slc4a-5

Overview
Nameslc4a-5 (AKN21411.1)
Smed IDSMED30034606
Length (bp)2735
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc4a-5 (SMED30034606) t-SNE clustered cells

Violin plots show distribution of expression levels for slc4a-5 (SMED30034606) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc4a-5 (SMED30034606) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc4a-5 (SMED30034606) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034606

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30034606SMESG000061700.1 SmedASXL_016174SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30034606SMESG000061700.1 dd_Smed_v4_14606_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30034606SMESG000061700.1 dd_Smed_v6_14606_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30034606SMESG000061700.1 OX_Smed_1.0.06456ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc4a-5 vs. Ensembl Human
Match: SLC4A11 (solute carrier family 4 member 11 [Source:HGNC Symbol;Acc:HGNC:16438])

HSP 1 Score: 527.324 bits (1357), Expect = 1.648e-173
Identity = 314/782 (40.15%), Postives = 479/782 (61.25%), Query Frame = 2
Query:  383 LPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSF-LTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQL------AETQKILRKRSVKVDEVMDQAFSVKTKFWI--GGGIVGDIKRRIPHYLSDYCDGFKGAN-TIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQ---CAEENKVNNSIFKSLSNMSNPFQIT-------STLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L LK+F  E+RA  D++ F+ ++ + L     S++ ++  ML         +E +  + +  A   LF      +      L+ TI+G++   T G+   QSW+  + T+  L KRH+ I+RL  P N G ++  V F+ILVL P K K TK+ +E+ RTF+T+ +DI FRQ+LL    E++F+  L  Q RQL             ++RS             K K ++  G GI  DI RR P Y  D+ DG  G N  + K  +TT FLYF+CLLP+IAFG LN  NTD  IDV++ I  Q+IGGL++ +  GQPL+++LTTAPLALY ++I  I  +Y +DF++ +A TG++N+ +L +Y+  ++  +M    +STEE+ A F++I F +DA K   K F ++Y      + +    S   SLS +      +       S L+   +  ++ H G +      +VL LL+ +GT+WL   L+ F K+PYL+   RE+L+D ALP+A+   S+I +  FR+I +  F Y+     F    +  L  +A+     LGF LS+LFF++QN+ +++VN+P N+L KG+ +HWDL ++A+IN  LS+FGLPWIH A PHSPLHV+AL+ +EER++ GH ++ TIV V+ETR+TS+ +++ + LSL LLP PL +IP  VL GLF+++A+TSL  NQ  +R+ LL  EQ+AYPP+HY+RRVPQRK+H FT  Q++QL++L A G S  PYMKM FP++++  IPIR+ ++P+ I+  +++ MD
Sbjct:   99 LKLKNFKEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAM--LFTDAGAPMRGKVHLLSDTIQGVTATVT-GVRYQQSWLCIICTMKALQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKLLETRTEEEFKEALVHQ-RQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLDFTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLALYIQVIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLSLVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGLGASLNASLHTALNASFLASPTELPSATHSGQA-----TAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAMAQIQSLSLRAVSGAMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGH-IYDTIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIPKPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLLLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMD 870          
BLAST of slc4a-5 vs. Ensembl Human
Match: SLC4A11 (solute carrier family 4 member 11 [Source:HGNC Symbol;Acc:HGNC:16438])

HSP 1 Score: 527.709 bits (1358), Expect = 2.042e-173
Identity = 314/782 (40.15%), Postives = 479/782 (61.25%), Query Frame = 2
Query:  383 LPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSF-LTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQL------AETQKILRKRSVKVDEVMDQAFSVKTKFWI--GGGIVGDIKRRIPHYLSDYCDGFKGAN-TIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQ---CAEENKVNNSIFKSLSNMSNPFQIT-------STLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L LK+F  E+RA  D++ F+ ++ + L     S++ ++  ML         +E +  + +  A   LF      +      L+ TI+G++   T G+   QSW+  + T+  L KRH+ I+RL  P N G ++  V F+ILVL P K K TK+ +E+ RTF+T+ +DI FRQ+LL    E++F+  L  Q RQL             ++RS             K K ++  G GI  DI RR P Y  D+ DG  G N  + K  +TT FLYF+CLLP+IAFG LN  NTD  IDV++ I  Q+IGGL++ +  GQPL+++LTTAPLALY ++I  I  +Y +DF++ +A TG++N+ +L +Y+  ++  +M    +STEE+ A F++I F +DA K   K F ++Y      + +    S   SLS +      +       S L+   +  ++ H G +      +VL LL+ +GT+WL   L+ F K+PYL+   RE+L+D ALP+A+   S+I +  FR+I +  F Y+     F    +  L  +A+     LGF LS+LFF++QN+ +++VN+P N+L KG+ +HWDL ++A+IN  LS+FGLPWIH A PHSPLHV+AL+ +EER++ GH ++ TIV V+ETR+TS+ +++ + LSL LLP PL +IP  VL GLF+++A+TSL  NQ  +R+ LL  EQ+AYPP+HY+RRVPQRK+H FT  Q++QL++L A G S  PYMKM FP++++  IPIR+ ++P+ I+  +++ MD
Sbjct:  115 LKLKNFKEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAM--LFTDAGAPMRGKVHLLSDTIQGVTATVT-GVRYQQSWLCIICTMKALQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKLLETRTEEEFKEALVHQ-RQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLDFTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLALYIQVIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLSLVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGLGASLNASLHTALNASFLASPTELPSATHSGQA-----TAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAMAQIQSLSLRAVSGAMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGH-IYDTIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIPKPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLLLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMD 886          
BLAST of slc4a-5 vs. Ensembl Human
Match: SLC4A11 (solute carrier family 4 member 11 [Source:HGNC Symbol;Acc:HGNC:16438])

