TTF-type domain-containing protein

Overview
NameTTF-type domain-containing protein
Smed IDSMED30034615
Length (bp)800
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TTF-type domain-containing protein (SMED30034615) t-SNE clustered cells

Violin plots show distribution of expression levels for TTF-type domain-containing protein (SMED30034615) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034615

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30034615h1SMcG0010442 dd_Smed_v4_13756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034615h1SMcG0010442 dd_Smed_v4_13756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TTF-type domain-containing protein vs. Ensembl Human
Match: ZMYM5 (zinc finger MYM-type containing 5 [Source:HGNC Symbol;Acc:HGNC:13029])

HSP 1 Score: 73.1738 bits (178), Expect = 4.941e-14
Identity = 43/110 (39.09%), Postives = 58/110 (52.73%), Query Frame = 2
Query:  296 DPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENS 625
            DP  WP   N K RD ++    +V   + N   FP+ +  R FS++   R L NGE   R+WLLYS S D VFC+ CKLF   K +      G  +W+H++  L  HE S
Sbjct:  521 DPGTWPRILNIKQRDTLVE---NVPPQVRNFN-FPKDNTGRKFSETYYTRILPNGEKTTRSWLLYSTSKDSVFCLYCKLFGEGKNQLKNEN-GCKDWQHLSHILSKHEES 625          
BLAST of TTF-type domain-containing protein vs. Ensembl Zebrafish
Match: CR762475.1 (pep chromosome:GRCz11:4:55494751:55498830:1 gene:ENSDARG00000098243.2 transcript:ENSDART00000172605.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR762475.1)

HSP 1 Score: 49.2914 bits (116), Expect = 2.616e-6
Identity = 25/83 (30.12%), Postives = 39/83 (46.99%), Query Frame = 2
Query:  386 VTKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSD---KTKSSLATVGINNWKHITEYLKSHENS 625
            V  FP+    R F +S             R WL YS   D ++C  C++F  +   K K++  T+GIN W+  T  +K H ++
Sbjct:  190 VMTFPKNAEGRSFQRSWYTD---------RPWLEYSPKNDAIYCFSCRIFLREEKFKNKTAWKTLGINTWRSATGKMKEHAST 263          
BLAST of TTF-type domain-containing protein vs. Ensembl Mouse
Match: Zmym5 (zinc finger, MYM-type 5 [Source:MGI Symbol;Acc:MGI:3041170])

HSP 1 Score: 63.929 bits (154), Expect = 3.971e-11
Identity = 41/115 (35.65%), Postives = 58/115 (50.43%), Query Frame = 2
Query:  296 DPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPEFYI 640
            DP  WP   N K R+ ++    +    + N   FP+    + FS++   R L NGE   R WLLYSAS D VFC+ C+LF   K +      G  +W H++  L  H+ S E +I
Sbjct:  486 DPGSWPRILNMKQREFLVK---NNPPQIRNFN-FPKDSAGKKFSETYYTRILPNGEKGTRPWLLYSASKDSVFCLYCRLFGEGKNQLRNEN-GCKDWHHLSHLLSKHDES-EMHI 594          
BLAST of TTF-type domain-containing protein vs. Ensembl Mouse
Match: Zmym5 (zinc finger, MYM-type 5 [Source:MGI Symbol;Acc:MGI:3041170])

HSP 1 Score: 63.929 bits (154), Expect = 3.971e-11
Identity = 41/115 (35.65%), Postives = 58/115 (50.43%), Query Frame = 2
Query:  296 DPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPEFYI 640
            DP  WP   N K R+ ++    +    + N   FP+    + FS++   R L NGE   R WLLYSAS D VFC+ C+LF   K +      G  +W H++  L  H+ S E +I
Sbjct:  486 DPGSWPRILNMKQREFLVK---NNPPQIRNFN-FPKDSAGKKFSETYYTRILPNGEKGTRPWLLYSASKDSVFCLYCRLFGEGKNQLRNEN-GCKDWHHLSHLLSKHDES-EMHI 594          
BLAST of TTF-type domain-containing protein vs. Ensembl Mouse
Match: Zmym5 (zinc finger, MYM-type 5 [Source:MGI Symbol;Acc:MGI:3041170])

