protein lin-9

Overview
Nameprotein lin-9 (AKG62108.1)
Smed IDSMED30034610
Length (bp)1840
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of protein lin-9 (SMED30034610) t-SNE clustered cells

Violin plots show distribution of expression levels for protein lin-9 (SMED30034610) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of protein lin-9 (SMED30034610) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for protein lin-9 (SMED30034610) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034610

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30034610SMESG000030984.1 SmedASXL_009176SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30034610SMESG000030984.1 SmedASXL_009176SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30034610SMESG000030984.1 dd_Smed_v4_4758_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034610SMESG000030984.1 dd_Smed_v4_4758_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034610SMESG000030984.1 dd_Smed_v4_4758_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034610SMESG000030984.1 dd_Smed_v4_4758_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of protein lin-9 vs. Ensembl Human
Match: LIN9 (lin-9 DREAM MuvB core complex component [Source:HGNC Symbol;Acc:HGNC:30830])

HSP 1 Score: 381.333 bits (978), Expect = 1.818e-125
Identity = 199/491 (40.53%), Postives = 308/491 (62.73%), Query Frame = 3
Query:  279 ERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSL-EFINKSVSILVQIRYLTMNEG---SAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            ++K +Q    +LRN+LKLPKAHKW  YEWFYSN+D+PL  G+NDF V L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF+EER++L  KR KIR LQQ++  ++   KDLPD+  IP+PL+IGT+VTAR+R   DGL+ G +DA+D +N +YR++F++  LGT  +PDYEVLS  PH+ +P++AF  + + SR  FM+P RL     LQS                                      P I ++ +   +G S           S+I+ ++ +  GG+P++FL+ VT+LSKIL +KK+ +++ R++N  A+   +   PIS+EFQ  Y T+++ LE+LNK+L + L  V Q+  E+A + G+ P +Q +D++++C+++A EI+    + +G      ++L + I++  +IL+QI+ L   EG   ++FE  S+ +SL ++KS +   NI  F++  EI + HI SGL+ + NL+ F
Sbjct:   74 DKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDE--IPLPLVIGTKVTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETMPIAAFGQKQRPSR-FFMTPPRLHYTPPLQS--------------------------------------PIIDNDPL---LGQSPWR--------SKISGSDTETLGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPCVENENLTDLISRLTAILLQIKCLA--EGGDLNSFEFKSLTDSLNDIKSTIDASNISCFQNNVEIHVAHIQSGLSQMGNLHAF 510          
BLAST of protein lin-9 vs. Ensembl Human
Match: LIN9 (lin-9 DREAM MuvB core complex component [Source:HGNC Symbol;Acc:HGNC:30830])

HSP 1 Score: 381.719 bits (979), Expect = 4.579e-125
Identity = 199/491 (40.53%), Postives = 308/491 (62.73%), Query Frame = 3
Query:  279 ERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSL-EFINKSVSILVQIRYLTMNEG---SAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            ++K +Q    +LRN+LKLPKAHKW  YEWFYSN+D+PL  G+NDF V L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF+EER++L  KR KIR LQQ++  ++   KDLPD+  IP+PL+IGT+VTAR+R   DGL+ G +DA+D +N +YR++F++  LGT  +PDYEVLS  PH+ +P++AF  + + SR  FM+P RL     LQS                                      P I ++ +   +G S           S+I+ ++ +  GG+P++FL+ VT+LSKIL +KK+ +++ R++N  A+   +   PIS+EFQ  Y T+++ LE+LNK+L + L  V Q+  E+A + G+ P +Q +D++++C+++A EI+    + +G      ++L + I++  +IL+QI+ L   EG   ++FE  S+ +SL ++KS +   NI  F++  EI + HI SGL+ + NL+ F
Sbjct:  114 DKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDE--IPLPLVIGTKVTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETMPIAAFGQKQRPSR-FFMTPPRLHYTPPLQS--------------------------------------PIIDNDPL---LGQSPWR--------SKISGSDTETLGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPCVENENLTDLISRLTAILLQIKCLA--EGGDLNSFEFKSLTDSLNDIKSTIDASNISCFQNNVEIHVAHIQSGLSQMGNLHAF 550          
BLAST of protein lin-9 vs. Ensembl Human
Match: LIN9 (lin-9 DREAM MuvB core complex component [Source:HGNC Symbol;Acc:HGNC:30830])

HSP 1 Score: 382.104 bits (980), Expect = 1.908e-124
Identity = 199/491 (40.53%), Postives = 308/491 (62.73%), Query Frame = 3
Query:  279 ERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSL-EFINKSVSILVQIRYLTMNEG---SAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            ++K +Q    +LRN+LKLPKAHKW  YEWFYSN+D+PL  G+NDF V L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF+EER++L  KR KIR LQQ++  ++   KDLPD+  IP+PL+IGT+VTAR+R   DGL+ G +DA+D +N +YR++F++  LGT  +PDYEVLS  PH+ +P++AF  + + SR  FM+P RL     LQS                                      P I ++ +   +G S           S+I+ ++ +  GG+P++FL+ VT+LSKIL +KK+ +++ R++N  A+   +   PIS+EFQ  Y T+++ LE+LNK+L + L  V Q+  E+A + G+ P +Q +D++++C+++A EI+    + +G      ++L + I++  +IL+QI+ L   EG   ++FE  S+ +SL ++KS +   NI  F++  EI + HI SGL+ + NL+ F
Sbjct:  169 DKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDE--IPLPLVIGTKVTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETMPIAAFGQKQRPSR-FFMTPPRLHYTPPLQS--------------------------------------PIIDNDPL---LGQSPWR--------SKISGSDTETLGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPCVENENLTDLISRLTAILLQIKCLA--EGGDLNSFEFKSLTDSLNDIKSTIDASNISCFQNNVEIHVAHIQSGLSQMGNLHAF 605          
BLAST of protein lin-9 vs. Ensembl Human
Match: LIN9 (lin-9 DREAM MuvB core complex component [Source:HGNC Symbol;Acc:HGNC:30830])

HSP 1 Score: 357.836 bits (917), Expect = 9.172e-117
Identity = 188/465 (40.43%), Postives = 292/465 (62.80%), Query Frame = 3
Query:  279 ERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSL-EFINKSVSILVQIRYLTMNEG---SAFECSSVYESLREMKSELSPHNIQ 1661
            ++K +Q    +LRN+LKLPKAHKW  YEWFYSN+D+PL  G+NDF V L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF+EER++L  KR KIR LQQ++  ++   KDLPD+  IP+PL+IGT+VTAR+R   DGL+ G +DA+D +N +YR++F++  LGT  +PDYEVLS  PH+ +P++AF  + + SR  FM+P RL     LQS                                      P I ++ +   +G S           S+I+ ++ +  GG+P++FL+ VT+LSKIL +KK+ +++ R++N  A+   +   PIS+EFQ  Y T+++ LE+LNK+L + L  V Q+  E+A + G+ P +Q +D++++C+++A EI+    + +G      ++L + I++  +IL+QI+ L   EG   ++FE  S+ +SL ++KS +   NI+
Sbjct:   79 DKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDE--IPLPLVIGTKVTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETMPIAAFGQKQRPSR-FFMTPPRLHYTPPLQS--------------------------------------PIIDNDPL---LGQSPWR--------SKISGSDTETLGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPCVENENLTDLISRLTAILLQIKCLA--EGGDLNSFEFKSLTDSLNDIKSTIDASNIR 489          
BLAST of protein lin-9 vs. Ensembl Celegans
Match: lin-9 (pep chromosome:WBcel235:III:8900240:8904160:-1 gene:WBGene00002998.1 transcript:ZK637.7a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-9)

HSP 1 Score: 213.386 bits (542), Expect = 1.231e-60
Identity = 144/472 (30.51%), Postives = 242/472 (51.27%), Query Frame = 3
Query:  294 QANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSV---ELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLA-----HVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSLEFINKSVSILVQIRYLTMNEGSAFECSSVYESLREMKSELSPHNIQNFEDKTEI 1685
            +AN  KL N+L+  KA +WV  E+FYS +D  +   EN+F   +RE+FP LK   LTR +W  IRK++GKPRRCS  FF+EER  L  KR KIR++ +   +    +D LKDLP    +P P+++G +V AR+R+P DG+Y G +DA+  +   +RI F+KP +    V D E+L     D++ ++ F  Q               A S L SG           R  +++ +D +  +    V         + S  +  S G   L  PN      R+    A++ G +P+KFLV + KL+K++++KK  + +  +LN  A+ +  T +  S  FQ  Y   II+LE +N+ +   +      H+   +N+I+  +  P       ++Q C   A   +  C    G  + ++ +L  I    ++L+Q+R +   + SA +  S+ +++ E+++ + P N+  F+D  E+
Sbjct:  200 RANIKKLYNLLRYKKARQWVMCEFFYSAIDEQIFKEENEFATIIRESFPNLKNWNLTRIEWRSIRKLLGKPRRCSKVFFEEERMYLEEKRMKIRSVYEGSYLNDPSID-LKDLPAK--LPRPMVVGNRVFARIRNPYDGIYSGIIDAV--IPKGFRIIFDKPDIPPTLVSDTEILLDGKLDLLSIAYFIEQ---------------ANSKLPSGV----------RPFVAAVRDSSHPHLVRDV---------LVSRKIERSGG--PLMGPN----DERLNGKNAEMVGNFPLKFLVNLVKLTKLIDIKKGLIRQLNELNADAEIQNMTSDKYSKAFQEKYAKTIIDLEHVNQNIDINMNGIQDHHMYFSSNDISTSNMKP-----EAVRQMCSQQAGRFVEHCNQ--GLNVENVHALTLIQSLTAVLLQVRTMGTQKISAVDLQSLGDAISEIRTAIHPRNVAFFQDYVEV 619          
BLAST of protein lin-9 vs. Ensembl Celegans
Match: lin-9 (pep chromosome:WBcel235:III:8900237:8904131:-1 gene:WBGene00002998.1 transcript:ZK637.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-9)

