSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPD-----------QQIE-PL------------MAYIEERVLGTDIKIHTVLFN--VDDYDVSGTPIPSRYANITKTAEIMRMLAHSTKGRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKEK 2762
            DG   NV A   +L + Q+ L   V+L +QR+ WLS+ SRR+FG I E  V +I+D+   N +     + +++  + +Q++   KFN+I            L  V++ NL +   WL  ++    + S NL+ AL       + + +N   + +YL T  +             +Q++ PL            ++Y++  VL T  + H+ LFN  VD Y+ S     +  AN+              K + +     GI   +D   + +EI+ A     + + +IN   EK
Sbjct:  113 DGLTFNVVAKKEKLLQVQQELENAVQLYQQRLEWLSSESRRLFGVIEEHCVTIIIDIKNKNKRDFDQFICAIERFLNEQIRCIAKFNLIRVQENKCQLSNNLLPVSKDNLANGIDWLWQIDRTSATNSANLVEAL-------IRASNNKENEALYLITEDLSSDGSREVLREKVKQLKIPLNIISYNCKDPEFISYLKCLVLMTGGRFHSYLFNLEVDAYESSPLDSENPKANLL------------LKKKVYGGSIGGIGTRNDCVAVFSEIEEAKALINQIKSLINQIPEK 386          

HSP 6 Score: 52.373 bits (124), Expect = 3.027e-6
Identity = 87/370 (23.51%), Postives = 156/370 (42.16%), Query Frame = 3
Query:  525 SSEDWL-----KTHNLDALQL----------TIEDLISK---GKLGN---PRPDEQTGTAYNCLVYDDFIVTDYEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDAN-LGFGRVISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFM-----NLNCRV--IEEIKESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGS-CPDQEAKMLMYFVQQLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYTSNDIDL------LLLEIERTQEVLEKIELMRR--GIFS--NRASPYINQIAEELKNIPQSENLPKPISFNDPLKFEVPKFEPRTSSEW 1514
            SSE WL     K  NLD+  L             D++ K    + G+   P+   + G  +N +   + ++   + +L  A+++Y +R++W    SR++FG +    + ++ID  + N   F + I     +   L+EQ+      N+     N   L  + +     NL   +  + +I  + +T S+    NL++AL   +  K  + + LI      D   ++L   V+QL     +P + +SY  +  E  S LK +  ++ G +H Y    E   Y S+ +D       LLL+ +     +  I        +FS    A   INQI   +  IP+ + +    S    L   +P+ E  +S EW
Sbjct:   57 SSEQWLNKFGLKASNLDSSSLYPRLGFARLEGFNDVLKKPIHSRYGDNLFPKHFREDGLTFNVVAKKEKLL-QVQQELENAVQLYQQRLEWLSSESRRLFGVIEEHCVTIIIDIKNKNKRDFDQFIC---AIERFLNEQIRCIAKFNLIRVQENKCQLSNNLLPVSKDNLANGIDWLWQIDRTSATNSA----NLVEALIRASNNKENEALYLITEDLSSDGSREVLREKVKQL----KIPLNIISYNCKDPEFISYLKCLVLMTGGRFHSYLFNLEVDAYESSPLDSENPKANLLLKKKVYGGSIGGIGTRNDCVAVFSEIEEAKALINQIKSLINQIPEKKGIYDDNS-QSKLAVHIPREEYMSSQEW 413          
The following BLAST results are available for this feature:
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VWA3A7.978e-15036.59von Willebrand factor A domain containing 3A [Sour... [more]
VWA3A1.828e-7436.96von Willebrand factor A domain containing 3A [Sour... [more]
VWA3A7.223e-6636.68von Willebrand factor A domain containing 3A [Sour... [more]
VWA3A1.485e-4736.09von Willebrand factor A domain containing 3A [Sour... [more]
VWA3B8.069e-3232.48von Willebrand factor A domain containing 3B [Sour... [more]
back to top