HSP 1 Score: 63.929 bits (154), Expect = 3.971e-11
Identity = 41/115 (35.65%), Postives = 58/115 (50.43%), Query Frame = 2
Query:  296 DPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPEFYI 640
            DP  WP   N K R+ ++    +    + N   FP+    + FS++   R L NGE   R WLLYSAS D VFC+ C+LF   K +      G  +W H++  L  H+ S E +I
Sbjct:  486 DPGSWPRILNMKQREFLVK---NNPPQIRNFN-FPKDSAGKKFSETYYTRILPNGEKGTRPWLLYSASKDSVFCLYCRLFGEGKNQLRNEN-GCKDWHHLSHLLSKHDES-EMHI 594          
BLAST of TTF-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4R3D6|ZMYM5_MACFA (Zinc finger MYM-type protein 5 OS=Macaca fascicularis OX=9541 GN=ZMYM5 PE=2 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 2.118e-13
Identity = 44/115 (38.26%), Postives = 61/115 (53.04%), Query Frame = 2
Query:  296 DPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPEFYI 640
            DP  WP   N K RD ++    +V   + N   FP+ +  R FS++   R L NGE   R+WLLYS S D VFC+ C+LF   K +      G  +W+H++  L  HE S E +I
Sbjct:  518 DPGTWPRILNIKQRDTLVE---NVPPQVRNFN-FPKDNTGRKFSETYYTRILPNGEKTTRSWLLYSTSKDSVFCLYCRLFGEGKNQLKNEN-GCKDWQHLSHILSKHEES-EMHI 626          
BLAST of TTF-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UJ78|ZMYM5_HUMAN (Zinc finger MYM-type protein 5 OS=Homo sapiens OX=9606 GN=ZMYM5 PE=1 SV=4)

HSP 1 Score: 73.1738 bits (178), Expect = 2.373e-13
Identity = 43/110 (39.09%), Postives = 58/110 (52.73%), Query Frame = 2
Query:  296 DPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENS 625
            DP  WP   N K RD ++    +V   + N   FP+ +  R FS++   R L NGE   R+WLLYS S D VFC+ CKLF   K +      G  +W+H++  L  HE S
Sbjct:  521 DPGTWPRILNIKQRDTLVE---NVPPQVRNFN-FPKDNTGRKFSETYYTRILPNGEKTTRSWLLYSTSKDSVFCLYCKLFGEGKNQLKNEN-GCKDWQHLSHILSKHEES 625          
BLAST of TTF-type domain-containing protein vs. UniProt/SwissProt
Match: sp|A6QPH9|ZMYM5_BOVIN (Zinc finger MYM-type protein 5 OS=Bos taurus OX=9913 GN=ZMYM5 PE=2 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 5.969e-12
Identity = 45/117 (38.46%), Postives = 59/117 (50.43%), Query Frame = 2
Query:  296 DPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKF--PRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPEFYI 640
            DP  WP   + K RD +      VE+    V  F  P+    R FS++   R L NGE   R+WLLYS S D VFC+ CKLF   K +      G  +W+H++  L  HE S E +I
Sbjct:  521 DPGTWPRILSIKQRDTL------VENDPPQVRNFNFPKDSTGRKFSETYYTRILANGEKTTRSWLLYSTSKDSVFCLYCKLFGEGKNQLKNEN-GCRDWQHLSHILSKHEES-EMHI 629          
BLAST of TTF-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3U2E2|ZMYM5_MOUSE (Zinc finger MYM-type protein 5 OS=Mus musculus OX=10090 GN=Zmym5 PE=2 SV=2)