HSP 1 Score: 213.386 bits (542), Expect = 1.231e-60
Identity = 144/472 (30.51%), Postives = 242/472 (51.27%), Query Frame = 3
Query:  294 QANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSV---ELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLA-----HVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSLEFINKSVSILVQIRYLTMNEGSAFECSSVYESLREMKSELSPHNIQNFEDKTEI 1685
            +AN  KL N+L+  KA +WV  E+FYS +D  +   EN+F   +RE+FP LK   LTR +W  IRK++GKPRRCS  FF+EER  L  KR KIR++ +   +    +D LKDLP    +P P+++G +V AR+R+P DG+Y G +DA+  +   +RI F+KP +    V D E+L     D++ ++ F  Q               A S L SG           R  +++ +D +  +    V         + S  +  S G   L  PN      R+    A++ G +P+KFLV + KL+K++++KK  + +  +LN  A+ +  T +  S  FQ  Y   II+LE +N+ +   +      H+   +N+I+  +  P       ++Q C   A   +  C    G  + ++ +L  I    ++L+Q+R +   + SA +  S+ +++ E+++ + P N+  F+D  E+
Sbjct:  200 RANIKKLYNLLRYKKARQWVMCEFFYSAIDEQIFKEENEFATIIRESFPNLKNWNLTRIEWRSIRKLLGKPRRCSKVFFEEERMYLEEKRMKIRSVYEGSYLNDPSID-LKDLPAK--LPRPMVVGNRVFARIRNPYDGIYSGIIDAV--IPKGFRIIFDKPDIPPTLVSDTEILLDGKLDLLSIAYFIEQ---------------ANSKLPSGV----------RPFVAAVRDSSHPHLVRDV---------LVSRKIERSGG--PLMGPN----DERLNGKNAEMVGNFPLKFLVNLVKLTKLIDIKKGLIRQLNELNADAEIQNMTSDKYSKAFQEKYAKTIIDLEHVNQNIDINMNGIQDHHMYFSSNDISTSNMKP-----EAVRQMCSQQAGRFVEHCNQ--GLNVENVHALTLIQSLTAVLLQVRTMGTQKISAVDLQSLGDAISEIRTAIHPRNVAFFQDYVEV 619          
BLAST of protein lin-9 vs. Ensembl Celegans
Match: lin-9 (pep chromosome:WBcel235:III:8900237:8904131:-1 gene:WBGene00002998.1 transcript:ZK637.7b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-9)

HSP 1 Score: 213.386 bits (542), Expect = 1.354e-60
Identity = 144/472 (30.51%), Postives = 242/472 (51.27%), Query Frame = 3
Query:  294 QANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSV---ELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLA-----HVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSLEFINKSVSILVQIRYLTMNEGSAFECSSVYESLREMKSELSPHNIQNFEDKTEI 1685
            +AN  KL N+L+  KA +WV  E+FYS +D  +   EN+F   +RE+FP LK   LTR +W  IRK++GKPRRCS  FF+EER  L  KR KIR++ +   +    +D LKDLP    +P P+++G +V AR+R+P DG+Y G +DA+  +   +RI F+KP +    V D E+L     D++ ++ F  Q               A S L SG           R  +++ +D +  +    V         + S  +  S G   L  PN      R+    A++ G +P+KFLV + KL+K++++KK  + +  +LN  A+ +  T +  S  FQ  Y   II+LE +N+ +   +      H+   +N+I+  +  P       ++Q C   A   +  C    G  + ++ +L  I    ++L+Q+R +   + SA +  S+ +++ E+++ + P N+  F+D  E+
Sbjct:  202 RANIKKLYNLLRYKKARQWVMCEFFYSAIDEQIFKEENEFATIIRESFPNLKNWNLTRIEWRSIRKLLGKPRRCSKVFFEEERMYLEEKRMKIRSVYEGSYLNDPSID-LKDLPAK--LPRPMVVGNRVFARIRNPYDGIYSGIIDAV--IPKGFRIIFDKPDIPPTLVSDTEILLDGKLDLLSIAYFIEQ---------------ANSKLPSGV----------RPFVAAVRDSSHPHLVRDV---------LVSRKIERSGG--PLMGPN----DERLNGKNAEMVGNFPLKFLVNLVKLTKLIDIKKGLIRQLNELNADAEIQNMTSDKYSKAFQEKYAKTIIDLEHVNQNIDINMNGIQDHHMYFSSNDISTSNMKP-----EAVRQMCSQQAGRFVEHCNQ--GLNVENVHALTLIQSLTAVLLQVRTMGTQKISAVDLQSLGDAISEIRTAIHPRNVAFFQDYVEV 621          
BLAST of protein lin-9 vs. Ensembl Celegans
Match: lin-9 (pep chromosome:WBcel235:III:8900238:8904160:-1 gene:WBGene00002998.1 transcript:ZK637.7b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-9)

HSP 1 Score: 213.386 bits (542), Expect = 1.354e-60
Identity = 144/472 (30.51%), Postives = 242/472 (51.27%), Query Frame = 3
Query:  294 QANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSV---ELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLA-----HVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSLEFINKSVSILVQIRYLTMNEGSAFECSSVYESLREMKSELSPHNIQNFEDKTEI 1685
            +AN  KL N+L+  KA +WV  E+FYS +D  +   EN+F   +RE+FP LK   LTR +W  IRK++GKPRRCS  FF+EER  L  KR KIR++ +   +    +D LKDLP    +P P+++G +V AR+R+P DG+Y G +DA+  +   +RI F+KP +    V D E+L     D++ ++ F  Q               A S L SG           R  +++ +D +  +    V         + S  +  S G   L  PN      R+    A++ G +P+KFLV + KL+K++++KK  + +  +LN  A+ +  T +  S  FQ  Y   II+LE +N+ +   +      H+   +N+I+  +  P       ++Q C   A   +  C    G  + ++ +L  I    ++L+Q+R +   + SA +  S+ +++ E+++ + P N+  F+D  E+
Sbjct:  202 RANIKKLYNLLRYKKARQWVMCEFFYSAIDEQIFKEENEFATIIRESFPNLKNWNLTRIEWRSIRKLLGKPRRCSKVFFEEERMYLEEKRMKIRSVYEGSYLNDPSID-LKDLPAK--LPRPMVVGNRVFARIRNPYDGIYSGIIDAV--IPKGFRIIFDKPDIPPTLVSDTEILLDGKLDLLSIAYFIEQ---------------ANSKLPSGV----------RPFVAAVRDSSHPHLVRDV---------LVSRKIERSGG--PLMGPN----DERLNGKNAEMVGNFPLKFLVNLVKLTKLIDIKKGLIRQLNELNADAEIQNMTSDKYSKAFQEKYAKTIIDLEHVNQNIDINMNGIQDHHMYFSSNDISTSNMKP-----EAVRQMCSQQAGRFVEHCNQ--GLNVENVHALTLIQSLTAVLLQVRTMGTQKISAVDLQSLGDAISEIRTAIHPRNVAFFQDYVEV 621          
BLAST of protein lin-9 vs. Ensembl Fly
Match: mip130 (gene:FBgn0023509 transcript:FBtr0070315)

HSP 1 Score: 177.563 bits (449), Expect = 1.219e-46
Identity = 91/193 (47.15%), Postives = 129/193 (66.84%), Query Frame = 3
Query:  282 RKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVE----LDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAF 848
            +++ Q+  ++LRN+LKLPKAHKW   EWFYS +D+PL    ++F   + E  P L TR L R +W  IR+ MG+PRRCS  FF EER  L  KR  IRTLQ ++  E    + +L D+P+   IPM L +GT+VTAR+R P DG++ G V A D++N  YR++FE+  LGT  +PDYE++S   H+++PL +F
Sbjct:  283 KRLGQSIGLRLRNLLKLPKAHKWAIAEWFYSYVDKPLFECRDEFMNHVNELAPRLGTRSLIRHEWVNIRRRMGRPRRCSAKFFSEERKELDRKRQVIRTLQSRKPGEFKDSVSMLSDMPEK--IPMTLPLGTKVTARLRSPQDGIFAGTVAAYDSLNAMYRVTFERIGLGTHAIPDYEIVSENFHEMLPLHSF 473          
BLAST of protein lin-9 vs. Ensembl Fly
Match: aly (gene:FBgn0004372 transcript:FBtr0073006)

HSP 1 Score: 75.8702 bits (185), Expect = 3.893e-14
Identity = 55/192 (28.65%), Postives = 92/192 (47.92%), Query Frame = 3
Query:  309 KLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKR---SVELDLLKDLPDDICIPMPLIIGTQVTARVR-HPTDGLYVGNVDAIDAVNNSYRISFEKPALG-TRPVPDYEVLSILPHDVIPLSAFKMQHKAS 869
            +L N LK   +H+W++ E+  S LD+P L    D + F+ E  P L +  + R  W  +R+ MGK RR S  F + ER  L  +R  +R LQQ +      +  L  +P    +P+PL     V++ +  +  +G+  G V   D  + +Y + F +        +PD ++ S      +PLS     +K+S
Sbjct:  126 RLYNFLKYLSSHRWIWCEFVDSFLDKPTLTMGYDMKRFIAEYCPLLHSCFMPRRGWQLVRRNMGKARRFSAAFIELEREELECQRRIVRQLQQHKFNPKENVGYLDQIPKR--VPLPLAKDATVSSFLHGNSFEGIVNGTVMGYDPQDYTYLVRFNRNDNAVVLSLPDSQLYSDEETAAVPLSIIMRGNKSS 315          
BLAST of protein lin-9 vs. Ensembl Fly
Match: aly (gene:FBgn0004372 transcript:FBtr0332086)

HSP 1 Score: 75.8702 bits (185), Expect = 3.893e-14
Identity = 55/192 (28.65%), Postives = 92/192 (47.92%), Query Frame = 3
Query:  309 KLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKR---SVELDLLKDLPDDICIPMPLIIGTQVTARVR-HPTDGLYVGNVDAIDAVNNSYRISFEKPALG-TRPVPDYEVLSILPHDVIPLSAFKMQHKAS 869
            +L N LK   +H+W++ E+  S LD+P L    D + F+ E  P L +  + R  W  +R+ MGK RR S  F + ER  L  +R  +R LQQ +      +  L  +P    +P+PL     V++ +  +  +G+  G V   D  + +Y + F +        +PD ++ S      +PLS     +K+S
Sbjct:  126 RLYNFLKYLSSHRWIWCEFVDSFLDKPTLTMGYDMKRFIAEYCPLLHSCFMPRRGWQLVRRNMGKARRFSAAFIELEREELECQRRIVRQLQQHKFNPKENVGYLDQIPKR--VPLPLAKDATVSSFLHGNSFEGIVNGTVMGYDPQDYTYLVRFNRNDNAVVLSLPDSQLYSDEETAAVPLSIIMRGNKSS 315          
BLAST of protein lin-9 vs. Ensembl Zebrafish
Match: lin9 (lin-9 DREAM MuvB core complex component [Source:NCBI gene;Acc:560867])