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vwa3a1.433e-6833.33von Willebrand factor A domain containing 3A [Sour... [more]
back to top
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
muc41.955e-7343.64mucin 4, cell surface associated [Source:Xenbase;A... [more]
muc45.605e-7043.64mucin 4, cell surface associated [Source:Xenbase;A... [more]
muc43.638e-4946.50mucin 4, cell surface associated [Source:Xenbase;A... [more]
ENSXETT00000049307.14.658e-3632.99pep primary_assembly:Xenopus_tropicalis_v9.1:2:109... [more]
back to top
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vwa3a1.945e-15236.35von Willebrand factor A domain containing 3A [Sour... [more]
Vwa3a1.945e-15236.35von Willebrand factor A domain containing 3A [Sour... [more]
Vwa3a1.945e-15236.35von Willebrand factor A domain containing 3A [Sour... [more]
Vwa3a5.814e-5233.05von Willebrand factor A domain containing 3A [Sour... [more]
Vwa3b1.231e-3724.86von Willebrand factor A domain containing 3B [Sour... [more]
back to top
BLAST of von Willebrand factor A domain-containing protein 3A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q3UVV9|VWA3A_MOUSE1.360e-15136.35von Willebrand factor A domain-containing protein ... [more]
sp|A6NCI4|VWA3A_HUMAN3.831e-14936.59von Willebrand factor A domain-containing protein ... [more]
sp|A1A5Q7|VWA3A_RAT5.431e-7337.22von Willebrand factor A domain-containing protein ... [more]
sp|Q502W6|VWA3B_HUMAN3.875e-3132.48von Willebrand factor A domain-containing protein ... [more]
back to top
BLAST of von Willebrand factor A domain-containing protein 3A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FB754.920e-9446.61VWFA domain-containing protein OS=Macrostomum lign... [more]
A0A267GGY94.538e-9246.61VWFA domain-containing protein OS=Macrostomum lign... [more]
A0A267FB834.874e-9446.61VWFA domain-containing protein OS=Macrostomum lign... [more]
A0A2B4SKJ80.000e+033.66von Willebrand factor A domain-containing protein ... [more]
A0A1S3KGN77.378e-8943.73von Willebrand factor A domain-containing protein ... [more]
back to top
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000000373.29.885e-14634.86von Willebrand factor A domain containing 3A [Sour... [more]
ENSAMXT00000042735.14.030e-13934.02von Willebrand factor A domain containing 3A [Sour... [more]
si:dkey-8l13.54.552e-927.07chromosome 18 C11orf16 homolog [Source:NCBI gene;A... [more]
ENSAMXT00000037803.11.508e-624.48inter-alpha-trypsin inhibitor heavy chain H3-like ... [more]
ENSAMXT00000057721.11.680e-624.48inter-alpha-trypsin inhibitor heavy chain H3-like ... [more]
back to top
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000008921.11.849e-4743.80pep scaffold:Pmarinus_7.0:GL477596:1845:16253:1 ge... [more]
ENSPMAT00000008919.17.364e-4644.31pep scaffold:Pmarinus_7.0:GL477596:1845:16253:1 ge... [more]