HSP 1 Score: 63.929 bits (154), Expect = 2.778e-10
Identity = 41/115 (35.65%), Postives = 58/115 (50.43%), Query Frame = 2
Query:  296 DPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPEFYI 640
            DP  WP   N K R+ ++    +    + N   FP+    + FS++   R L NGE   R WLLYSAS D VFC+ C+LF   K +      G  +W H++  L  H+ S E +I
Sbjct:  486 DPGSWPRILNMKQREFLVK---NNPPQIRNFN-FPKDSAGKKFSETYYTRILPNGEKGTRPWLLYSASKDSVFCLYCRLFGEGKNQLRNEN-GCKDWHHLSHLLSKHDES-EMHI 594          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: A0A3L6F912 (Zinc finger MYM-type protein 1 OS=Zea mays OX=4577 GN=ZMYM1_3 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.136e-22
Identity = 63/134 (47.01%), Postives = 75/134 (55.97%), Query Frame = 2
Query:  230 SFKTTHQSPSSTSTGDVQTDINDPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPE 631
            S  T  +S S      V  DI DP  W    N K RD ++  G   E +L     FP   N+R FS S  +RKL+NGE + R WL+YS   D+VFC CCKLF SD   SSLA  G  +WKHI+E LK HENS E
Sbjct:  249 SHPTATESASVDEPPVVTIDIYDPRNWNNLDN-KARDRLVEKGPIREKNLF----FPMDGNSRYFSYSHYFRKLSNGEEHDRKWLVYSKHVDRVFCFCCKLFNSDSCTSSLAHDGYRDWKHISERLKEHENSAE 377          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: A0A2S2N685 (Zinc finger MYM-type protein 5 (Fragment) OS=Schizaphis graminum OX=13262 GN=ZMYM5_10 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 4.149e-22
Identity = 56/146 (38.36%), Postives = 82/146 (56.16%), Query Frame = 2
Query:  287 DINDPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPEFYIIRRNYLPTMTCLSFAKICI*NLKWKIIA 724
            + N+   WP    S  +D++I  G  +         FP+ +NNR FS SL +R ++NGE YLR WL+YS + + VFC  CK+F    ++S+LA  G+ +WKH+ EYLK+HENSP        +L T   L   K     L+ +I+A
Sbjct:   95 NFNEIAYWPEQLTSTDKDYLITTGPKMSIDYMKNFNFPKDNNNRSFSYSLFFRTISNGEKYLRKWLVYSETVNAVFCFFCKIF-DPTSRSNLAKDGLKDWKHVHEYLKTHENSPHHIKCASMWLETNIRLKENKSIDAGLQKQIVA 239          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: A0A1D6NAY9 (General transcription factor 2-related zinc finger protein OS=Zea mays OX=4577 GN=ZEAMMB73_Zm00001d043373 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 4.683e-22
Identity = 69/169 (40.83%), Postives = 91/169 (53.85%), Query Frame = 2
Query:  230 SFKTTHQSPSSTSTGDVQTDINDPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPEF-------YIIRRNYLPTMTCLSFAKICI*NLKWK 715
            S  T  +S S      V  DI DP  W    N K RD ++  G   E +L     FP   N+R FS S  +RKL+NGE + R WL+YS   D+VFC CCKLF SD   SSLA  G  +WKHI+E LK HENS E        + +  +++P++T  S   +C  N +W+
Sbjct:   51 SHPTATESASVDEPPVVTIDIYDPRNWNNLDN-KARDTLVEKGPIREKNLV----FPMDGNSRHFSYSHYFRKLSNGEQHDRKWLVYSKHVDRVFCFCCKLFNSDSCTSSLAHDGYRDWKHISERLKEHENSAEHITGSTKRWKVLLDHVPSLTVKS---LC--NTRWE 209          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: A0A2S2QYV6 (Zinc finger MYM-type protein 1 OS=Sipha flava OX=143950 GN=ZMYM1_2 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.173e-21
Identity = 56/119 (47.06%), Postives = 71/119 (59.66%), Query Frame = 2
Query:  281 QTDINDPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPEFY 637
            Q D+ DP LWP    + + D +I  G        N   FP+  NNR FSK    RKL+N E + R WL+YS S D+VFC CCKLF S  + S+L+T G N+WKH+T  L SHE SPE +
Sbjct:  156 QPDLFDPYLWPDNRQNNLIDIVIKMG----PREINEDIFPKDENNRHFSKIYQIRKLDNNEKFKRRWLVYSKSIDRVFCFCCKLFNS--SHSTLSTTGNNDWKHMTTILISHEKSPEHF 268          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: A0A1D6ML06 (General transcription factor 2-related zinc finger protein OS=Zea mays OX=4577 GN=ZEAMMB73_Zm00001d039761 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.186e-21
Identity = 62/131 (47.33%), Postives = 74/131 (56.49%), Query Frame = 2
Query:  239 TTHQSPSSTSTGDVQTDINDPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPE 631
            T  +S S      V  DI DP  W    N K RD ++  G   E +L     FP   N+R FS S  +RKL+NGE + R WL+YS   D+VFC CCKLF SD   SSLA  G  +WKHI+E LK HENS E