HSP 1 Score: 370.933 bits (951), Expect = 5.476e-122
Identity = 199/516 (38.57%), Postives = 310/516 (60.08%), Query Frame = 3
Query:  213 SVPSKMKNISASNYNRMGIQQSERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASR-NLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPG-SRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGN--RIRSMKSLEFINKSVSILVQIRYLTMNEG---SAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            ++P K+ N++            +++V+Q   ++LRN+LKLPKAHKW  YEWFYSN+DRPL  G+NDF + L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF EER +L  KR K+R LQQ++  ++ L KDLPD+I  P+PL+IGT+VTAR+R   DGL+ G +DA+D    +YR++F++  LGT  VPDYEVLS  PH+ +P+SAF  + +  R   F++P                       RG  + +    L +                 ND   S           Q P  S++T  + +  GG+P+KFLV VT+LSKIL +KK+ ++  +++N  A+   +   PI L+ Q  Y T +++LE+LNK+L + L  V QF  E+A + G+ P +Q S+L+++C++++ +++ +   L+    R+++ +  + I++  ++L+QIR L   EG   ++FE  S+ +SL ++KS +   N+  F+D  EI + HI SGL+ L NL+ F
Sbjct:   35 TMPQKLTNVATP----------DKRVSQKIGLRLRNLLKLPKAHKWCIYEWFYSNIDRPLFEGDNDFCLCLKESFPNLKTRKLTRVEWGTIRRLMGKPRRCSSAFFAEERMALKQKRQKMRLLQQRKITDMSLCKDLPDEI--PLPLVIGTKVTARLRGVHDGLFTGQIDAVDTSAATYRVTFDRNGLGTHTVPDYEVLSNEPHETMPISAFAQKQRPPRFQNFLTPP----------------------RGSYTGSTQSILMD-----------------NDPLFS-----------QSPWRSKLTGTDGETLGGFPVKFLVQVTRLSKILMIKKEHIKHLKEMNTEAEKLKSYSMPIGLDLQKRYATTVLDLEQLNKDLNKVLHEVQQFCFELAPDQGMQPADQPSELRRRCEEESQDVLRQNNTLASGEPRVQNTELTQLISRLTALLLQIRCLA--EGGDLNSFEFKSLTDSLNDIKSSIDDSNLSCFQDNVEIHVAHIQSGLSQLGNLHAF 486          
BLAST of protein lin-9 vs. Ensembl Zebrafish
Match: lin9 (lin-9 DREAM MuvB core complex component [Source:NCBI gene;Acc:560867])

HSP 1 Score: 371.703 bits (953), Expect = 1.225e-121
Identity = 199/516 (38.57%), Postives = 310/516 (60.08%), Query Frame = 3
Query:  213 SVPSKMKNISASNYNRMGIQQSERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASR-NLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPG-SRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGN--RIRSMKSLEFINKSVSILVQIRYLTMNEG---SAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            ++P K+ N++            +++V+Q   ++LRN+LKLPKAHKW  YEWFYSN+DRPL  G+NDF + L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF EER +L  KR K+R LQQ++  ++ L KDLPD+I  P+PL+IGT+VTAR+R   DGL+ G +DA+D    +YR++F++  LGT  VPDYEVLS  PH+ +P+SAF  + +  R   F++P                       RG  + +    L +                 ND   S           Q P  S++T  + +  GG+P+KFLV VT+LSKIL +KK+ ++  +++N  A+   +   PI L+ Q  Y T +++LE+LNK+L + L  V QF  E+A + G+ P +Q S+L+++C++++ +++ +   L+    R+++ +  + I++  ++L+QIR L   EG   ++FE  S+ +SL ++KS +   N+  F+D  EI + HI SGL+ L NL+ F
Sbjct:   84 TMPQKLTNVATP----------DKRVSQKIGLRLRNLLKLPKAHKWCIYEWFYSNIDRPLFEGDNDFCLCLKESFPNLKTRKLTRVEWGTIRRLMGKPRRCSSAFFAEERMALKQKRQKMRLLQQRKITDMSLCKDLPDEI--PLPLVIGTKVTARLRGVHDGLFTGQIDAVDTSAATYRVTFDRNGLGTHTVPDYEVLSNEPHETMPISAFAQKQRPPRFQNFLTPP----------------------RGSYTGSTQSILMD-----------------NDPLFS-----------QSPWRSKLTGTDGETLGGFPVKFLVQVTRLSKILMIKKEHIKHLKEMNTEAEKLKSYSMPIGLDLQKRYATTVLDLEQLNKDLNKVLHEVQQFCFELAPDQGMQPADQPSELRRRCEEESQDVLRQNNTLASGEPRVQNTELTQLISRLTALLLQIRCLA--EGGDLNSFEFKSLTDSLNDIKSSIDDSNLSCFQDNVEIHVAHIQSGLSQLGNLHAF 535          
BLAST of protein lin-9 vs. Ensembl Xenopus
Match: LIN9 (lin-9 DREAM MuvB core complex component [Source:NCBI gene;Acc:100491065])

HSP 1 Score: 378.637 bits (971), Expect = 2.485e-124
Identity = 200/517 (38.68%), Postives = 319/517 (61.70%), Query Frame = 3
Query:  210 KSVPSKMKNISASNYNRMGIQQSE--RKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNR--IRSMKSLEFINKSVSILVQIRYLTMNEG---SAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            +  P+    I ++N  +  +  +   +K +Q    +LRN+LKLPKAHKW  YEWFYSN+D+PL  G+NDF V L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF+EER++L  KR KIR LQQ++  ++   KDLPD+  IP+ L+IGT+VTAR+R   DGL+ G +DA+D  N++YR++F++  LGT  +PDYEVLS  PH+ +P++AF  + +  R +FM+P R  + +A+QS                                      P + S+ +   +G S           ++I+ ++ +  GG+P++FLV VT+LSKIL +KK+ ++  RD+N  A+   +   PIS+EFQ  Y T++++LE+LNK+L + L  V Q+  E+A + G+ P +Q + ++++C++DA +++ R    S  +  +++    E I++  +IL+QI+ L   EG   ++FE  S+ +S+ ++KS +SP NI  F++  EI + HI SGL+ + NL+ F
Sbjct:   57 QKTPNWKGGIISANETKFNVTSTTPVKKASQKIGYRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSAAFFEEERSALEQKRQKIRLLQQRKVADVSQFKDLPDE--IPLSLVIGTKVTARLRGVHDGLFTGQIDAVDTQNSTYRVTFDRTGLGTHTIPDYEVLSNEPHETMPIAAFGQKQRPPR-MFMTPPR-SSYTAIQS--------------------------------------PVMESDTL---LGQSPWK--------AKISSSDTETIGGFPVEFLVQVTRLSKILMIKKEHIKLLRDMNTEAEKLKSYSSPISIEFQRRYATIVLDLEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTSMRRRCEEDARQMVRRANTSSTGQPCVQNESLTELISRLTAILLQIKCLA--EGGDLNSFEFKSLTDSINDIKSTISPSNISCFQNNVEIHVAHIQSGLSQMGNLHAF 518          
BLAST of protein lin-9 vs. Ensembl Xenopus
Match: LIN9 (lin-9 DREAM MuvB core complex component [Source:NCBI gene;Acc:100491065])

HSP 1 Score: 376.326 bits (965), Expect = 2.689e-124
Identity = 197/491 (40.12%), Postives = 309/491 (62.93%), Query Frame = 3
Query:  282 RKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNR--IRSMKSLEFINKSVSILVQIRYLTMNEG---SAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            +K +Q    +LRN+LKLPKAHKW  YEWFYSN+D+PL  G+NDF V L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF+EER++L  KR KIR LQQ++  ++   KDLPD+  IP+ L+IGT+VTAR+R   DGL+ G +DA+D  N++YR++F++  LGT  +PDYEVLS  PH+ +P++AF  + +  R +FM+P R  + +A+QS                                      P + S+ +   +G S           ++I+ ++ +  GG+P++FLV VT+LSKIL +KK+ ++  RD+N  A+   +   PIS+EFQ  Y T++++LE+LNK+L + L  V Q+  E+A + G+ P +Q + ++++C++DA +++ R    S  +  +++    E I++  +IL+QI+ L   EG   ++FE  S+ +S+ ++KS +SP NI  F++  EI + HI SGL+ + NL+ F
Sbjct:   25 KKASQKIGYRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSAAFFEEERSALEQKRQKIRLLQQRKVADVSQFKDLPDE--IPLSLVIGTKVTARLRGVHDGLFTGQIDAVDTQNSTYRVTFDRTGLGTHTIPDYEVLSNEPHETMPIAAFGQKQRPPR-MFMTPPR-SSYTAIQS--------------------------------------PVMESDTL---LGQSPWK--------AKISSSDTETIGGFPVEFLVQVTRLSKILMIKKEHIKLLRDMNTEAEKLKSYSSPISIEFQRRYATIVLDLEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTSMRRRCEEDARQMVRRANTSSTGQPCVQNESLTELISRLTAILLQIKCLA--EGGDLNSFEFKSLTDSINDIKSTISPSNISCFQNNVEIHVAHIQSGLSQMGNLHAF 460          
BLAST of protein lin-9 vs. Ensembl Xenopus
Match: LIN9 (lin-9 DREAM MuvB core complex component [Source:NCBI gene;Acc:100491065])

HSP 1 Score: 378.252 bits (970), Expect = 1.097e-123
Identity = 197/491 (40.12%), Postives = 309/491 (62.93%), Query Frame = 3
Query:  282 RKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNR--IRSMKSLEFINKSVSILVQIRYLTMNEG---SAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            +K +Q    +LRN+LKLPKAHKW  YEWFYSN+D+PL  G+NDF V L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF+EER++L  KR KIR LQQ++  ++   KDLPD+  IP+ L+IGT+VTAR+R   DGL+ G +DA+D  N++YR++F++  LGT  +PDYEVLS  PH+ +P++AF  + +  R +FM+P R  + +A+QS                                      P + S+ +   +G S           ++I+ ++ +  GG+P++FLV VT+LSKIL +KK+ ++  RD+N  A+   +   PIS+EFQ  Y T++++LE+LNK+L + L  V Q+  E+A + G+ P +Q + ++++C++DA +++ R    S  +  +++    E I++  +IL+QI+ L   EG   ++FE  S+ +S+ ++KS +SP NI  F++  EI + HI SGL+ + NL+ F
Sbjct:  118 KKASQKIGYRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSAAFFEEERSALEQKRQKIRLLQQRKVADVSQFKDLPDE--IPLSLVIGTKVTARLRGVHDGLFTGQIDAVDTQNSTYRVTFDRTGLGTHTIPDYEVLSNEPHETMPIAAFGQKQRPPR-MFMTPPR-SSYTAIQS--------------------------------------PVMESDTL---LGQSPWK--------AKISSSDTETIGGFPVEFLVQVTRLSKILMIKKEHIKLLRDMNTEAEKLKSYSSPISIEFQRRYATIVLDLEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTSMRRRCEEDARQMVRRANTSSTGQPCVQNESLTELISRLTAILLQIKCLA--EGGDLNSFEFKSLTDSINDIKSTISPSNISCFQNNVEIHVAHIQSGLSQMGNLHAF 553          
BLAST of protein lin-9 vs. Ensembl Xenopus
Match: LIN9 (lin-9 DREAM MuvB core complex component [Source:NCBI gene;Acc:100491065])