HSP 1 Score: 526.939 bits (1356), Expect = 7.922e-173
Identity = 314/782 (40.15%), Postives = 479/782 (61.25%), Query Frame = 2
Query:  383 LPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSF-LTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQL------AETQKILRKRSVKVDEVMDQAFSVKTKFWI--GGGIVGDIKRRIPHYLSDYCDGFKGAN-TIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQ---CAEENKVNNSIFKSLSNMSNPFQIT-------STLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L LK+F  E+RA  D++ F+ ++ + L     S++ ++  ML         +E +  + +  A   LF      +      L+ TI+G++   T G+   QSW+  + T+  L KRH+ I+RL  P N G ++  V F+ILVL P K K TK+ +E+ RTF+T+ +DI FRQ+LL    E++F+  L  Q RQL             ++RS             K K ++  G GI  DI RR P Y  D+ DG  G N  + K  +TT FLYF+CLLP+IAFG LN  NTD  IDV++ I  Q+IGGL++ +  GQPL+++LTTAPLALY ++I  I  +Y +DF++ +A TG++N+ +L +Y+  ++  +M    +STEE+ A F++I F +DA K   K F ++Y      + +    S   SLS +      +       S L+   +  ++ H G +      +VL LL+ +GT+WL   L+ F K+PYL+   RE+L+D ALP+A+   S+I +  FR+I +  F Y+     F    +  L  +A+     LGF LS+LFF++QN+ +++VN+P N+L KG+ +HWDL ++A+IN  LS+FGLPWIH A PHSPLHV+AL+ +EER++ GH ++ TIV V+ETR+TS+ +++ + LSL LLP PL +IP  VL GLF+++A+TSL  NQ  +R+ LL  EQ+AYPP+HY+RRVPQRK+H FT  Q++QL++L A G S  PYMKM FP++++  IPIR+ ++P+ I+  +++ MD
Sbjct:  142 LKLKNFKEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAM--LFTDAGAPMRGKVHLLSDTIQGVTATVT-GVRYQQSWLCIICTMKALQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKLLETRTEEEFKEALVHQ-RQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLDFTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLALYIQVIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLSLVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGLGASLNASLHTALNASFLASPTELPSATHSGQA-----TAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAMAQIQSLSLRAVSGAMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGH-IYDTIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIPKPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLLLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMD 913          
BLAST of slc4a-5 vs. Ensembl Human
Match: SLC4A11 (solute carrier family 4 member 11 [Source:HGNC Symbol;Acc:HGNC:16438])

HSP 1 Score: 515.768 bits (1327), Expect = 2.955e-169
Identity = 297/701 (42.37%), Postives = 445/701 (63.48%), Query Frame = 2
Query:  623 LAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQL------AETQKILRKRSVKVDEVMDQAFSVKTKFWI--GGGIVGDIKRRIPHYLSDYCDGFKGAN-TIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQ---CAEENKVNNSIFKSLSNMSNPFQIT-------STLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L+ TI+G++   T G+   QSW+  + T+  L KRH+ I+RL  P N G ++  V F+ILVL P K K TK+ +E+ RTF+T+ +DI FRQ+LL    E++F+  L  Q RQL             ++RS             K K ++  G GI  DI RR P Y  D+ DG  G N  + K  +TT FLYF+CLLP+IAFG LN  NTD  IDV++ I  Q+IGGL++ +  GQPL+++LTTAPLALY ++I  I  +Y +DF++ +A TG++N+ +L +Y+  ++  +M    +STEE+ A F++I F +DA K   K F ++Y      + +    S   SLS +      +       S L+   +  ++ H G +      +VL LL+ +GT+WL   L+ F K+PYL+   RE+L+D ALP+A+   S+I +  FR+I +  F Y+     F    +  L  +A+     LGF LS+LFF++QN+ +++VN+P N+L KG+ +HWDL ++A+IN  LS+FGLPWIH A PHSPLHV+AL+ +EER++ GH ++ TIV V+ETR+TS+ +++ + LSL LLP PL +IP  VL GLF+++A+TSL  NQ  +R+ LL  EQ+AYPP+HY+RRVPQRK+H FT  Q++QL++L A G S  PYMKM FP++++  IPIR+ ++P+ I+  +++ MD
Sbjct:  155 LSDTIQGVTATVT-GVRYQQSWLCIICTMKALQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKLLETRTEEEFKEALVHQ-RQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLDFTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLALYIQVIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLSLVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGLGASLNASLHTALNASFLASPTELPSATHSGQA-----TAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAMAQIQSLSLRAVSGAMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGH-IYDTIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIPKPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLLLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMD 847          
BLAST of slc4a-5 vs. Ensembl Human
Match: SLC4A11 (solute carrier family 4 member 11 [Source:HGNC Symbol;Acc:HGNC:16438])