Sbjct:   54 TATESASVDEPPVVTIDIYDPRNWNNLDN-KARDTLVEKGPIREKNLV----FPMDGNSRHFSYSHYFRKLSNGEQHDRKWLVYSKHVDRVFCFCCKLFNSDSCTSSLAHDGYRDWKHISERLKEHENSAE 179          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000036272.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:11935414:11938921:1 gene:ENSAMXG00000041670.1 transcript:ENSAMXT00000036272.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.1149 bits (209), Expect = 2.253e-18
Identity = 46/127 (36.22%), Postives = 66/127 (51.97%), Query Frame = 2
Query:  254 PSSTSTGDVQT-DINDPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPE 631
            PS    G+V      DP LWPV  +   R  ++  G      + +  +FPRG + R F   L Y+ L N E   R+W++YSA  + VFC  CKLF +  T+  L   G ++W +I   L+SHE SP+
Sbjct:   79 PSPNDDGEVNVPSSKDPALWPVHISDSDRVELVRGG---PLMVPDTFQFPRGPDGRAFHAGLQYKSLPNKEKIKRSWMVYSAQSNAVFCFPCKLFGTKSTR--LTKTGYSDWSNINICLRSHEGSPD 200          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000044961.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000032.1:419978:423709:1 gene:ENSAMXG00000036481.1 transcript:ENSAMXT00000044961.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 3.571e-14
Identity = 50/144 (34.72%), Postives = 72/144 (50.00%), Query Frame = 2
Query:  227 SSFKTTHQSPSSTSTGDVQTDI---------NDPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNN--RCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENS 625
            +S  T   SP   STGD+ T           +DP  WP       R  I+  G      +T++ +FP+   N  R F+K    R + NGE  LR+WL+YS S D VFC  C +F   K  ++L+ +  + WK++T +LK HE S
Sbjct:   35 ASTSTQIASPPHLSTGDISTAQGTTSTFIIDDDPAQWPKVLTDSERCQIVRKGT---VQITDI-QFPQNSENPPRRFTKENYRRTMKNGEKILRSWLVYSMSTDSVFCFPCTVF--GKRDNALSKLWFHKWKNLTYHLKEHEYS 172          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000035531.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000029.1:6285841:6288423:1 gene:ENSAMXG00000041958.1 transcript:ENSAMXT00000035531.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 1.929e-12
Identity = 44/122 (36.07%), Postives = 62/122 (50.82%), Query Frame = 2
Query:  290 INDPTLWPVPPNSKIRDHIIYAGIDVESHLTNVT-KFPR-------GHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPE 631
            +NDP LWP     + R  ++  G   E+   N + K+P        G  +R F+ +LL   L NG++  R WLLYS S   V+C  CKLF S   K +    G ++WKH +E +  HE S E
Sbjct:  138 VNDPALWPSTITDQARSILVSRG---ETAFQNRSAKYPASVRDRGIGGTSRSFTNALLSCSLPNGQTVTRQWLLYSPSTGCVYCFACKLFSS---KHNTFVHGFSDWKH-SERIGEHEGSVE 252          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000037907.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002089.1:152797:155023:-1 gene:ENSAMXG00000037599.1 transcript:ENSAMXT00000037907.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 6.565e-12
Identity = 40/115 (34.78%), Postives = 58/115 (50.43%), Query Frame = 2
Query:  293 NDPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNN----RCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENS 625
            +DP LWP     + R  II  G         + +F    NN    R F+    + K+NNGE     WL+YS S D VFC CC +F  + +K +L++ G  +W +I  +L+ HE S
Sbjct:   12 DDPALWPETLTDQQRCEIIKRGP------VQIKEFDFPQNNDKIPRQFTVDNYHMKMNNGEKINWNWLVYSLSSDSVFCFCCTVFERE-SKFALSSSGFRSWINIHSHLRDHEKS 119          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000025204.2 (pep primary_assembly:Astyanax_mexicanus-2.0:12:7364240:7371214:-1 gene:ENSAMXG00000024490.2 transcript:ENSAMXT00000025204.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 1.492e-10
Identity = 33/80 (41.25%), Postives = 47/80 (58.75%), Query Frame = 2
Query:  392 KFPRGHNN--RCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENS 625
            +FP+   N  R F+K    R + NGE  LR+WL+YS S D VFC  C +    K  ++L+  G + WK++T +LK HE S
Sbjct:   45 EFPQNSENPPRRFTKENYRRTMKNGEKILRSWLVYSMSTDSVFCFPCTVL--GKRDNALSNCGFHKWKNLTYHLKEHEYS 122          
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000028133.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948955])