HSP 1 Score: 377.096 bits (967), Expect = 1.848e-123
Identity = 197/491 (40.12%), Postives = 309/491 (62.93%), Query Frame = 3
Query:  282 RKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNR--IRSMKSLEFINKSVSILVQIRYLTMNEG---SAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            +K +Q    +LRN+LKLPKAHKW  YEWFYSN+D+PL  G+NDF V L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF+EER++L  KR KIR LQQ++  ++   KDLPD+  IP+ L+IGT+VTAR+R   DGL+ G +DA+D  N++YR++F++  LGT  +PDYEVLS  PH+ +P++AF  + +  R +FM+P R  + +A+QS                                      P + S+ +   +G S           ++I+ ++ +  GG+P++FLV VT+LSKIL +KK+ ++  RD+N  A+   +   PIS+EFQ  Y T++++LE+LNK+L + L  V Q+  E+A + G+ P +Q + ++++C++DA +++ R    S  +  +++    E I++  +IL+QI+ L   EG   ++FE  S+ +S+ ++KS +SP NI  F++  EI + HI SGL+ + NL+ F
Sbjct:  105 KKASQKIGYRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSAAFFEEERSALEQKRQKIRLLQQRKVADVSQFKDLPDE--IPLSLVIGTKVTARLRGVHDGLFTGQIDAVDTQNSTYRVTFDRTGLGTHTIPDYEVLSNEPHETMPIAAFGQKQRPPR-MFMTPPR-SSYTAIQS--------------------------------------PVMESDTL---LGQSPWK--------AKISSSDTETIGGFPVEFLVQVTRLSKILMIKKEHIKLLRDMNTEAEKLKSYSSPISIEFQRRYATIVLDLEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTSMRRRCEEDARQMVRRANTSSTGQPCVQNESLTELISRLTAILLQIKCLA--EGGDLNSFEFKSLTDSINDIKSTISPSNISCFQNNVEIHVAHIQSGLSQMGNLHAF 540          
BLAST of protein lin-9 vs. Ensembl Xenopus
Match: LIN9 (lin-9 DREAM MuvB core complex component [Source:NCBI gene;Acc:100491065])

HSP 1 Score: 376.326 bits (965), Expect = 2.730e-123
Identity = 197/491 (40.12%), Postives = 309/491 (62.93%), Query Frame = 3
Query:  282 RKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNR--IRSMKSLEFINKSVSILVQIRYLTMNEG---SAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            +K +Q    +LRN+LKLPKAHKW  YEWFYSN+D+PL  G+NDF V L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF+EER++L  KR KIR LQQ++  ++   KDLPD+  IP+ L+IGT+VTAR+R   DGL+ G +DA+D  N++YR++F++  LGT  +PDYEVLS  PH+ +P++AF  + +  R +FM+P R  + +A+QS                                      P + S+ +   +G S           ++I+ ++ +  GG+P++FLV VT+LSKIL +KK+ ++  RD+N  A+   +   PIS+EFQ  Y T++++LE+LNK+L + L  V Q+  E+A + G+ P +Q + ++++C++DA +++ R    S  +  +++    E I++  +IL+QI+ L   EG   ++FE  S+ +S+ ++KS +SP NI  F++  EI + HI SGL+ + NL+ F
Sbjct:   98 KKASQKIGYRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSAAFFEEERSALEQKRQKIRLLQQRKVADVSQFKDLPDE--IPLSLVIGTKVTARLRGVHDGLFTGQIDAVDTQNSTYRVTFDRTGLGTHTIPDYEVLSNEPHETMPIAAFGQKQRPPR-MFMTPPR-SSYTAIQS--------------------------------------PVMESDTL---LGQSPWK--------AKISSSDTETIGGFPVEFLVQVTRLSKILMIKKEHIKLLRDMNTEAEKLKSYSSPISIEFQRRYATIVLDLEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTSMRRRCEEDARQMVRRANTSSTGQPCVQNESLTELISRLTAILLQIKCLA--EGGDLNSFEFKSLTDSINDIKSTISPSNISCFQNNVEIHVAHIQSGLSQMGNLHAF 533          
BLAST of protein lin-9 vs. Ensembl Mouse
Match: Lin9 (lin-9 homolog (C. elegans) [Source:MGI Symbol;Acc:MGI:1919818])

HSP 1 Score: 379.407 bits (973), Expect = 8.044e-125
Identity = 201/517 (38.88%), Postives = 315/517 (60.93%), Query Frame = 3
Query:  201 RGRKSVPSKMKNISASNYNRMGIQQSERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSL-EFINKSVSILVQIRYLTMNEG---SAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            +GR + P+     +A+      +   ++K +Q    +LRN+LKLPKAHKW  YEWFYSN+D+PL  G+NDF V L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF+EER++L  KR KIR LQQ++  ++   KDLPD+  IP+PL+IGT+VTAR+R   DGL+ G +DA+D +N +YR++F++  LGT  +PDYEVLS  PH+ +P+SAF  + + SR  FM+P RL     LQS                       + + +  +G    +  ++S +D                           +  GG+P++FL+ VTKLSKIL +KK+ +++ R++N  A+   +   PI +EFQ  Y T+++ LE+LNK+L + L  V Q+  E+A + G+ P +Q +D++++C+++A EI+ +  + SG      ++L + I++  +IL+QI+ L   EG   ++FE  S+ +SL ++K+ +   NI  F++  EI + HI SGL+ + NL+ F
Sbjct:   54 KGRNAGPAVEMKFTAT------MSTPDKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDE--IPLPLVIGTKVTARLRGIHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETMPISAFGQKQRPSR-FFMTPPRLHYTPPLQS----------------------PITDGDPLLGQSPWR-SKVSGSDT--------------------------ETLGGFPVEFLIQVTKLSKILMIKKEHIKKLREMNTEAEKLKSYSMPIGIEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRQANSASGQPCVENENLTDLISRLTAILLQIKCLA--EGGDLNSFEFKSLTDSLNDIKNTIDASNISCFQNNVEIHVAHIQSGLSQMGNLHAF 510          
BLAST of protein lin-9 vs. Ensembl Mouse
Match: Lin9 (lin-9 homolog (C. elegans) [Source:MGI Symbol;Acc:MGI:1919818])

HSP 1 Score: 378.252 bits (970), Expect = 6.055e-124
Identity = 197/491 (40.12%), Postives = 305/491 (62.12%), Query Frame = 3
Query:  279 ERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSL-EFINKSVSILVQIRYLTMNEG---SAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            ++K +Q    +LRN+LKLPKAHKW  YEWFYSN+D+PL  G+NDF V L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF+EER++L  KR KIR LQQ++  ++   KDLPD+  IP+PL+IGT+VTAR+R   DGL+ G +DA+D +N +YR++F++  LGT  +PDYEVLS  PH+ +P+SAF  + + SR  FM+P RL     LQS                       + + +  +G    +  ++S +D                           +  GG+P++FL+ VTKLSKIL +KK+ +++ R++N  A+   +   PI +EFQ  Y T+++ LE+LNK+L + L  V Q+  E+A + G+ P +Q +D++++C+++A EI+ +  + SG      ++L + I++  +IL+QI+ L   EG   ++FE  S+ +SL ++K+ +   NI  F++  EI + HI SGL+ + NL+ F
Sbjct:  114 DKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDE--IPLPLVIGTKVTARLRGIHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETMPISAFGQKQRPSR-FFMTPPRLHYTPPLQS----------------------PITDGDPLLGQSPWR-SKVSGSDT--------------------------ETLGGFPVEFLIQVTKLSKILMIKKEHIKKLREMNTEAEKLKSYSMPIGIEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRQANSASGQPCVENENLTDLISRLTAILLQIKCLA--EGGDLNSFEFKSLTDSLNDIKNTIDASNISCFQNNVEIHVAHIQSGLSQMGNLHAF 550          
BLAST of protein lin-9 vs. Ensembl Mouse
Match: Lin9 (lin-9 homolog (C. elegans) [Source:MGI Symbol;Acc:MGI:1919818])

HSP 1 Score: 234.958 bits (598), Expect = 2.098e-72
Identity = 103/177 (58.19%), Postives = 138/177 (77.97%), Query Frame = 3
Query:  279 ERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVL 809
            ++K +Q    +LRN+LKLPKAHKW  YEWFYSN+D+PL  G+NDF V L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF+EER++L  KR KIR LQQ++  ++   KDLPD+  IP+PL+IGT+VTAR+R   DGL+ G +DA+D +N +YR++F++  LGT  +PDYEVL
Sbjct:   98 DKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDE--IPLPLVIGTKVTARLRGIHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVL 272          
BLAST of protein lin-9 vs. Ensembl Mouse
Match: Lin9 (lin-9 homolog (C. elegans) [Source:MGI Symbol;Acc:MGI:1919818])

HSP 1 Score: 63.5438 bits (153), Expect = 2.651e-12
Identity = 28/42 (66.67%), Postives = 34/42 (80.95%), Query Frame = 3
Query:  387 PLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRR 512
            PL  G+NDF V L+E+FP LKTRKLTR +W  IR++MGKPRR
Sbjct:    2 PLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRR 43          
BLAST of protein lin-9 vs. UniProt/SwissProt
Match: sp|Q4R8N2|LIN9_MACFA (Protein lin-9 homolog OS=Macaca fascicularis OX=9541 GN=LIN9 PE=2 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 2.243e-124
Identity = 200/491 (40.73%), Postives = 306/491 (62.32%), Query Frame = 3
Query:  279 ERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSL-EFINKSVSILVQIRYLTMNEG---SAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            ++K +Q    +LRN+LKLPKAHKW  YEWFYSN+D+PL  G+NDF V L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF+EER++L  KR KIR LQQ++  ++   KDLPD+  IP+PL+IGT+VTAR+R   DGL+ G +DA+D +N +YR++F++  LGT  +PDYEVLS  PH+ +P++AF  + + SR  FM+P RL     LQS                                        I  ND    +G S           S+I+ ++ +  GG+P++FL+ VT+LSKIL +KK+ +++ R++N  A+   +   PIS+EFQ  Y T+++ LE+LNK+L + L  V Q+  E+A + G+ P +Q +D++++C+++A EI+    + +G      ++L + I++  +IL+QI+ L   EG   ++FE  S+ +SL ++KS +   NI  F++  EI + HI SGL+ + NL+ F
Sbjct:   98 DKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDE--IPLPLVIGTKVTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETMPIAAFGQKQRPSR-FFMTPPRLHYTPPLQS---------------------------------------PIMDNDPL--LGQSPWR--------SKISGSDTETLGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTDAEKLKSYSMPISIEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPCVENENLTDLISRLTAILLQIKCLA--EGGDLNSFEFKSLTDSLNDIKSTIDASNISCFQNNVEIHVAHIQSGLSQMGNLHAF 534          
BLAST of protein lin-9 vs. UniProt/SwissProt
Match: sp|Q5TKA1|LIN9_HUMAN (Protein lin-9 homolog OS=Homo sapiens OX=9606 GN=LIN9 PE=1 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 2.497e-124
Identity = 199/491 (40.53%), Postives = 308/491 (62.73%), Query Frame = 3
Query:  279 ERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSL-EFINKSVSILVQIRYLTMNEG---SAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            ++K +Q    +LRN+LKLPKAHKW  YEWFYSN+D+PL  G+NDF V L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF+EER++L  KR KIR LQQ++  ++   KDLPD+  IP+PL+IGT+VTAR+R   DGL+ G +DA+D +N +YR++F++  LGT  +PDYEVLS  PH+ +P++AF  + + SR  FM+P RL     LQS                                      P I ++ +   +G S           S+I+ ++ +  GG+P++FL+ VT+LSKIL +KK+ +++ R++N  A+   +   PIS+EFQ  Y T+++ LE+LNK+L + L  V Q+  E+A + G+ P +Q +D++++C+++A EI+    + +G      ++L + I++  +IL+QI+ L   EG   ++FE  S+ +SL ++KS +   NI  F++  EI + HI SGL+ + NL+ F
Sbjct:   98 DKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDE--IPLPLVIGTKVTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETMPIAAFGQKQRPSR-FFMTPPRLHYTPPLQS--------------------------------------PIIDNDPL---LGQSPWR--------SKISGSDTETLGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPCVENENLTDLISRLTAILLQIKCLA--EGGDLNSFEFKSLTDSLNDIKSTIDASNISCFQNNVEIHVAHIQSGLSQMGNLHAF 534          
BLAST of protein lin-9 vs. UniProt/SwissProt
Match: sp|Q8C735|LIN9_MOUSE (Protein lin-9 homolog OS=Mus musculus OX=10090 GN=Lin9 PE=1 SV=2)