HSP 1 Score: 459.529 bits (1181), Expect = 7.829e-148
Identity = 293/782 (37.47%), Postives = 448/782 (57.29%), Query Frame = 2
Query:  383 LPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSF-LTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQL------AETQKILRKRSVKVDEVMDQAFSVKTKFWI--GGGIVGDIKRRIPHYLSDYCDGFKGAN-TIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQ---CAEENKVNNSIFKSLSNMSNPFQIT-------STLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L LK+F  E+RA  D++ F+ ++ + L     S++ ++  ML         +E +  + +  A   LF      +      L+ TI+G++   T G+   QSW+  + T+  L KRH+ I+RL  P N G ++  V F+ILVL P K K TK+ +E+ RTF+T+ +DI FRQ+LL    E++F+  L  Q RQL             ++RS             K K ++  G GI  DI RR P Y  D+ DG  G N  + K  +TT FLYF+CLLP+IAFG LN  NTD  I                                      +I  I  +Y +DF++ +A TG++N+ +L +Y+  ++  +M    +STEE+ A F++I F +DA K   K F ++Y      + +    S   SLS +      +       S L+   +  ++ H G +      +VL LL+ +GT+WL   L+ F K+PYL+   RE+L+D ALP+A+   S+I +  FR+I +  F Y+     F    +  L  +A+     LGF LS+LFF++QN+ +++VN+P N+L KG+ +HWDL ++A+IN  LS+FGLPWIH A PHSPLHV+AL+ +EER++ GH ++ TIV V+ETR+TS+ +++ + LSL LLP PL +IP  VL GLF+++A+TSL  NQ  +R+ LL  EQ+AYPP+HY+RRVPQRK+H FT  Q++QL++L A G S  PYMKM FP++++  IPIR+ ++P+ I+  +++ MD
Sbjct:   99 LKLKNFKEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAM--LFTDAGAPMRGKVHLLSDTIQGVTATVT-GVRYQQSWLCIICTMKALQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKLLETRTEEEFKEALVHQ-RQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLDFTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAI--------------------------------------VIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLSLVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGLGASLNASLHTALNASFLASPTELPSATHSGQA-----TAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAMAQIQSLSLRAVSGAMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGH-IYDTIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIPKPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLLLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMD 832          
BLAST of slc4a-5 vs. Ensembl Celegans
Match: abts-3 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:A0A3B1E4W4])

HSP 1 Score: 660.218 bits (1702), Expect = 0.000e+0
Identity = 358/784 (45.66%), Postives = 534/784 (68.11%), Query Frame = 2
Query:  359 LVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERML--INILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMD--QSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKR--SVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEEN----KVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPF--YYDEKVFQFQPV-NLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSL-FLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L+ ++ EK+P+KDF SE+RA++DI+  + ++VL L++   S+EEI  +++  ++I E E T E        + ++ LF   +     +  L++T++ I    + G + D  Q+WI A+  L  +  RH+AIARLS P NLGR+ +++ FII+V+ P++ KGTK+ +E  RTF+T+ AD++ RQ+L+M ++ + FRS L   A++LA  Q   R+R  S+ +    +Q F  +  ++   G+V + KRR+  Y SDY DG +G  T++K+FST  FLYF+CLLP+IAFGVLN +NT   I+V++VII+QAIGG+ F + GGQP+I++LTT PLA+Y K+IF IS E   DF AM+AC G+F  ++L++YS T++C LMK++T+S EE+F+ F+AIAFTV++ + ++  F ++Y   + +    K   +   +  N SN   I   ++       S+    S C RD S+LY+LL  GT+WL   L+NF KTPYL   +RE LAD+ALP ++ IMS  G+  F DI  D F   ++  + Q   V +LP  G+     C  LGF LS LFF+DQNI S++VN+  NKLKKG++ + DLF+VAL+N FLS+FGLPW+HGA+PHSPLH++AL+D+EER+  GH VH+ I+ VRETR+ S+++++ I +S+ FL+P PL  IP +VL GLF++MA+TSL  N+  ER+ LL TEQ AYPP+HY+R+VPQRK+HLFT  QL+QLI+L A GFSP P+++M FPIV    +PIRH +IP+ ID  +++A+D
Sbjct:  111 LMYAKHEKIPMKDFGSEIRATMDIDHLLNKAVLLLDLQETSLEEIFAKIIHEMDIQEPEFTSE--------QVRSVLFTQDA--GNQFHILSRTVQSICTTGSVGGSFDYDQTWICALCMLNTVQHRHVAIARLSHPTNLGRTMQDLRFIIIVIAPSRAKGTKTALETTRTFATLFADMEIRQRLVMAQSVEQFRSTLLSAAKELAMDQNQWRERKSSIHLSHAKEQIFGPEA-WYPFRGLVEEFKRRLAIYPSDYLDGIRGHKTVQKLFSTVVFLYFACLLPAIAFGVLNDDNTKGAINVRKVIIAQAIGGIFFSLFGGQPMIILLTTVPLAIYIKVIFKISQELGYDFLAMYACVGLFCQMFLILYSATELCSLMKFATRSAEEMFSLFIAIAFTVESIRAIHNSFKKNYNDCDTSAISMKAARTALNAFKNGSNADSIVGNITS----SMSIGDTGSLCRRDTSILYMLLMFGTLWLGLFLYNFRKTPYLTRSRREWLADYALPASVLIMSFTGSYAFSDIEKDRFNLRFEFPLIQMADVTSLPPSGY---FVCLLLGFSLSFLFFIDQNITSAIVNNNQNKLKKGTSHNLDLFVVALLNMFLSVFGLPWMHGALPHSPLHLRALADVEERVSQGH-VHEVIMNVRETRLASLIAHVMILVSMFFLIPYPLQLIPTSVLHGLFLYMALTSLSGNEMFERLLLLITEQQAYPPTHYIRKVPQRKVHLFTACQLLQLIILCAFGFSPYPFIEMVFPIVCFFFLPIRHTLIPRLIDYKYLDALD 875          
BLAST of slc4a-5 vs. Ensembl Celegans
Match: abts-3 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:A0A3B1E4W4])