ENSPMAT00000001432.13.519e-2632.62pep scaffold:Pmarinus_7.0:GL485617:3236:10216:1 ge... [more]
back to top
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO283274.780e-2439.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416551.390e-2135.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of von Willebrand factor A domain-containing protein 3A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of von Willebrand factor A domain-containing protein 3A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022332.14.110e-13100.00SMESG000022332.1[more]
SMESG000022334.12.907e-1399.66SMESG000022334.1[more]
SMESG000047774.11.212e-4637.72SMESG000047774.1[more]
SMESG000047774.11.255e-4637.72SMESG000047774.1[more]
SMESG000047774.11.301e-4637.72SMESG000047774.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034618 ID=SMED30034618|Name=von Willebrand factor A domain-containing protein 3A|organism=Schmidtea mediterranea sexual|type=transcript|length=4287bp
TTTGTTTAAATAATTTCCATACTCCAATGATATTTGTATCTAAGTGAATT
ATTTACTTTGAAAAAAGCAGCAAATTGAAAATGTATCGAAAAGACAAAGT
TGCCGTTGCAGTCGATAGTTATAAAAGAAAGTATAGTGACGATGAAAACG
AGGATAGTCTCCAAAATAATAGTAATAATATTGATAAAGAAAACGAATCA
GAAAAATCTAGTTCTGATGAAAGAAATGAAATTATAGAGGACAATAAAAC
TAAAGCCATTAAGTCGGTTAAAGCTGCCAACAGAGCAACTAATCTTATAG
AAAAAAAACAAGTCGAAGGTTTTAACATGTTTTTGAATAAAATAAAACCT
ACAGATAATAGAAACAGCAATAATCAAAATTCAAGTAACAAAGTAAAGAA
CTTTGAAATAATTGACCGAAACAAAAAATATTATCCACCAAACCAATTTA
CGGTAACTTCAATTAATCAAGCTCATGATTTATTGAGAGTTCAAAACAAT
CCAGCGGTATCAGGAGATGAGCAATCATCTGAAGATTGGCTGAAAACACA
TAATTTAGATGCTTTGCAGTTGACAATCGAAGACTTAATATCCAAAGGAA
AATTGGGTAATCCTAGACCCGATGAGCAAACTGGAACAGCTTACAACTGT
TTAGTGTACGATGATTTTATTGTTACGGATTATGAATACAAACTCCATAT
GGCTATAGAAATGTACAGCAAGCGAATAAAATGGTATTTACAGGGAAGTA
GAAAAATGTTTGGATTTGTAAGTGGAAGCAAATTAGCAGTTTTAATCGAC
TCATCGGACGCTAACCTAGGATTCGGGCGAGTAATTTCATTCCAGGATAA
CTTATTGCATTTGTTGGATGAACAGCTTTTCAAGAAAAAGTCCATAAATA
TAGGATATTTTGGAACGAATACAAAATTTTTGTATCAAGATTTTATGAAT
CTAAATTGCAGAGTCATTGAGGAAATAAAGGAATCATTTTCCACTATGTC
ATCCCTTGGTGGCTGTAATCTAATGCAAGCACTGAAATATGTAACCAAAG
AAAAATCAATCGATGAAGTGCTTCTTATCTTAGGCAGCTGTCCGGATCAA
GAAGCAAAAATGTTGATGTATTTTGTTCAACAGCTCTTATTAGGTCGAGA
TTTGCCTTTCCATTGCGTTTCCTATGAAACGCAAAGTGAAGAAGTCAGCT
CAATTCTAAAGTATATTGCAACCATAAGTCACGGTAATTACCATAGATAT
TCCTCCATGACAGAGGAACTGATGTATACTAGTAATGACATCGACTTGCT
GCTTTTAGAAATTGAAAGAACTCAAGAAGTGCTTGAGAAAATAGAACTAA
TGCGAAGGGGAATATTTTCAAATCGAGCCTCTCCGTACATTAATCAGATA
GCGGAAGAATTGAAAAATATTCCCCAATCAGAAAATTTGCCAAAACCAAT
ATCGTTCAATGATCCACTGAAATTTGAAGTGCCAAAATTTGAACCTCGCA
CTTCATCGGAATGGTTAGGCAAAAGCGGACTCAAAGCAAAGAAATTGGGC
TTGTATTCAAAAAACATTTTAAGTGCTACAATGGCTAATAATTTTGAGCG
AAACCCAACATCGTATCCTGTCATTGAAATGTCAGATGTTTTTCCATTAC
GTGAGTCGAATTTTACTCGTGACGCCAATATTTCACGGAAATCCATTCAA
GGACGAAGATTTTCGTCTACGATTTCGAAACCTGTAAAATCGAGAATTTC