HSP 1 Score: 78.5666 bits (192), Expect = 4.446e-16
Identity = 54/158 (34.18%), Postives = 75/158 (47.47%), Query Frame = 2
Query:  173 LVGSNSFLVKKMEETPEESSFKTTHQSPSS----TSTGDVQTDINDPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNNRCFSKSLLYRK-LNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPE 631
            L+   SF  +  +  P  S+   T + P      T T + Q    DP  WP P   +IR  ++  G    S +     FPR  ++        +RK L +GE   RTWL+YS   + +FC CCKLF +     +L T G  NWKH + YL +HE SPE
Sbjct:   79 LLPEQSFDSEAEDVVPSTSTQLETSEMPGDETPLTPTAEDQPLPTDPAKWPSPLTDRIRMELVRRG---PSSIPPDFVFPRNDSDGRSCHHHYFRKTLVSGEKIARTWLMYSKVKNSLFCFCCKLFSNKNI--NLTTSGTANWKHASTYLTAHEKSPE 231          
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000042294.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:110016639])

HSP 1 Score: 78.5666 bits (192), Expect = 4.446e-16
Identity = 54/158 (34.18%), Postives = 75/158 (47.47%), Query Frame = 2
Query:  173 LVGSNSFLVKKMEETPEESSFKTTHQSPSS----TSTGDVQTDINDPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNNRCFSKSLLYRK-LNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPE 631
            L+   SF  +  +  P  S+   T + P      T T + Q    DP  WP P   +IR  ++  G    S +     FPR  ++        +RK L +GE   RTWL+YS   + +FC CCKLF +     +L T G  NWKH + YL +HE SPE
Sbjct:   79 LLPEQSFDSEAEDVVPSTSTQLETSEMPGDETPLTPTAEDQPLPTDPAKWPSPLTDRIRMELVRRG---PSSIPPDFVFPRNDSDGRSCHHHYFRKTLVSGEKIARTWLMYSKVKNSLFCFCCKLFSNKNI--NLTTSGTANWKHASTYLTAHEKSPE 231          
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045044.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948193])

HSP 1 Score: 78.5666 bits (192), Expect = 4.446e-16
Identity = 54/158 (34.18%), Postives = 75/158 (47.47%), Query Frame = 2
Query:  173 LVGSNSFLVKKMEETPEESSFKTTHQSPSS----TSTGDVQTDINDPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNNRCFSKSLLYRK-LNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPE 631
            L+   SF  +  +  P  S+   T + P      T T + Q    DP  WP P   +IR  ++  G    S +     FPR  ++        +RK L +GE   RTWL+YS   + +FC CCKLF +     +L T G  NWKH + YL +HE SPE
Sbjct:   79 LLPEQSFDSEAEDVVPSTSTQLETSEMPGDETPLTPTAEDQPLPTDPAKWPSPLTDRIRMELVRRG---PSSIPPDFVFPRNDSDGRSCHHHYFRKTLVSGEKIARTWLMYSKVKNSLFCFCCKLFSNKNI--NLTTSGTANWKHASTYLTAHEKSPE 231          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000003086.1 (SMESG000003086.1)

HSP 1 Score: 342.428 bits (877), Expect = 5.630e-121
Identity = 164/164 (100.00%), Postives = 164/164 (100.00%), Query Frame = 2
Query:  206 MEETPEESSFKTTHQSPSSTSTGDVQTDINDPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPEFYIIRRNYLPTMTCLSFAKICI 697
            MEETPEESSFKTTHQSPSSTSTGDVQTDINDPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPEFYIIRRNYLPTMTCLSFAKICI
Sbjct:    1 MEETPEESSFKTTHQSPSSTSTGDVQTDINDPTLWPVPPNSKIRDHIIYAGIDVESHLTNVTKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPEFYIIRRNYLPTMTCLSFAKICI 164          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000072194.1 (SMESG000072194.1)