HSP 1 Score: 378.252 bits (970), Expect = 3.341e-123
Identity = 197/491 (40.12%), Postives = 305/491 (62.12%), Query Frame = 3
Query:  279 ERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSL-EFINKSVSILVQIRYLTMNEG---SAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            ++K +Q    +LRN+LKLPKAHKW  YEWFYSN+D+PL  G+NDF V L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF+EER++L  KR KIR LQQ++  ++   KDLPD+  IP+PL+IGT+VTAR+R   DGL+ G +DA+D +N +YR++F++  LGT  +PDYEVLS  PH+ +P+SAF  + + SR  FM+P RL     LQS                       + + +  +G    +  ++S +D                           +  GG+P++FL+ VTKLSKIL +KK+ +++ R++N  A+   +   PI +EFQ  Y T+++ LE+LNK+L + L  V Q+  E+A + G+ P +Q +D++++C+++A EI+ +  + SG      ++L + I++  +IL+QI+ L   EG   ++FE  S+ +SL ++K+ +   NI  F++  EI + HI SGL+ + NL+ F
Sbjct:   98 DKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDE--IPLPLVIGTKVTARLRGIHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETMPISAFGQKQRPSR-FFMTPPRLHYTPPLQS----------------------PITDGDPLLGQSPWR-SKVSGSDT--------------------------ETLGGFPVEFLIQVTKLSKILMIKKEHIKKLREMNTEAEKLKSYSMPIGIEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRQANSASGQPCVENENLTDLISRLTAILLQIKCLA--EGGDLNSFEFKSLTDSLNDIKNTIDASNISCFQNNVEIHVAHIQSGLSQMGNLHAF 534          
BLAST of protein lin-9 vs. UniProt/SwissProt
Match: sp|Q5RHQ8|LIN9_DANRE (Protein lin-9 homolog OS=Danio rerio OX=7955 GN=lin9 PE=3 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 9.251e-121
Identity = 199/516 (38.57%), Postives = 310/516 (60.08%), Query Frame = 3
Query:  213 SVPSKMKNISASNYNRMGIQQSERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASR-NLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPG-SRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGN--RIRSMKSLEFINKSVSILVQIRYLTMNEG---SAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            ++P K+ N++            +++V+Q   ++LRN+LKLPKAHKW  YEWFYSN+DRPL  G+NDF + L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF EER +L  KR K+R LQQ++  ++ L KDLPD+I  P+PL+IGT+VTAR+R   DGL+ G +DA+D    +YR++F++  LGT  VPDYEVLS  PH+ +P+SAF  + +  R   F++P                       RG  + +    L +                 ND   S           Q P  S++T  + +  GG+P+KFLV VT+LSKIL +KK+ ++  +++N  A+   +   PI L+ Q  Y T +++LE+LNK+L + L  V QF  E+A + G+ P +Q S+L+++C++++ +++ +   L+    R+++ +  + I++  ++L+QIR L   EG   ++FE  S+ +SL ++KS +   N+  F+D  EI + HI SGL+ L NL+ F
Sbjct:   84 TMPQKLTNVATP----------DKRVSQKIGLRLRNLLKLPKAHKWCIYEWFYSNIDRPLFEGDNDFCLCLKESFPNLKTRKLTRVEWGTIRRLMGKPRRCSSAFFAEERMALKQKRQKMRLLQQRKITDMSLCKDLPDEI--PLPLVIGTKVTARLRGVHDGLFTGQIDAVDTSAATYRVTFDRNGLGTHTVPDYEVLSNEPHETMPISAFAQKQRPPRFQNFLTPP----------------------RGSYTGSTQSILMD-----------------NDPLFS-----------QSPWRSKLTGTDGETLGGFPVKFLVQVTRLSKILMIKKEHIKHLKEMNTEAEKLKSYSMPIGLDLQKRYATTVLDLEQLNKDLNKVLHEVQQFCFELAPDQGMQPADQPSELRRRCEEESQDVLRQNNTLASGEPRVQNTELTQLISRLTALLLQIRCLA--EGGDLNSFEFKSLTDSLNDIKSSIDDSNLSCFQDNVEIHVAHIQSGLSQLGNLHAF 535          
BLAST of protein lin-9 vs. UniProt/SwissProt
Match: sp|P30630|LIN9_CAEEL (Protein lin-9 OS=Caenorhabditis elegans OX=6239 GN=lin-9 PE=1 SV=3)

HSP 1 Score: 213.386 bits (542), Expect = 1.722e-59
Identity = 144/472 (30.51%), Postives = 242/472 (51.27%), Query Frame = 3
Query:  294 QANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSV---ELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLA-----HVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSLEFINKSVSILVQIRYLTMNEGSAFECSSVYESLREMKSELSPHNIQNFEDKTEI 1685
            +AN  KL N+L+  KA +WV  E+FYS +D  +   EN+F   +RE+FP LK   LTR +W  IRK++GKPRRCS  FF+EER  L  KR KIR++ +   +    +D LKDLP    +P P+++G +V AR+R+P DG+Y G +DA+  +   +RI F+KP +    V D E+L     D++ ++ F  Q               A S L SG           R  +++ +D +  +    V         + S  +  S G   L  PN      R+    A++ G +P+KFLV + KL+K++++KK  + +  +LN  A+ +  T +  S  FQ  Y   II+LE +N+ +   +      H+   +N+I+  +  P       ++Q C   A   +  C    G  + ++ +L  I    ++L+Q+R +   + SA +  S+ +++ E+++ + P N+  F+D  E+
Sbjct:  202 RANIKKLYNLLRYKKARQWVMCEFFYSAIDEQIFKEENEFATIIRESFPNLKNWNLTRIEWRSIRKLLGKPRRCSKVFFEEERMYLEEKRMKIRSVYEGSYLNDPSID-LKDLPAK--LPRPMVVGNRVFARIRNPYDGIYSGIIDAV--IPKGFRIIFDKPDIPPTLVSDTEILLDGKLDLLSIAYFIEQ---------------ANSKLPSGV----------RPFVAAVRDSSHPHLVRDV---------LVSRKIERSGG--PLMGPN----DERLNGKNAEMVGNFPLKFLVNLVKLTKLIDIKKGLIRQLNELNADAEIQNMTSDKYSKAFQEKYAKTIIDLEHVNQNIDINMNGIQDHHMYFSSNDISTSNMKP-----EAVRQMCSQQAGRFVEHCNQ--GLNVENVHALTLIQSLTAVLLQVRTMGTQKISAVDLQSLGDAISEIRTAIHPRNVAFFQDYVEV 621          
BLAST of protein lin-9 vs. TrEMBL
Match: A0A0F7GXQ7 (Protein lin-9 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 794.267 bits (2050), Expect = 0.000e+0
Identity = 383/384 (99.74%), Postives = 383/384 (99.74%), Query Frame = 3
Query:  537 ERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSLEFINKSVSILVQIRYLTMNEGSAFECSSVYESLREMKSELSPHNIQNFEDKTEIA 1688
            ERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSLEFINKSVSILVQIRYLTMNEGSAFECSSVYESLREMKSELSPHNIQNFEDKTE A
Sbjct:    1 ERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSLEFINKSVSILVQIRYLTMNEGSAFECSSVYESLREMKSELSPHNIQNFEDKTEXA 384          
BLAST of protein lin-9 vs. TrEMBL
Match: A0A4Z2CPK9 (Protein lin-9 isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_008550 PE=4 SV=1)

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 325/541 (60.07%), Postives = 406/541 (75.05%), Query Frame = 3
Query:  258 RMGIQQSERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELS--------SAQDCALCNAE------------GAVGAMN----------------LKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSLEFINKSVSILVQIRYLTMNEGSAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPFLYSHPSHLQYL 1772
            R  +   ER++AQ NA++LRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFR+ LRE+FP +KTR+L+RA W+ +R++MGKPRRCS  FF EER SL+ KR KIRTLQ  RSV+L+ L+DLPDD+ +PMPLIIGT++TARVR+PTDGLY G VDAIDA+ + YR++F+KPALGTR +PDYEVLSILP + IPLSA+K QHKASRNLFMSPARLLAQSALQ    H HH K                +  DC LC +E            G+  A                  LKLP ISS DVAASMGS+AL+  N    G R+ LNEAD+YGGYPMKFLVMVTKLSKILEVKK+CV+E +DLN  A+ K++ +  +SLEFQH+YLT++++LERLNKEL QYL HVLQ+ANEIAQEHGV PLEQA+D KQ+CD+DAYEI+ R K++   + R++K+++ I K VS+LVQIR L+ +E S ++CSS+ ESL E+KS +   N+  FE+  EI+++H +SGL +LSNLN FLY+HP+H  YL
Sbjct:    4 RTQMHHPERRMAQTNAVRLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRICLRESFPNVKTRRLSRAHWSLLRRLMGKPRRCSTAFFDEERRSLNEKREKIRTLQATRSVQLEFLRDLPDDMHVPMPLIIGTKITARVRYPTDGLYTGKVDAIDALRHCYRVTFDKPALGTRSIPDYEVLSILPQETIPLSAYKTQHKASRNLFMSPARLLAQSALQGKRHHMHHHKFGPGLGQGGGGGSGDLTVHDCPLCQSEAAAAASSGGTITGSPSARAPNFMAANNNNNALATPLKLPAISSGDVAASMGSAALS-LNESSSGGRLLLNEADIYGGYPMKFLVMVTKLSKILEVKKRCVDELQDLNDEAERKISNKAELSLEFQHTYLTLVMHLERLNKELNQYLVHVLQYANEIAQEHGVAPLEQAADFKQRCDEDAYEIVTRIKSMQAQKFRNLKTVDLITKLVSLLVQIRSLSEHEESTYDCSSIQESLHELKSSIHSSNVHVFENSVEISVHHTLSGLCTLSNLNSFLYTHPNHFHYL 543          
BLAST of protein lin-9 vs. TrEMBL
Match: C1L4U1 (Lin-9 homolog OS=Schistosoma japonicum OX=6182 GN=EWB00_008550 PE=2 SV=1)