HSP 1 Score: 660.218 bits (1702), Expect = 0.000e+0
Identity = 358/784 (45.66%), Postives = 534/784 (68.11%), Query Frame = 2
Query:  359 LVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERML--INILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMD--QSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKR--SVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEEN----KVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPF--YYDEKVFQFQPV-NLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSL-FLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L+ ++ EK+P+KDF SE+RA++DI+  + ++VL L++   S+EEI  +++  ++I E E T E        + ++ LF   +     +  L++T++ I    + G + D  Q+WI A+  L  +  RH+AIARLS P NLGR+ +++ FII+V+ P++ KGTK+ +E  RTF+T+ AD++ RQ+L+M ++ + FRS L   A++LA  Q   R+R  S+ +    +Q F  +  ++   G+V + KRR+  Y SDY DG +G  T++K+FST  FLYF+CLLP+IAFGVLN +NT   I+V++VII+QAIGG+ F + GGQP+I++LTT PLA+Y K+IF IS E   DF AM+AC G+F  ++L++YS T++C LMK++T+S EE+F+ F+AIAFTV++ + ++  F ++Y   + +    K   +   +  N SN   I   ++       S+    S C RD S+LY+LL  GT+WL   L+NF KTPYL   +RE LAD+ALP ++ IMS  G+  F DI  D F   ++  + Q   V +LP  G+     C  LGF LS LFF+DQNI S++VN+  NKLKKG++ + DLF+VAL+N FLS+FGLPW+HGA+PHSPLH++AL+D+EER+  GH VH+ I+ VRETR+ S+++++ I +S+ FL+P PL  IP +VL GLF++MA+TSL  N+  ER+ LL TEQ AYPP+HY+R+VPQRK+HLFT  QL+QLI+L A GFSP P+++M FPIV    +PIRH +IP+ ID  +++A+D
Sbjct:  192 LMYAKHEKIPMKDFGSEIRATMDIDHLLNKAVLLLDLQETSLEEIFAKIIHEMDIQEPEFTSE--------QVRSVLFTQDA--GNQFHILSRTVQSICTTGSVGGSFDYDQTWICALCMLNTVQHRHVAIARLSHPTNLGRTMQDLRFIIIVIAPSRAKGTKTALETTRTFATLFADMEIRQRLVMAQSVEQFRSTLLSAAKELAMDQNQWRERKSSIHLSHAKEQIFGPEA-WYPFRGLVEEFKRRLAIYPSDYLDGIRGHKTVQKLFSTVVFLYFACLLPAIAFGVLNDDNTKGAINVRKVIIAQAIGGIFFSLFGGQPMIILLTTVPLAIYIKVIFKISQELGYDFLAMYACVGLFCQMFLILYSATELCSLMKFATRSAEEMFSLFIAIAFTVESIRAIHNSFKKNYNDCDTSAISMKAARTALNAFKNGSNADSIVGNITS----SMSIGDTGSLCRRDTSILYMLLMFGTLWLGLFLYNFRKTPYLTRSRREWLADYALPASVLIMSFTGSYAFSDIEKDRFNLRFEFPLIQMADVTSLPPSGY---FVCLLLGFSLSFLFFIDQNITSAIVNNNQNKLKKGTSHNLDLFVVALLNMFLSVFGLPWMHGALPHSPLHLRALADVEERVSQGH-VHEVIMNVRETRLASLIAHVMILVSMFFLIPYPLQLIPTSVLHGLFLYMALTSLSGNEMFERLLLLITEQQAYPPTHYIRKVPQRKVHLFTACQLLQLIILCAFGFSPYPFIEMVFPIVCFFFLPIRHTLIPRLIDYKYLDALD 956          
BLAST of slc4a-5 vs. Ensembl Celegans
Match: abts-3 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:A0A3B1E4W4])

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 358/784 (45.66%), Postives = 533/784 (67.98%), Query Frame = 2
Query:  359 LVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERML--INILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEG--LAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKR--SVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEEN----KVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPF--YYDEKVFQFQPV-NLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSL-FLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L+ ++ EK+P+KDF SE+RA++DI+  + ++VL L++   S+EEI  +++  ++I E E T E        + ++ LF   +     +  L++T++ I    + G     DQ+WI A+  L  +  RH+AIARLS P NLGR+ +++ FII+V+ P++ KGTK+ +E  RTF+T+ AD++ RQ+L+M ++ + FRS L   A++LA  Q   R+R  S+ +    +Q F  +  ++   G+V + KRR+  Y SDY DG +G  T++K+FST  FLYF+CLLP+IAFGVLN +NT   I+V++VII+QAIGG+ F + GGQP+I++LTT PLA+Y K+IF IS E   DF AM+AC G+F  ++L++YS T++C LMK++T+S EE+F+ F+AIAFTV++ + ++  F ++Y   + +    K   +   +  N SN   I   ++       S+    S C RD S+LY+LL  GT+WL   L+NF KTPYL   +RE LAD+ALP ++ IMS  G+  F DI  D F   ++  + Q   V +LP  G+     C  LGF LS LFF+DQNI S++VN+  NKLKKG++ + DLF+VAL+N FLS+FGLPW+HGA+PHSPLH++AL+D+EER+  GH VH+ I+ VRETR+ S+++++ I +S+ FL+P PL  IP +VL GLF++MA+TSL  N+  ER+ LL TEQ AYPP+HY+R+VPQRK+HLFT  QL+QLI+L A GFSP P+++M FPIV    +PIRH +IP+ ID  +++A+D
Sbjct:   30 LMYAKHEKIPMKDFGSEIRATMDIDHLLNKAVLLLDLQETSLEEIFAKIIHEMDIQEPEFTSE--------QVRSVLFTQDA--GNQFHILSRTVQSICTTGSVGGSFDYDQTWICALCMLNTVQHRHVAIARLSHPTNLGRTMQDLRFIIIVIAPSRAKGTKTALETTRTFATLFADMEIRQRLVMAQSVEQFRSTLLSAAKELAMDQNQWRERKSSIHLSHAKEQIFGPEA-WYPFRGLVEEFKRRLAIYPSDYLDGIRGHKTVQKLFSTVVFLYFACLLPAIAFGVLNDDNTKGAINVRKVIIAQAIGGIFFSLFGGQPMIILLTTVPLAIYIKVIFKISQELGYDFLAMYACVGLFCQMFLILYSATELCSLMKFATRSAEEMFSLFIAIAFTVESIRAIHNSFKKNYNDCDTSAISMKAARTALNAFKNGSNADSIVGNITS----SMSIGDTGSLCRRDTSILYMLLMFGTLWLGLFLYNFRKTPYLTRSRREWLADYALPASVLIMSFTGSYAFSDIEKDRFNLRFEFPLIQMADVTSLPPSGY---FVCLLLGFSLSFLFFIDQNITSAIVNNNQNKLKKGTSHNLDLFVVALLNMFLSVFGLPWMHGALPHSPLHLRALADVEERVSQGH-VHEVIMNVRETRLASLIAHVMILVSMFFLIPYPLQLIPTSVLHGLFLYMALTSLSGNEMFERLLLLITEQQAYPPTHYIRKVPQRKVHLFTACQLLQLIILCAFGFSPYPFIEMVFPIVCFFFLPIRHTLIPRLIDYKYLDALD 794          
BLAST of slc4a-5 vs. Ensembl Celegans
Match: abts-3 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:A0A3B1E4W4])