HSP 1 Score: 129.028 bits (323), Expect = 1.704e-33
Identity = 69/105 (65.71%), Postives = 77/105 (73.33%), Query Frame = 2
Query:   44 NRRVQQTEKDNCNLNKKMKSPKVFTKYFQV*SKQGEEIGCSL*LVGSNSFLVKKMEETPEESSFKTTHQSPSSTSTGDVQTDINDPTLWPVPPNSKIRDHIIYAG 358
            NR+++   K N       KS KVFTKYFQV  KQ EEIGCS  +VGSNSFL +K+EETPEESS KTT QSPSST+TGDVQ +INDP LWPV  N KI DHIIY  
Sbjct:  319 NRKIRLQFKQN------KKSAKVFTKYFQVEYKQSEEIGCSSSIVGSNSFLDEKLEETPEESSLKTTPQSPSSTTTGDVQININDPALWPVSFNLKICDHIIYTA 417          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000061124.1 (SMESG000061124.1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.106e-19
Identity = 46/118 (38.98%), Postives = 64/118 (54.24%), Query Frame = 2
Query:  275 DVQTDINDPTLWPVPPNSKIRDHIIYAGIDVESHLTNV-TKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENS 625
            D+  ++NDP  WP+    K+ D +I  G      + N+ + +P     R FSK   YRKL NGE + R WL+YS   D  FC CCKLF   + K  L   G N+W+HI++ L  HE +
Sbjct:  100 DMCIELNDPACWPLALTDKVLDILIEKG-----PVQNIQSTYPLNEFGRSFSKVYFYRKLPNGEKFNREWLIYSPKNDATFCFCCKLFGKQEIK--LVNEGFNDWQHISDNLSRHEKT 210          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000061124.1 (SMESG000061124.1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.129e-19
Identity = 46/118 (38.98%), Postives = 64/118 (54.24%), Query Frame = 2
Query:  275 DVQTDINDPTLWPVPPNSKIRDHIIYAGIDVESHLTNV-TKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENS 625
            D+  ++NDP  WP+    K+ D +I  G      + N+ + +P     R FSK   YRKL NGE + R WL+YS   D  FC CCKLF   + K  L   G N+W+HI++ L  HE +
Sbjct:  100 DMCIELNDPACWPLALTDKVLDILIEKG-----PVQNIQSTYPLNEFGRSFSKVYFYRKLPNGEKFNREWLIYSPKNDATFCFCCKLFGKQEIK--LVNEGFNDWQHISDNLSRHEKT 210          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000061124.1 (SMESG000061124.1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.352e-19
Identity = 46/118 (38.98%), Postives = 64/118 (54.24%), Query Frame = 2
Query:  275 DVQTDINDPTLWPVPPNSKIRDHIIYAGIDVESHLTNV-TKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPDKVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENS 625
            D+  ++NDP  WP+    K+ D +I  G      + N+ + +P     R FSK   YRKL NGE + R WL+YS   D  FC CCKLF   + K  L   G N+W+HI++ L  HE +
Sbjct:  100 DMCIELNDPACWPLALTDKVLDILIEKG-----PVQNIQSTYPLNEFGRSFSKVYFYRKLPNGEKFNREWLIYSPKNDATFCFCCKLFGKQEIK--LVNEGFNDWQHISDNLSRHEKT 210          
The following BLAST results are available for this feature:
BLAST of TTF-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ZMYM54.941e-1439.09zinc finger MYM-type containing 5 [Source:HGNC Sym... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CR762475.12.616e-630.12pep chromosome:GRCz11:4:55494751:55498830:1 gene:E... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Zmym53.971e-1135.65zinc finger, MYM-type 5 [Source:MGI Symbol;Acc:MGI... [more]
Zmym53.971e-1135.65zinc finger, MYM-type 5 [Source:MGI Symbol;Acc:MGI... [more]
Zmym53.971e-1135.65zinc finger, MYM-type 5 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of TTF-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q4R3D6|ZMYM5_MACFA2.118e-1338.26Zinc finger MYM-type protein 5 OS=Macaca fascicula... [more]
sp|Q9UJ78|ZMYM5_HUMAN2.373e-1339.09Zinc finger MYM-type protein 5 OS=Homo sapiens OX=... [more]