ACAAATATTAACGATTGATAATTTAAAAGAATTTAGTCAGTTTGGTAGTG
AGTTTGAAGGCATAAAAGAAAGCACAGACGAAAAGAGATTTATTGAGATG
TTTACTGAAAATATTCTCAGTAAAAACGCATACGAAAGTAAATCAGAATT
CATTCCATCAATCGGCAGAATGGTCACATCCAGTGTCTATGAGAAAGCAA
TGATACAAGTGGAATGGCCAGATGGCTCAGTGAGAAATGTTCACGCTGAT
TTGGCACAGCTTTTTGAATATCAGAAACTTTTGGGTGAACAGGTAAAATT
AATGGAGCAACGAATAACTTGGCTTTCGACTGGAAGTCGAAGAATATTTG
GCACGATAATTGAAAGAAAAGTCATTCTCATTTTAGACCTGTCCATATCG
AATATAAAATATCTAGTCCATATTCTTCAATCGCTCAAAATCCTTATACA
GCAACAACTAAAGGCTAAAGACAAATTTAACATTATTGCTTTTTCCAACA
CGATTAGTTCATTCAAAGCTGGCTTGACTGTTGTAAACGAAACGAACTTA
CAAGACTCGTGGTCATGGCTTCGAAGTCTTAATTGCAGTGGAAGTAGAAA
TCTTCTTGGCGCTCTAAAACATGTATTTGAGAATCCGGTAGATTCTGTGC
ATAATGATTATGCTCAAGGAATATATTTATTCACATCCGGTGTTCCTGAT
CAACAAATTGAGCCTCTTATGGCCTACATCGAAGAAAGAGTTCTGGGAAC
AGATATTAAGATTCATACAGTTTTATTTAACGTTGACGATTATGATGTAT
CAGGCACTCCTATACCAAGCCGATATGCAAATATTACCAAGACGGCTGAA
ATCATGCGGATGCTGGCCCACAGTACCAAAGGGAGATTTCACTGGTTTCG
TGAATCGGGAATTATTGAGAGTGATGATATCAGAGTTTTGATGGCTGAGA
TAGATTTAGCGGTGGAATATTCGAGGCGGACCCAACAAATTATTAATGAT
TATAAAGAAAAATACCCACCAAGTCATTCAAAGAAGAATGAAGATATAAT
CAAAAATGCCGTGGAACTTTGTAGAAGAAACTCTAGTGATAATATGGTCG
CTTTGATGCCTCCTAGACAAACATCTTTAAGCAAGGCACGCTTAAAATAT
TTGTCAGATAAAACTGAAGAAAATCTCAAAATTCCAAAAACCTTGGCTTA
TAAATCAGATATAGATCCTAGGAAAAGTATCACCAATTCTAAACCTCCTT
ATAGACCGGTAATTCAATCGGCATTTTATACTGAGGACAAGAATTCTAAA
GGAGTAGTTTATCGAGACTATCCTGGTCAAAACATGCATTCTAGAAGAGG
TATTGGTAAGGCAGTGATTCCGGATAAAGAAGAATGGATAACTAGCAAAG
ATTGGATGAAGAAATATTCTTTGAAAAATATGGGGCTTGACCTTTTAAGA
CTTGTATCGGGTCCTGAATGTCGCCACGAAGAAGCATTAATTATTCCACT
GGAAAAATATGTTGAGGCGAAATATTGCGCTGGTTTATTTCCAATAGTCA
ACGTGAAAGGTACAAGGAAACACCTTCAATACACAGTTACAGAGCTAAAC
AAATACAGTGTTGAAGCGAAAAAAGCTTTGATTCGGTATATGAAACGACT
GGAATGGTTAATGATTAGCAGTAAAAGAATATTCGGTGTTATTACTGAGA
CTGACGTAGCTATTTTATTGGACACCAGCGGCTCTATGACCCCCCATATG
CCAGAATTAATATTGAATCTCAAGGCTCTGATTTGGGAGCAACTATTCAA
AAGAAAAATCAGTTATAATATAATTGCATTCAATTCTCAAATCCGTCGGT
TTCGAGAACGATTGGTGACTCCTGACGAATCGAGTTGCCATTCGGCCATT
GGATGGACGGAACATTTAGTTGCGTGTGGCAATACTGACACCACCAAGGC
TTTGCTAATAACATTAGAAGATCCTCGAATCCAAGGAATATATTTATTGA
CAGATGGTAAACCAGATAACAGCACGGAAATAGTATTAAAAAACGTTCAA
AATATAATGTCATCAAGAAAGACAAAAGTTCCAATTCATACAATTTCATT
CAACTGCGAAGACGAGAGCGCCAATGAATTTTTGAAACGTTTGGCGCGAA
TGTCAAATGGTCGCTATCACAAGGTCTGCCATGACTATGACATCAGGATG
TTTTCACAGCGCGTTATTGAACAATCAAAAACAACAGCTCTACCTCAGAA
TGATATTGACACCAAACAAGACCGAACGACTGTTGCCGCAGATTTACTCA
GTATTGACCCCCACTATCCTCCGTTGCCGAATCTCGAGGGCGATGATTTG
GTGAGACTTGCGAAAGAAATCCAGTTAACCAGAGAGAATCTAGCAAAAAT
CAACTATTTCCGACAGCTTCATATTCAACTACAAAAGTATCAAGAGCAAA
TCAAAGCAGAGGAAATTAAAGCTCATTTAATATGACCAGAAATTTTATGA
TTATTTTCATATGGTTTATTATTATTATTATTATTAT
back to top

protein sequence of SMED30034618-orf-1

>SMED30034618-orf-1 ID=SMED30034618-orf-1|Name=SMED30034618-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1385bp