HSP 1 Score: 659.448 bits (1700), Expect = 0.000e+0
Identity = 358/784 (45.66%), Postives = 534/784 (68.11%), Query Frame = 2
Query:  359 LVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERML--INILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMD--QSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKR--SVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEEN----KVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPF--YYDEKVFQFQPV-NLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSL-FLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L+ ++ EK+P+KDF SE+RA++DI+  + ++VL L++   S+EEI  +++  ++I E E T E        + ++ LF   +     +  L++T++ I    + G + D  Q+WI A+  L  +  RH+AIARLS P NLGR+ +++ FII+V+ P++ KGTK+ +E  RTF+T+ AD++ RQ+L+M ++ + FRS L   A++LA  Q   R+R  S+ +    +Q F  +  ++   G+V + KRR+  Y SDY DG +G  T++K+FST  FLYF+CLLP+IAFGVLN +NT   I+V++VII+QAIGG+ F + GGQP+I++LTT PLA+Y K+IF IS E   DF AM+AC G+F  ++L++YS T++C LMK++T+S EE+F+ F+AIAFTV++ + ++  F ++Y   + +    K   +   +  N SN   I   ++       S+    S C RD S+LY+LL  GT+WL   L+NF KTPYL   +RE LAD+ALP ++ IMS  G+  F DI  D F   ++  + Q   V +LP  G+     C  LGF LS LFF+DQNI S++VN+  NKLKKG++ + DLF+VAL+N FLS+FGLPW+HGA+PHSPLH++AL+D+EER+  GH VH+ I+ VRETR+ S+++++ I +S+ FL+P PL  IP +VL GLF++MA+TSL  N+  ER+ LL TEQ AYPP+HY+R+VPQRK+HLFT  QL+QLI+L A GFSP P+++M FPIV    +PIRH +IP+ ID  +++A+D
Sbjct:  276 LMYAKHEKIPMKDFGSEIRATMDIDHLLNKAVLLLDLQETSLEEIFAKIIHEMDIQEPEFTSE--------QVRSVLFTQDA--GNQFHILSRTVQSICTTGSVGGSFDYDQTWICALCMLNTVQHRHVAIARLSHPTNLGRTMQDLRFIIIVIAPSRAKGTKTALETTRTFATLFADMEIRQRLVMAQSVEQFRSTLLSAAKELAMDQNQWRERKSSIHLSHAKEQIFGPEA-WYPFRGLVEEFKRRLAIYPSDYLDGIRGHKTVQKLFSTVVFLYFACLLPAIAFGVLNDDNTKGAINVRKVIIAQAIGGIFFSLFGGQPMIILLTTVPLAIYIKVIFKISQELGYDFLAMYACVGLFCQMFLILYSATELCSLMKFATRSAEEMFSLFIAIAFTVESIRAIHNSFKKNYNDCDTSAISMKAARTALNAFKNGSNADSIVGNITS----SMSIGDTGSLCRRDTSILYMLLMFGTLWLGLFLYNFRKTPYLTRSRREWLADYALPASVLIMSFTGSYAFSDIEKDRFNLRFEFPLIQMADVTSLPPSGY---FVCLLLGFSLSFLFFIDQNITSAIVNNNQNKLKKGTSHNLDLFVVALLNMFLSVFGLPWMHGALPHSPLHLRALADVEERVSQGH-VHEVIMNVRETRLASLIAHVMILVSMFFLIPYPLQLIPTSVLHGLFLYMALTSLSGNEMFERLLLLITEQQAYPPTHYIRKVPQRKVHLFTACQLLQLIILCAFGFSPYPFIEMVFPIVCFFFLPIRHTLIPRLIDYKYLDALD 1040          
BLAST of slc4a-5 vs. Ensembl Celegans
Match: abts-3 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:A0A3B1E4W4])