HSP 1 Score: 670.618 bits (1729), Expect = 0.000e+0
Identity = 325/541 (60.07%), Postives = 406/541 (75.05%), Query Frame = 3
Query:  258 RMGIQQSERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELS--------SAQDCALCNAE------------GAVGAMN----------------LKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSLEFINKSVSILVQIRYLTMNEGSAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPFLYSHPSHLQYL 1772
            R  +   ER++AQ NA++LRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFR+ LRE+FP +KTR+L+RA W+ +R++MGKPRRCS  FF EER SL+ KR KIRTLQ  RSV+L+ L+DLPDD+ +PMPLIIGT++TARVR+PTDGLY G VDAIDA+ + YR++F+KPALGTR +PDYEVLSILP + IPLSA+K QHKASRNLFMSPARLLAQSALQ    H HH K                +  DC LC +E            G+  A                  LKLP ISS DVAASMGS+AL+  N    G R+ LNEAD+YGGYPMKFLVMVTKLSKILEVKK+CV+E +DLN  A+ K++ +  +SLEFQH+YLT++++LERLNKEL QYL HVLQ+ANEIAQEHGV PLEQA+D KQ+CD+DAYEI+ R K++   + R++K+++ I K VS+LVQIR L+ +E S ++CSS+ ESL E+KS +   N+  FE+  EI+++H +SGL +LSNLN FLY+HP+H  YL
Sbjct:   83 RTQMHHPERRMAQTNAVRLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRICLRESFPNVKTRRLSRAHWSLLRRLMGKPRRCSTAFFDEERRSLNEKREKIRTLQATRSVQLEFLRDLPDDMHVPMPLIIGTKITARVRYPTDGLYTGKVDAIDALRHCYRVTFDKPALGTRSIPDYEVLSILPQETIPLSAYKTQHKASRNLFMSPARLLAQSALQGKRHHMHHHKFGPGLGQGGGGGSGDLTVHDCPLCQSEAAAAASSGGTITGSPSARAPNFMAANNNNNALATPLKLPAISSGDVAASMGSAALS-LNESSSGGRLLLNEADIYGGYPMKFLVMVTKLSKILEVKKRCVDELQDLNDEAERKISNKAELSLEFQHTYLTLVMHLERLNKELNQYLVHVLQYANEIAQEHGVAPLEQAADFKQRCDEDAYEIVTRIKSMQAQKFRNLKTVDLITKLVSLLVQIRSLSEHEESTYDCSSIQESLHELKSSIHSSNVHVFENSVEISVHHTLSGLCTLSNLNSFLYTHPNHFHYL 622          
BLAST of protein lin-9 vs. TrEMBL
Match: A0A4S2LRI8 (DIRP domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005342 PE=4 SV=1)

HSP 1 Score: 667.152 bits (1720), Expect = 0.000e+0
Identity = 334/584 (57.19%), Postives = 423/584 (72.43%), Query Frame = 3
Query:  114 FEDDTYESGETLKNDNIGVMLP--PEEGSYTRGRKSVPSKMKNISASNYNRMGIQQSERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELS---------SAQDCALCNAE--GAVGAM------------------NLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSLEFINKSVSILVQIRYLTMNEGSAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPFLYSHPSHLQYL 1772
            + DD +E   + +   +    P  PEE    + RK  P KM                ER+++Q NA++LRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFR+ LRE FP +KTR L+RA W+ +R++MGKPRRCS  FF EER SL+ KR KIRTLQ  RSV+L+ L+DLPDD+ +PMPLIIGT++TARVR+PTDGLY G VDAID++ + YR++F+KP LGTR +PDYEVLS+ P + IPLSA+K QHKASRNLFMSPARLLAQSALQ    H HH K+      +         +  DC LC AE  G  GA                    LKLP ISS DVAASMGS+AL+  N    G R+ LNEAD+YGGYPMKFLVMVTKLSKILEVKK+CV+E +DLN  A+ K++ +  +SLEFQH+YLT+I++LERLNKEL QYLAHVLQ+ANEIAQEHGV PLEQASD KQ+CD+D+YEI++R KN+   R+++ ++++ I+K V +LVQ+R LT  EG+A+ CSS+ ++LRE+K+ + P N+Q FE+  EI  +HI+ GL S SNL+ FLY HP+H+QY+
Sbjct:   29 YFDDYFEPSSSYRPRIVPSHRPHIPEEELPQKIRK--PHKMHKSMGRPPWHPAAHNPERRMSQVNAVRLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRICLRENFPNVKTRNLSRAHWSLLRRLMGKPRRCSTAFFDEERRSLNEKREKIRTLQATRSVQLEYLRDLPDDMHVPMPLIIGTKITARVRYPTDGLYTGKVDAIDSLRHCYRVTFDKPTLGTRSIPDYEVLSLFPQETIPLSAYKTQHKASRNLFMSPARLLAQSALQGKRHHMHHHKLLQGYGGTAGPGAAGDVAVHDCPLCQAEASGTGGATVRTTISSGFGSNSNLLSAPLKLPAISSGDVAASMGSAALS-LNEASSGGRLLLNEADIYGGYPMKFLVMVTKLSKILEVKKRCVDELQDLNDEAERKISNKTDLSLEFQHTYLTLIVHLERLNKELNQYLAHVLQYANEIAQEHGVAPLEQASDFKQRCDEDSYEIVSRMKNIQSQRLQNTRNMDLISKLVGLLVQVRSLTEQEGAAYGCSSIQDALREIKASVHPGNLQVFENSVEICAHHILCGLCSQSNLHAFLYMHPNHMQYI 609          
BLAST of protein lin-9 vs. TrEMBL
Match: A0A4S2LXB8 (DIRP domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005342 PE=4 SV=1)

HSP 1 Score: 667.152 bits (1720), Expect = 0.000e+0
Identity = 322/527 (61.10%), Postives = 405/527 (76.85%), Query Frame = 3
Query:  279 ERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELS---------SAQDCALCNAE--GAVGAM------------------NLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSLEFINKSVSILVQIRYLTMNEGSAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPFLYSHPSHLQYL 1772
            ER+++Q NA++LRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFR+ LRE FP +KTR L+RA W+ +R++MGKPRRCS  FF EER SL+ KR KIRTLQ  RSV+L+ L+DLPDD+ +PMPLIIGT++TARVR+PTDGLY G VDAID++ + YR++F+KP LGTR +PDYEVLS+ P + IPLSA+K QHKASRNLFMSPARLLAQSALQ    H HH K+      +         +  DC LC AE  G  GA                    LKLP ISS DVAASMGS+AL+  N    G R+ LNEAD+YGGYPMKFLVMVTKLSKILEVKK+CV+E +DLN  A+ K++ +  +SLEFQH+YLT+I++LERLNKEL QYLAHVLQ+ANEIAQEHGV PLEQASD KQ+CD+D+YEI++R KN+   R+++ ++++ I+K V +LVQ+R LT  EG+A+ CSS+ ++LRE+K+ + P N+Q FE+  EI  +HI+ GL S SNL+ FLY HP+H+QY+
Sbjct:   18 ERRMSQVNAVRLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRICLRENFPNVKTRNLSRAHWSLLRRLMGKPRRCSTAFFDEERRSLNEKREKIRTLQATRSVQLEYLRDLPDDMHVPMPLIIGTKITARVRYPTDGLYTGKVDAIDSLRHCYRVTFDKPTLGTRSIPDYEVLSLFPQETIPLSAYKTQHKASRNLFMSPARLLAQSALQGKRHHMHHHKLLQGYGGTAGPGAAGDVAVHDCPLCQAEASGTGGATVRTTISSGFGSNSNLLSAPLKLPAISSGDVAASMGSAALS-LNEASSGGRLLLNEADIYGGYPMKFLVMVTKLSKILEVKKRCVDELQDLNDEAERKISNKTDLSLEFQHTYLTLIVHLERLNKELNQYLAHVLQYANEIAQEHGVAPLEQASDFKQRCDEDSYEIVSRMKNIQSQRLQNTRNMDLISKLVGLLVQVRSLTEQEGAAYGCSSIQDALREIKASVHPGNLQVFENSVEICAHHILCGLCSQSNLHAFLYMHPNHMQYI 543          
BLAST of protein lin-9 vs. Ensembl Cavefish
Match: lin9 (lin-9 DREAM MuvB core complex component [Source:NCBI gene;Acc:103022377])

HSP 1 Score: 379.022 bits (972), Expect = 4.696e-125
Identity = 207/524 (39.50%), Postives = 312/524 (59.54%), Query Frame = 3
Query:  198 TRGRKSVPS---KMKNISASNYNRMGIQQSERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASR-NLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPG-SRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGN--RIRSMKSLEFINKSVSILVQIRYLTMNEG---SAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            TRGR S  S   K+ N++            +++ +Q   ++LRN+LKLPKAHKW  YEWFYSN+D+PL  G+NDF + L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF EER +L  KR K+R LQQ++  ++ L KDLPD+  IP+PL+IGT+VTAR+R   DGL+ G +DA+D    +YR++F++  LGT  VPDYEVLS  PH+ +P+SAF  + + SR   F++P R    ++ Q                                       P +  ND   S           Q P  S++T ++ D  GG+P+KFLV VT+LSKIL +KK+ ++  +++N  A+   +    I L+FQ  Y T +++LE+LNK+L + L  V QF  E+A + G+ P +Q S+L+++C+++A ++M  C  L     R++S    + +++  +IL+QIR L   EG   ++FE  ++ +SL ++KS +   N+  F+D  EI + HI SGL+ L NL+ F
Sbjct:   38 TRGRSSYTSMETKLANVTTP----------DKRTSQKIGLRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCLCLKESFPNLKTRKLTRVEWGTIRRLMGKPRRCSSAFFAEERTALKQKRQKMRLLQQRKITDISLCKDLPDE--IPLPLVIGTKVTARLRGLHDGLFTGQIDAVDTSAATYRVTFDRSGLGTHTVPDYEVLSNEPHETMPISAFAQKQRPSRFQNFLTPPRGAYPASTQ---------------------------------------PILMDNDPLFS-----------QSPWRSKLTGSDGDTLGGFPVKFLVQVTRLSKILMIKKEHIKHLKEMNTEAEKLKSYSMQIGLDFQKRYATTVLDLEQLNKDLNKVLHEVQQFCYELAPDQGMQPADQPSELRRRCENEAEDVMRLCNALPDGEQRVQSPGLTQLVSRLTTILLQIRCLA--EGGDLNSFEFKALTDSLNDIKSSIDTSNLSCFQDNVEIHVAHIQSGLSQLGNLHAF 497          
BLAST of protein lin-9 vs. Ensembl Cavefish
Match: lin9 (lin-9 DREAM MuvB core complex component [Source:NCBI gene;Acc:103022377])