sp|A6QPH9|ZMYM5_BOVIN5.969e-1238.46Zinc finger MYM-type protein 5 OS=Bos taurus OX=99... [more]
sp|Q3U2E2|ZMYM5_MOUSE2.778e-1035.65Zinc finger MYM-type protein 5 OS=Mus musculus OX=... [more]
back to top
BLAST of TTF-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3L6F9121.136e-2247.01Zinc finger MYM-type protein 1 OS=Zea mays OX=4577... [more]
A0A2S2N6854.149e-2238.36Zinc finger MYM-type protein 5 (Fragment) OS=Schiz... [more]
A0A1D6NAY94.683e-2240.83General transcription factor 2-related zinc finger... [more]
A0A2S2QYV61.173e-2147.06Zinc finger MYM-type protein 1 OS=Sipha flava OX=1... [more]
A0A1D6ML062.186e-2147.33General transcription factor 2-related zinc finger... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036272.12.253e-1836.22pep primary_assembly:Astyanax_mexicanus-2.0:20:119... [more]
ENSAMXT00000044961.13.571e-1434.72pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000035531.11.929e-1236.07pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000037907.16.565e-1234.78pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000025204.21.492e-1041.25pep primary_assembly:Astyanax_mexicanus-2.0:12:736... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000028133.14.446e-1634.18zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000042294.14.446e-1634.18zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000045044.14.446e-1634.18zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003086.15.630e-121100.00SMESG000003086.1[more]
SMESG000072194.11.704e-3365.71SMESG000072194.1[more]
SMESG000061124.11.106e-1938.98SMESG000061124.1[more]
SMESG000061124.11.129e-1938.98SMESG000061124.1[more]
SMESG000061124.11.352e-1938.98SMESG000061124.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034615 ID=SMED30034615|Name=TTF-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=800bp
AATTTGAATTAATTAATTTAAGAGTCCATCATGTCCGCAAATAAACCGTC
GGGTGCAACAAACCGAAAAAGACAATTGCAATTTAAACAAGAAAATGAAG
TCTCCAAAGGTATTTACGAAATATTTTCAAGTATAATCCAAGCAAGGTGA
AGAAATTGGTTGTTCTTTGTGATTAGTTGGTAGTAATTCTTTTTTGGTCA
AGAAAATGGAAGAAACGCCTGAAGAAAGTAGTTTCAAAACAACACATCAG
TCTCCTAGCTCTACCAGTACCGGTGACGTTCAAACAGATATAAATGATCC
TACACTATGGCCAGTTCCCCCTAATTCTAAAATTCGTGATCACATAATTT
ATGCAGGAATTGATGTAGAATCTCACCTAACAAATGTTACTAAATTTCCA
CGAGGTCATAACAATCGTTGTTTTTCGAAATCATTATTGTACAGAAAATT
AAATAACGGTGAATCGTATTTGCGAACCTGGCTACTATATTCAGCAAGTC
CCGATAAAGTGTTTTGTGTTTGTTGTAAGCTTTTTTATTCAGATAAAACT
AAATCATCACTGGCCACTGTTGGAATCAATAACTGGAAACACATTACTGA
ATATTTGAAATCGCATGAAAATTCACCCGAATTTTATATAATCAGAAGAA
ATTACCTGCCGACAATGACTTGCTTAAGTTTTGCAAAGATCTGCATTTGA
AATTTAAAATGGAAAATAATCGCGATATTGATGGCGCAGAATTATTTGAC
AAATTGAAATCTGCATCCACCTATTTGCCTAAAGATATTCTTGAACCTCT
back to top

protein sequence of SMED30034615-orf-1

>SMED30034615-orf-1 ID=SMED30034615-orf-1|Name=SMED30034615-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=165bp
MEETPEESSFKTTHQSPSSTSTGDVQTDINDPTLWPVPPNSKIRDHIIYA
GIDVESHLTNVTKFPRGHNNRCFSKSLLYRKLNNGESYLRTWLLYSASPD
KVFCVCCKLFYSDKTKSSLATVGINNWKHITEYLKSHENSPEFYIIRRNY
LPTMTCLSFAKICI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0007010cytoskeleton organization
GO:0007275multicellular organism development
GO:0022604regulation of cell morphogenesis