HSP 1 Score: 659.062 bits (1699), Expect = 0.000e+0
Identity = 358/784 (45.66%), Postives = 533/784 (67.98%), Query Frame = 2
Query:  359 LVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERML--INILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEG--LAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKR--SVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEEN----KVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPF--YYDEKVFQFQPV-NLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSL-FLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L+ ++ EK+P+KDF SE+RA++DI+  + ++VL L++   S+EEI  +++  ++I E E T E        + ++ LF   +     +  L++T++ I    + G     DQ+WI A+  L  +  RH+AIARLS P NLGR+ +++ FII+V+ P++ KGTK+ +E  RTF+T+ AD++ RQ+L+M ++ + FRS L   A++LA  Q   R+R  S+ +    +Q F  +  ++   G+V + KRR+  Y SDY DG +G  T++K+FST  FLYF+CLLP+IAFGVLN +NT   I+V++VII+QAIGG+ F + GGQP+I++LTT PLA+Y K+IF IS E   DF AM+AC G+F  ++L++YS T++C LMK++T+S EE+F+ F+AIAFTV++ + ++  F ++Y   + +    K   +   +  N SN   I   ++       S+    S C RD S+LY+LL  GT+WL   L+NF KTPYL   +RE LAD+ALP ++ IMS  G+  F DI  D F   ++  + Q   V +LP  G+     C  LGF LS LFF+DQNI S++VN+  NKLKKG++ + DLF+VAL+N FLS+FGLPW+HGA+PHSPLH++AL+D+EER+  GH VH+ I+ VRETR+ S+++++ I +S+ FL+P PL  IP +VL GLF++MA+TSL  N+  ER+ LL TEQ AYPP+HY+R+VPQRK+HLFT  QL+QLI+L A GFSP P+++M FPIV    +PIRH +IP+ ID  +++A+D
Sbjct:  123 LMYAKHEKIPMKDFGSEIRATMDIDHLLNKAVLLLDLQETSLEEIFAKIIHEMDIQEPEFTSE--------QVRSVLFTQDA--GNQFHILSRTVQSICTTGSVGGSFDYDQTWICALCMLNTVQHRHVAIARLSHPTNLGRTMQDLRFIIIVIAPSRAKGTKTALETTRTFATLFADMEIRQRLVMAQSVEQFRSTLLSAAKELAMDQNQWRERKSSIHLSHAKEQIFGPEA-WYPFRGLVEEFKRRLAIYPSDYLDGIRGHKTVQKLFSTVVFLYFACLLPAIAFGVLNDDNTKGAINVRKVIIAQAIGGIFFSLFGGQPMIILLTTVPLAIYIKVIFKISQELGYDFLAMYACVGLFCQMFLILYSATELCSLMKFATRSAEEMFSLFIAIAFTVESIRAIHNSFKKNYNDCDTSAISMKAARTALNAFKNGSNADSIVGNITS----SMSIGDTGSLCRRDTSILYMLLMFGTLWLGLFLYNFRKTPYLTRSRREWLADYALPASVLIMSFTGSYAFSDIEKDRFNLRFEFPLIQMADVTSLPPSGY---FVCLLLGFSLSFLFFIDQNITSAIVNNNQNKLKKGTSHNLDLFVVALLNMFLSVFGLPWMHGALPHSPLHLRALADVEERVSQGH-VHEVIMNVRETRLASLIAHVMILVSMFFLIPYPLQLIPTSVLHGLFLYMALTSLSGNEMFERLLLLITEQQAYPPTHYIRKVPQRKVHLFTACQLLQLIILCAFGFSPYPFIEMVFPIVCFFFLPIRHTLIPRLIDYKYLDALD 887          
BLAST of slc4a-5 vs. Ensembl Fly
Match: CG8177 (gene:FBgn0036043 transcript:FBtr0076323)

HSP 1 Score: 211.846 bits (538), Expect = 3.882e-56
Identity = 165/571 (28.90%), Postives = 280/571 (49.04%), Query Frame = 2
Query: 1040 KFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSK---DVYKE--FAQHYQ------CAEENKVNNSIFKSLSNMS-NPFQITSTLS--PMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVF---QFQPVNLPILGWKAILSCAALGFPLS---------LLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDKS 2674
            + W  GG+  D+KRR+P Y SD  DG    NT  +  + T F+YF+CL  +I FG L    T+  I +   +IS ++ G+VF  L  QPL+++ TT PL L+ + +    T+++ DF ++    G++  +  +  S  +    ++  T+ T+E+F+  + + + V+       +Y+E      Y        A E+  N S+  + ++++ N  Q+   +S   MP     L K       + ++   +LT+ T  +A +L  F  + +L    R  L DF +P++I I  ++  L+       P  Y EK+       P +    GW      ++   P +         +L FM+  I+  +V+ P   LKKGS  HWD+ ++ L+N    IFG+PW   A   S  HV +++ +      G      IV V+E R++     + I LS+ + P  L  IP+AVL G+F++M V S+   Q  ERI L F     YPP+ Y++R+   KLHLFT  Q++ L++L ++    S    + FP  L++ +PIR  +   +  E  + A+D S
Sbjct:  663 RLW--GGLRNDLKRRMPMYKSDILDGL---NT--ETLAATIFMYFACLSTAITFGGLVSAKTNSWIGISETLISCSLVGIVFHCLSCQPLVIIGTTGPLLLFDEALMVFCTQHEFDFLSLRVYVGVWLIIIALTVSAFEGSVYVRLLTRFTQEIFSALITLIYIVETFMKLISIYRENPLLSDYNLPPPTLVAHEHATNESLLNATASVTTNITQMVMNISTTAMPIGPPPLPKNQP----NTALFCTILTLATFVVAYYLKLFRNSHFLGRNARRALGDFGVPISIAIFVLVDYLV-------PAVYTEKLVVPEGLSPSDPSKRGWYIGFDTSSTWIPFACVIPALLVYILIFMESQISELIVDKPDRGLKKGSGLHWDIVLLCLLNCACGIFGMPWHCAATVRSVTHVSSVTIMSRTHAPGESPR--IVDVKEQRLSGFFVCLMIGLSVLMAPL-LRLIPMAVLFGVFLYMGVASMSGVQLFERIRLYFMPVKHYPPTSYVKRLRPWKLHLFTTIQVLCLVLLWSVK---SSQFSLAFPFFLIMMVPIRQNLTKLYKPE-EMQALDGS 1208          
BLAST of slc4a-5 vs. Ensembl Fly
Match: CG8177 (gene:FBgn0036043 transcript:FBtr0076322)