HSP 1 Score: 379.407 bits (973), Expect = 1.098e-124
Identity = 205/516 (39.73%), Postives = 309/516 (59.88%), Query Frame = 3
Query:  213 SVPSKMKNISASNYNRMGIQQSERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASR-NLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPG-SRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGN--RIRSMKSLEFINKSVSILVQIRYLTMNEG---SAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            +VP K+ N++            +++ +Q   ++LRN+LKLPKAHKW  YEWFYSN+D+PL  G+NDF + L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF EER +L  KR K+R LQQ++  ++ L KDLPD+  IP+PL+IGT+VTAR+R   DGL+ G +DA+D    +YR++F++  LGT  VPDYEVLS  PH+ +P+SAF  + + SR   F++P R                                     GA  A     P +  ND   S           Q P  S++T ++ D  GG+P+KFLV VT+LSKIL +KK+ ++  +++N  A+   +    I L+FQ  Y T +++LE+LNK+L + L  V QF  E+A + G+ P +Q S+L+++C+++A ++M  C  L     R++S    + +++  +IL+QIR L   EG   ++FE  ++ +SL ++KS +   N+  F+D  EI + HI SGL+ L NL+ F
Sbjct:   84 TVPQKLANVTTP----------DKRTSQKIGLRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCLCLKESFPNLKTRKLTRVEWGTIRRLMGKPRRCSSAFFAEERTALKQKRQKMRLLQQRKITDISLCKDLPDE--IPLPLVIGTKVTARLRGLHDGLFTGQIDAVDTSAATYRVTFDRSGLGTHTVPDYEVLSNEPHETMPISAFAQKQRPSRFQNFLTPPR-------------------------------------GAYPAST--QPILMDNDPLFS-----------QSPWRSKLTGSDGDTLGGFPVKFLVQVTRLSKILMIKKEHIKHLKEMNTEAEKLKSYSMQIGLDFQKRYATTVLDLEQLNKDLNKVLHEVQQFCYELAPDQGMQPADQPSELRRRCENEAEDVMRLCNALPDGEQRVQSPGLTQLVSRLTTILLQIRCLA--EGGDLNSFEFKALTDSLNDIKSSIDTSNLSCFQDNVEIHVAHIQSGLSQLGNLHAF 535          
BLAST of protein lin-9 vs. Ensembl Nematostella
Match: EDO39836 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8Y2])

HSP 1 Score: 229.95 bits (585), Expect = 2.247e-68
Identity = 113/231 (48.92%), Postives = 153/231 (66.23%), Query Frame = 3
Query:  285 KVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLF--------------------MSPARLLAQSAL 917
            K A+A   KL+N+LKLPKA KW +YEWFYS++DR L  G+NDF + LRE+FP LK +K+ RA+W  +R++MGKPRRCS  FF EER +L  KR KIR LQQK+  EL   KDLP++  +P+PL+IGT+VTAR+R P DGL+ G ++A+D  N SYR++F+ P LGT  VPD EVLS    +++P+S+F ++ +     F                     SPARL  Q A+
Sbjct:   51 KGAKAAFSKLQNLLKLPKAAKWCYYEWFYSSVDRALFEGDNDFCICLRESFPNLKVKKMRRAEWREVRRLMGKPRRCSPSFFLEERQALQEKRKKIRLLQQKKVTELRRFKDLPEE--VPLPLVIGTKVTARLRWPQDGLFTGQIEAVDTQNASYRVTFDGPGLGTHTVPDTEVLSEENEELMPISSFLLKERPRTAAFPPTYTPPSKSSLVVNDPLLGASPARLRLQEAI 279          

HSP 2 Score: 158.688 bits (400), Expect = 2.794e-42
Identity = 88/232 (37.93%), Postives = 141/232 (60.78%), Query Frame = 3
Query: 1068 SMGSSALTNPNLQRPGSRITLNEA-------DLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNR-IRSMKSLEFINKSVSILVQIRYLTMNEGSAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            S  S  + +P L    +R+ L EA          GG+P+KFL++VT+LSKIL VKK+C+E+ RD+N  A+   + ++PI  +FQ  Y  V++ LERLNK+L  YL  V ++   +A +HG+  ++Q   +K+KCD++A  ++ +     G + +R   +LE IN   SIL+QI+ L  N+ + FE  S+ +++ E+K  + P NI  F+D  EI + HI SGL+ + NL+ F
Sbjct:  255 SKSSLVVNDPLLGASPARLRLQEAINQQGTGGTLGGFPIKFLILVTRLSKILLVKKECIEKLRDMNTKAEKMKSYQDPIDKDFQRQYACVVLELERLNKDLNDYLTGVQEYCQTLAPDHGLHTIDQTVSVKRKCDEEAKVMVEQLNMKMGQQAVRHRPTLEVINGLTSILLQIKSLAENDLNTFEFKSLSDAVEEIKKTIDPSNISCFQDNVEIHVAHIQSGLSQMGNLHAF 486          
BLAST of protein lin-9 vs. Ensembl Medaka
Match: lin9 (lin-9 DREAM MuvB core complex component [Source:NCBI gene;Acc:101157584])

HSP 1 Score: 334.339 bits (856), Expect = 3.431e-107
Identity = 187/525 (35.62%), Postives = 297/525 (56.57%), Query Frame = 3
Query:  183 EEGSYTRGRKSVPSKMKNISASNYNRMGIQQSERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNL--FMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCK-NLSGNRIRSMKSL-EFINKSVSILVQIRYLTMNEG--SAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPF 1739
            EE    R     P + + ++ +      +   ++K +Q   ++LRN+LKLPKAHKW  YEWFYSN+DRPL  G+N+F + L+E+FP LKTRKLTR +W  IR++MGKPRRCS  FF EER +L  KR K+R LQQ++  +L   KDLP++  IP+PLIIGT+VTAR+R   DGL+ G +DA+D    +YR++F++  LGT  VPDYEVLS  P++ +P+SAF  +H+++R +   M+P R    S          HM  +     S  ++   C+    +G   +K                                            FLV VT+LSKIL +KK+ ++  +++N  A+   +   PI L+FQ  Y   ++ L++LNK+L +    V QF  +++ + G+ P +  ++L+++C++ A +++        G  I +   L   I++  ++L+QI+ L  +EG  ++FE  S+ +SL ++K+ + P N+  F++  EI + HI SGL+ L NL+ F
Sbjct:   67 EESPQQRLPSRSPRRSQRVTITPQKFSNVVTPDKKASQKIGLRLRNLLKLPKAHKWCIYEWFYSNIDRPLFEGDNEFCLCLKESFPNLKTRKLTRVEWGTIRRLMGKPRRCSSAFFAEERTALRQKRQKMRLLQQRKLSDLSNCKDLPEE--IPLPLIIGTKVTARLRGNHDGLFTGQIDAVDTSAATYRVTFDRTGLGTHTVPDYEVLSNEPNETMPISAFAQKHRSARYMQNVMTPPRATYPSVTTPV-----HMDNDPLMSQSPWRNKLSCSEGETLGGFPVK--------------------------------------------FLVQVTRLSKILMIKKEHIKHLKEMNTEAERLKSYSMPIDLDFQKRYAITVLELDQLNKDLNKVFHEVQQFCCDLSPDQGMVPADHPTELRRRCEEQAQQMVQMYNPQWDGQHIITNPGLTSLISRLTALLLQIKCLA-DEGDLNSFEFKSLTDSLNDIKASVDPSNLSCFQNNVEIHVAHIQSGLSQLGNLHAF 539          
BLAST of protein lin-9 vs. Planmine SMEST
Match: SMESG000030984.1 (SMESG000030984.1)