MYRKDKVAVAVDSYKRKYSDDENEDSLQNNSNNIDKENESEKSSSDERNE
IIEDNKTKAIKSVKAANRATNLIEKKQVEGFNMFLNKIKPTDNRNSNNQN
SSNKVKNFEIIDRNKKYYPPNQFTVTSINQAHDLLRVQNNPAVSGDEQSS
EDWLKTHNLDALQLTIEDLISKGKLGNPRPDEQTGTAYNCLVYDDFIVTD
YEYKLHMAIEMYSKRIKWYLQGSRKMFGFVSGSKLAVLIDSSDANLGFGR
VISFQDNLLHLLDEQLFKKKSINIGYFGTNTKFLYQDFMNLNCRVIEEIK
ESFSTMSSLGGCNLMQALKYVTKEKSIDEVLLILGSCPDQEAKMLMYFVQ
QLLLGRDLPFHCVSYETQSEEVSSILKYIATISHGNYHRYSSMTEELMYT
SNDIDLLLLEIERTQEVLEKIELMRRGIFSNRASPYINQIAEELKNIPQS
ENLPKPISFNDPLKFEVPKFEPRTSSEWLGKSGLKAKKLGLYSKNILSAT
MANNFERNPTSYPVIEMSDVFPLRESNFTRDANISRKSIQGRRFSSTISK
PVKSRISQILTIDNLKEFSQFGSEFEGIKESTDEKRFIEMFTENILSKNA
YESKSEFIPSIGRMVTSSVYEKAMIQVEWPDGSVRNVHADLAQLFEYQKL
LGEQVKLMEQRITWLSTGSRRIFGTIIERKVILILDLSISNIKYLVHILQ
SLKILIQQQLKAKDKFNIIAFSNTISSFKAGLTVVNETNLQDSWSWLRSL
NCSGSRNLLGALKHVFENPVDSVHNDYAQGIYLFTSGVPDQQIEPLMAYI
EERVLGTDIKIHTVLFNVDDYDVSGTPIPSRYANITKTAEIMRMLAHSTK
GRFHWFRESGIIESDDIRVLMAEIDLAVEYSRRTQQIINDYKEKYPPSHS
KKNEDIIKNAVELCRRNSSDNMVALMPPRQTSLSKARLKYLSDKTEENLK
IPKTLAYKSDIDPRKSITNSKPPYRPVIQSAFYTEDKNSKGVVYRDYPGQ
NMHSRRGIGKAVIPDKEEWITSKDWMKKYSLKNMGLDLLRLVSGPECRHE
EALIIPLEKYVEAKYCAGLFPIVNVKGTRKHLQYTVTELNKYSVEAKKAL
IRYMKRLEWLMISSKRIFGVITETDVAILLDTSGSMTPHMPELILNLKAL
IWEQLFKRKISYNIIAFNSQIRRFRERLVTPDESSCHSAIGWTEHLVACG
NTDTTKALLITLEDPRIQGIYLLTDGKPDNSTEIVLKNVQNIMSSRKTKV
PIHTISFNCEDESANEFLKRLARMSNGRYHKVCHDYDIRMFSQRVIEQSK
TTALPQNDIDTKQDRTTVAADLLSIDPHYPPLPNLEGDDLVRLAKEIQLT
RENLAKINYFRQLHIQLQKYQEQIKAEEIKAHLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004674protein serine/threonine kinase activity
GO:0005524ATP binding
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0008150biological_process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005575cellular_component
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036465vWFA_dom_sf
IPR002035VWF_A
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1360..1380
NoneNo IPR availableCOILSCoilCoilcoord: 404..424
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 35..51
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 13..51
NoneNo IPR availablePANTHERPTHR46478FAMILY NOT NAMEDcoord: 71..492
coord: 594..1371
IPR036465von Willebrand factor A-like domain superfamilyGENE3DG3DSA:3.40.50.410coord: 678..865
e-value: 3.1E-9
score: 39.0
coord: 1124..1300
e-value: 1.3E-15
score: 59.8
IPR036465von Willebrand factor A-like domain superfamilySUPERFAMILYSSF53300vWA-likecoord: 1124..1287
IPR036465von Willebrand factor A-like domain superfamilySUPERFAMILYSSF53300vWA-likecoord: 680..855
IPR002035von Willebrand factor, type APFAMPF13768VWA_3coord: 681..817
e-value: 1.4E-10
score: 41.4
coord: 235..388
e-value: 4.2E-16
score: 59.3
coord: 1125..1280
e-value: 4.5E-15
score: 55.9
IPR002035von Willebrand factor, type APROSITEPS50234VWFAcoord: 1125..1304
score: 10.077