HSP 1 Score: 211.46 bits (537), Expect = 4.049e-56
Identity = 165/572 (28.85%), Postives = 280/572 (48.95%), Query Frame = 2
Query: 1040 KFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSK---DVYKE--FAQHYQ------CAEENKVNNSIFKSLSNMS-NPFQITSTLS--PMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVF---QFQPVNLPILGWKAILSCAALGFPLS---------LLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDKSS 2677
            + W  GG+  D+KRR+P Y SD  DG    NT  +  + T F+YF+CL  +I FG L    T+  I +   +IS ++ G+VF  L  QPL+++ TT PL L+ + +    T+++ DF ++    G++  +  +  S  +    ++  T+ T+E+F+  + + + V+       +Y+E      Y        A E+  N S+  + ++++ N  Q+   +S   MP     L K       + ++   +LT+ T  +A +L  F  + +L    R  L DF +P++I I  ++  L+       P  Y EK+       P +    GW      ++   P +         +L FM+  I+  +V+ P   LKKGS  HWD+ ++ L+N    IFG+PW   A   S  HV +++ +      G      IV V+E R++     + I LS+ + P  L  IP+AVL G+F++M V S+   Q  ERI L F     YPP+ Y++R+   KLHLFT  Q++ L++L ++    S    + FP  L++ +PIR  +   +  E  + A+D S 
Sbjct:  596 RLW--GGLRNDLKRRMPMYKSDILDGL---NT--ETLAATIFMYFACLSTAITFGGLVSAKTNSWIGISETLISCSLVGIVFHCLSCQPLVIIGTTGPLLLFDEALMVFCTQHEFDFLSLRVYVGVWLIIIALTVSAFEGSVYVRLLTRFTQEIFSALITLIYIVETFMKLISIYRENPLLSDYNLPPPTLVAHEHATNESLLNATASVTTNITQMVMNISTTAMPIGPPPLPKNQP----NTALFCTILTLATFVVAYYLKLFRNSHFLGRNARRALGDFGVPISIAIFVLVDYLV-------PAVYTEKLVVPEGLSPSDPSKRGWYIGFDTSSTWIPFACVIPALLVYILIFMESQISELIVDKPDRGLKKGSGLHWDIVLLCLLNCACGIFGMPWHCAATVRSVTHVSSVTIMSRTHAPGESPR--IVDVKEQRLSGFFVCLMIGLSVLMAPL-LRLIPMAVLFGVFLYMGVASMSGVQLFERIRLYFMPVKHYPPTSYVKRLRPWKLHLFTTIQVLCLVLLWSVK---SSQFSLAFPFFLIMMVPIRQNLTKLYKPE-EMQALDGSE 1142          
BLAST of slc4a-5 vs. Ensembl Fly
Match: CG8177 (gene:FBgn0036043 transcript:FBtr0076326)

HSP 1 Score: 211.46 bits (537), Expect = 4.361e-56
Identity = 165/572 (28.85%), Postives = 280/572 (48.95%), Query Frame = 2
Query: 1040 KFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSK---DVYKE--FAQHYQ------CAEENKVNNSIFKSLSNMS-NPFQITSTLS--PMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVF---QFQPVNLPILGWKAILSCAALGFPLS---------LLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDKSS 2677
            + W  GG+  D+KRR+P Y SD  DG    NT  +  + T F+YF+CL  +I FG L    T+  I +   +IS ++ G+VF  L  QPL+++ TT PL L+ + +    T+++ DF ++    G++  +  +  S  +    ++  T+ T+E+F+  + + + V+       +Y+E      Y        A E+  N S+  + ++++ N  Q+   +S   MP     L K       + ++   +LT+ T  +A +L  F  + +L    R  L DF +P++I I  ++  L+       P  Y EK+       P +    GW      ++   P +         +L FM+  I+  +V+ P   LKKGS  HWD+ ++ L+N    IFG+PW   A   S  HV +++ +      G      IV V+E R++     + I LS+ + P  L  IP+AVL G+F++M V S+   Q  ERI L F     YPP+ Y++R+   KLHLFT  Q++ L++L ++    S    + FP  L++ +PIR  +   +  E  + A+D S 
Sbjct:  601 RLW--GGLRNDLKRRMPMYKSDILDGL---NT--ETLAATIFMYFACLSTAITFGGLVSAKTNSWIGISETLISCSLVGIVFHCLSCQPLVIIGTTGPLLLFDEALMVFCTQHEFDFLSLRVYVGVWLIIIALTVSAFEGSVYVRLLTRFTQEIFSALITLIYIVETFMKLISIYRENPLLSDYNLPPPTLVAHEHATNESLLNATASVTTNITQMVMNISTTAMPIGPPPLPKNQP----NTALFCTILTLATFVVAYYLKLFRNSHFLGRNARRALGDFGVPISIAIFVLVDYLV-------PAVYTEKLVVPEGLSPSDPSKRGWYIGFDTSSTWIPFACVIPALLVYILIFMESQISELIVDKPDRGLKKGSGLHWDIVLLCLLNCACGIFGMPWHCAATVRSVTHVSSVTIMSRTHAPGESPR--IVDVKEQRLSGFFVCLMIGLSVLMAPL-LRLIPMAVLFGVFLYMGVASMSGVQLFERIRLYFMPVKHYPPTSYVKRLRPWKLHLFTTIQVLCLVLLWSVK---SSQFSLAFPFFLIMMVPIRQNLTKLYKPE-EMQALDGSE 1147          
BLAST of slc4a-5 vs. Ensembl Fly
Match: CG8177 (gene:FBgn0036043 transcript:FBtr0076327)