HSP 1 Score: 1157.13 bits (2992), Expect = 0.000e+0
Identity = 554/554 (100.00%), Postives = 554/554 (100.00%), Query Frame = 3
Query:  111 FFEDDTYESGETLKNDNIGVMLPPEEGSYTRGRKSVPSKMKNISASNYNRMGIQQSERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSLEFINKSVSILVQIRYLTMNEGSAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPFLYSHPSHLQYL 1772
            FFEDDTYESGETLKNDNIGVMLPPEEGSYTRGRKSVPSKMKNISASNYNRMGIQQSERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSLEFINKSVSILVQIRYLTMNEGSAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPFLYSHPSHLQYL
Sbjct:   30 FFEDDTYESGETLKNDNIGVMLPPEEGSYTRGRKSVPSKMKNISASNYNRMGIQQSERKVAQANAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDLPDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPALGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQSGTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASMGSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCVEEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVLQFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSLEFINKSVSILVQIRYLTMNEGSAFECSSVYESLREMKSELSPHNIQNFEDKTEIAINHIMSGLNSLSNLNPFLYSHPSHLQYL 583          
BLAST of protein lin-9 vs. Planmine SMEST
Match: SMESG000035506.1 (SMESG000035506.1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.633e-15
Identity = 36/96 (37.50%), Postives = 53/96 (55.21%), Query Frame = 3
Query:  300 NAIKLRNVLKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQWACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQ 587
            N  +L N LK  K   W+  E FYS +D+ + LG N  ++++    P LKT+KL  +QW  I+K  GKP R S  +F ++R  L   R  +R + Q
Sbjct:    7 NYNRLSNFLKSKKVFNWISNELFYSEIDKSIFLGNNKLQLYISSYLPNLKTKKLNISQWRIIKKCFGKPIRMSKQYFIKKRKMLSEYRKNVRFVYQ 102          
The following BLAST results are available for this feature:
BLAST of protein lin-9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
LIN91.818e-12540.53lin-9 DREAM MuvB core complex component [Source:HG... [more]
LIN94.579e-12540.53lin-9 DREAM MuvB core complex component [Source:HG... [more]
LIN91.908e-12440.53lin-9 DREAM MuvB core complex component [Source:HG... [more]
LIN99.172e-11740.43lin-9 DREAM MuvB core complex component [Source:HG... [more]
back to top
BLAST of protein lin-9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
lin-91.231e-6030.51pep chromosome:WBcel235:III:8900240:8904160:-1 gen... [more]
lin-91.231e-6030.51pep chromosome:WBcel235:III:8900237:8904131:-1 gen... [more]
lin-91.354e-6030.51pep chromosome:WBcel235:III:8900237:8904131:-1 gen... [more]
lin-91.354e-6030.51pep chromosome:WBcel235:III:8900238:8904160:-1 gen... [more]
back to top
BLAST of protein lin-9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mip1301.219e-4647.15gene:FBgn0023509 transcript:FBtr0070315[more]
aly3.893e-1428.65gene:FBgn0004372 transcript:FBtr0073006[more]
aly3.893e-1428.65gene:FBgn0004372 transcript:FBtr0332086[more]
back to top
BLAST of protein lin-9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lin95.476e-12238.57lin-9 DREAM MuvB core complex component [Source:NC... [more]
lin91.225e-12138.57lin-9 DREAM MuvB core complex component [Source:NC... [more]
back to top
BLAST of protein lin-9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LIN92.485e-12438.68lin-9 DREAM MuvB core complex component [Source:NC... [more]
LIN92.689e-12440.12lin-9 DREAM MuvB core complex component [Source:NC... [more]
LIN91.097e-12340.12lin-9 DREAM MuvB core complex component [Source:NC... [more]
LIN91.848e-12340.12lin-9 DREAM MuvB core complex component [Source:NC... [more]
LIN92.730e-12340.12lin-9 DREAM MuvB core complex component [Source:NC... [more]
back to top
BLAST of protein lin-9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Lin98.044e-12538.88lin-9 homolog (C. elegans) [Source:MGI Symbol;Acc:... [more]
Lin96.055e-12440.12lin-9 homolog (C. elegans) [Source:MGI Symbol;Acc:... [more]
Lin92.098e-7258.19lin-9 homolog (C. elegans) [Source:MGI Symbol;Acc:... [more]
Lin92.651e-1266.67lin-9 homolog (C. elegans) [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of protein lin-9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4R8N2|LIN9_MACFA2.243e-12440.73Protein lin-9 homolog OS=Macaca fascicularis OX=95... [more]
sp|Q5TKA1|LIN9_HUMAN2.497e-12440.53Protein lin-9 homolog OS=Homo sapiens OX=9606 GN=L... [more]
sp|Q8C735|LIN9_MOUSE3.341e-12340.12Protein lin-9 homolog OS=Mus musculus OX=10090 GN=... [more]
sp|Q5RHQ8|LIN9_DANRE9.251e-12138.57Protein lin-9 homolog OS=Danio rerio OX=7955 GN=li... [more]
sp|P30630|LIN9_CAEEL1.722e-5930.51Protein lin-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
back to top
BLAST of protein lin-9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7GXQ70.000e+099.74Protein lin-9 (Fragment) OS=Schmidtea mediterranea... [more]
A0A4Z2CPK90.000e+060.07Protein lin-9 isoform 2 OS=Schistosoma japonicum O... [more]
C1L4U10.000e+060.07Lin-9 homolog OS=Schistosoma japonicum OX=6182 GN=... [more]
A0A4S2LRI80.000e+057.19DIRP domain-containing protein OS=Opisthorchis fel... [more]
A0A4S2LXB80.000e+061.10DIRP domain-containing protein OS=Opisthorchis fel... [more]
back to top
BLAST of protein lin-9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lin94.696e-12539.50lin-9 DREAM MuvB core complex component [Source:NC... [more]
lin91.098e-12439.73lin-9 DREAM MuvB core complex component [Source:NC... [more]
back to top
BLAST of protein lin-9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein lin-9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein lin-9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO398362.247e-6848.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of protein lin-9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lin93.431e-10735.62lin-9 DREAM MuvB core complex component [Source:NC... [more]
back to top
BLAST of protein lin-9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000030984.10.000e+0100.00SMESG000030984.1[more]
SMESG000035506.15.633e-1537.50SMESG000035506.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30034610
GenBankAKG62108.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034610 ID=SMED30034610|Name=protein lin-9|organism=Schmidtea mediterranea sexual|type=transcript|length=1840bp
GATATAATACTGAATTTTGAATAATGGCTGAACAAATCGAAAATTATGAG
CCAGAAGAATATGAAAATACTTATCGAAGAAATCCACCAAGGCAAAGACG
ACGAAACAGATTTTTTGAAGATGATACATATGAATCAGGAGAAACATTGA
AAAATGACAATATAGGTGTAATGCTTCCTCCAGAAGAAGGATCTTATACT
AGAGGGCGAAAAAGTGTTCCGTCAAAAATGAAAAATATTTCAGCTAGTAA
TTACAATAGAATGGGAATTCAACAATCTGAAAGAAAAGTTGCTCAGGCAA
ATGCTATAAAATTACGAAACGTTCTTAAGTTACCTAAAGCGCATAAATGG
GTATTTTATGAATGGTTCTATTCCAATTTAGATAGACCATTATTGTTGGG
TGAAAATGACTTTCGAGTTTTTTTAAGAGAAACATTCCCAGCATTAAAAA
CTAGAAAGCTTACCAGGGCACAATGGGCTTGTATTCGAAAAATGATGGGT
AAACCTCGTCGTTGTTCATATCATTTTTTCAAAGAAGAACGTGCATCTCT
GCATGCTAAGCGTTCCAAAATAAGAACTCTTCAACAGAAAAGATCTGTGG
AATTGGATTTACTAAAAGATTTACCAGATGATATTTGTATTCCTATGCCT
TTAATTATTGGCACGCAAGTGACAGCTAGAGTGCGACATCCGACAGATGG
CTTGTATGTTGGGAACGTTGACGCCATTGATGCCGTAAATAACAGTTATC
GGATTTCATTTGAAAAACCAGCTCTCGGCACAAGACCTGTTCCGGATTAC
GAAGTGCTCAGCATATTGCCCCACGATGTGATTCCGCTATCGGCGTTCAA
AATGCAGCACAAGGCCAGTAGAAATCTGTTTATGAGTCCCGCTCGGTTAT
TGGCACAATCGGCTCTTCAATCGGGAACTCGGCATCAACATCATATGAAA
ATTAACAGCCGTGGAGAACTAAGCAGTGCTCAGGACTGCGCATTATGTAA
CGCCGAAGGCGCAGTTGGGGCGATGAATTTAAAATTACCGGAAATCAGTA
GTAATGATGTAGCTGCGAGCATGGGCTCATCAGCATTGACAAATCCAAAC
CTACAAAGGCCCGGCAGTAGAATCACCCTCAACGAAGCAGATCTATACGG
GGGATATCCGATGAAATTTTTAGTCATGGTTACAAAGCTCAGTAAAATTC
TAGAAGTGAAAAAGCAATGTGTGGAAGAACATCGAGATTTAAATCAAATT
GCGCAGTGGAAGATGGCAACAAGGGAGCCGATTTCCCTCGAGTTTCAACA
CAGCTACCTCACAGTTATCATTAATCTTGAACGGTTAAACAAAGAATTAA
CACAATACTTGGCGCATGTTCTCCAATTTGCTAATGAAATAGCTCAGGAG
CATGGAGTTCCACCGCTAGAACAAGCATCGGATTTGAAACAGAAATGTGA
TGATGATGCGTATGAAATCATGAATAGGTGCAAAAATTTAAGTGGAAATC
GTATTCGATCAATGAAAAGCCTAGAGTTCATAAATAAATCTGTCAGTATT
CTGGTACAGATCAGATATTTGACAATGAATGAAGGCAGTGCGTTTGAGTG
CTCAAGCGTTTACGAGTCGCTAAGAGAAATGAAAAGTGAATTATCCCCTC
ACAATATCCAAAATTTTGAGGACAAAACCGAAATTGCGATAAACCACATA
ATGAGTGGGCTGAATTCTCTCTCCAATTTAAATCCCTTTCTATATTCTCA
TCCCAGCCATCTGCAGTATTTATAATGGGAAATATTTTGTCTTGTACTAA
TTTTATTAATTGAAAGAATATTGTTACATTTGTTATGCAA
back to top

protein sequence of SMED30034610-orf-1

>SMED30034610-orf-1 ID=SMED30034610-orf-1|Name=SMED30034610-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=584bp
MAEQIENYEPEEYENTYRRNPPRQRRRNRFFEDDTYESGETLKNDNIGVM
LPPEEGSYTRGRKSVPSKMKNISASNYNRMGIQQSERKVAQANAIKLRNV
LKLPKAHKWVFYEWFYSNLDRPLLLGENDFRVFLRETFPALKTRKLTRAQ
WACIRKMMGKPRRCSYHFFKEERASLHAKRSKIRTLQQKRSVELDLLKDL
PDDICIPMPLIIGTQVTARVRHPTDGLYVGNVDAIDAVNNSYRISFEKPA
LGTRPVPDYEVLSILPHDVIPLSAFKMQHKASRNLFMSPARLLAQSALQS
GTRHQHHMKINSRGELSSAQDCALCNAEGAVGAMNLKLPEISSNDVAASM
GSSALTNPNLQRPGSRITLNEADLYGGYPMKFLVMVTKLSKILEVKKQCV
EEHRDLNQIAQWKMATREPISLEFQHSYLTVIINLERLNKELTQYLAHVL
QFANEIAQEHGVPPLEQASDLKQKCDDDAYEIMNRCKNLSGNRIRSMKSL
EFINKSVSILVQIRYLTMNEGSAFECSSVYESLREMKSELSPHNIQNFED
KTEIAINHIMSGLNSLSNLNPFLYSHPSHLQYL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR010561LIN-9/ALY1
IPR003133T_Ag_DNA-bd
IPR033471DIRP
Vocabulary: molecular function
TermDefinition
GO:0003688DNA replication origin binding
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0006351transcription, DNA-templated
GO:0007049cell cycle
Vocabulary: cellular component
TermDefinition
GO:0017053transcriptional repressor complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 435..455
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..37
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 11..37
NoneNo IPR availablePANTHERPTHR21689:SF2PROTEIN LIN-9 HOMOLOGcoord: 9..561
IPR033471DIRP domainSMARTSM01135DIRP_2coord: 115..222
e-value: 1.2E-47
score: 174.3
IPR033471DIRP domainPFAMPF06584DIRPcoord: 115..221
e-value: 1.3E-37
score: 128.2
IPR010561Protein LIN-9/Protein ALWAYS EARLYPANTHERPTHR21689LIN-9coord: 9..561