HSP 1 Score: 211.46 bits (537), Expect = 4.811e-56
Identity = 165/571 (28.90%), Postives = 280/571 (49.04%), Query Frame = 2
Query: 1040 KFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSK---DVYKE--FAQHYQ------CAEENKVNNSIFKSLSNMS-NPFQITSTLS--PMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVF---QFQPVNLPILGWKAILSCAALGFPLS---------LLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDKS 2674
            + W  GG+  D+KRR+P Y SD  DG    NT  +  + T F+YF+CL  +I FG L    T+  I +   +IS ++ G+VF  L  QPL+++ TT PL L+ + +    T+++ DF ++    G++  +  +  S  +    ++  T+ T+E+F+  + + + V+       +Y+E      Y        A E+  N S+  + ++++ N  Q+   +S   MP     L K       + ++   +LT+ T  +A +L  F  + +L    R  L DF +P++I I  ++  L+       P  Y EK+       P +    GW      ++   P +         +L FM+  I+  +V+ P   LKKGS  HWD+ ++ L+N    IFG+PW   A   S  HV +++ +      G      IV V+E R++     + I LS+ + P  L  IP+AVL G+F++M V S+   Q  ERI L F     YPP+ Y++R+   KLHLFT  Q++ L++L ++    S    + FP  L++ +PIR  +   +  E  + A+D S
Sbjct:  668 RLW--GGLRNDLKRRMPMYKSDILDGL---NT--ETLAATIFMYFACLSTAITFGGLVSAKTNSWIGISETLISCSLVGIVFHCLSCQPLVIIGTTGPLLLFDEALMVFCTQHEFDFLSLRVYVGVWLIIIALTVSAFEGSVYVRLLTRFTQEIFSALITLIYIVETFMKLISIYRENPLLSDYNLPPPTLVAHEHATNESLLNATASVTTNITQMVMNISTTAMPIGPPPLPKNQP----NTALFCTILTLATFVVAYYLKLFRNSHFLGRNARRALGDFGVPISIAIFVLVDYLV-------PAVYTEKLVVPEGLSPSDPSKRGWYIGFDTSSTWIPFACVIPALLVYILIFMESQISELIVDKPDRGLKKGSGLHWDIVLLCLLNCACGIFGMPWHCAATVRSVTHVSSVTIMSRTHAPGESPR--IVDVKEQRLSGFFVCLMIGLSVLMAPL-LRLIPMAVLFGVFLYMGVASMSGVQLFERIRLYFMPVKHYPPTSYVKRLRPWKLHLFTTIQVLCLVLLWSVK---SSQFSLAFPFFLIMMVPIRQNLTKLYKPE-EMQALDGS 1213          
BLAST of slc4a-5 vs. Ensembl Fly
Match: CG8177 (gene:FBgn0036043 transcript:FBtr0331848)

HSP 1 Score: 211.46 bits (537), Expect = 5.592e-56
Identity = 165/572 (28.85%), Postives = 280/572 (48.95%), Query Frame = 2
Query: 1040 KFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSK---DVYKE--FAQHYQ------CAEENKVNNSIFKSLSNMS-NPFQITSTLS--PMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVF---QFQPVNLPILGWKAILSCAALGFPLS---------LLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDKSS 2677
            + W  GG+  D+KRR+P Y SD  DG    NT  +  + T F+YF+CL  +I FG L    T+  I +   +IS ++ G+VF  L  QPL+++ TT PL L+ + +    T+++ DF ++    G++  +  +  S  +    ++  T+ T+E+F+  + + + V+       +Y+E      Y        A E+  N S+  + ++++ N  Q+   +S   MP     L K       + ++   +LT+ T  +A +L  F  + +L    R  L DF +P++I I  ++  L+       P  Y EK+       P +    GW      ++   P +         +L FM+  I+  +V+ P   LKKGS  HWD+ ++ L+N    IFG+PW   A   S  HV +++ +      G      IV V+E R++     + I LS+ + P  L  IP+AVL G+F++M V S+   Q  ERI L F     YPP+ Y++R+   KLHLFT  Q++ L++L ++    S    + FP  L++ +PIR  +   +  E  + A+D S 
Sbjct:  645 RLW--GGLRNDLKRRMPMYKSDILDGL---NT--ETLAATIFMYFACLSTAITFGGLVSAKTNSWIGISETLISCSLVGIVFHCLSCQPLVIIGTTGPLLLFDEALMVFCTQHEFDFLSLRVYVGVWLIIIALTVSAFEGSVYVRLLTRFTQEIFSALITLIYIVETFMKLISIYRENPLLSDYNLPPPTLVAHEHATNESLLNATASVTTNITQMVMNISTTAMPIGPPPLPKNQP----NTALFCTILTLATFVVAYYLKLFRNSHFLGRNARRALGDFGVPISIAIFVLVDYLV-------PAVYTEKLVVPEGLSPSDPSKRGWYIGFDTSSTWIPFACVIPALLVYILIFMESQISELIVDKPDRGLKKGSGLHWDIVLLCLLNCACGIFGMPWHCAATVRSVTHVSSVTIMSRTHAPGESPR--IVDVKEQRLSGFFVCLMIGLSVLMAPL-LRLIPMAVLFGVFLYMGVASMSGVQLFERIRLYFMPVKHYPPTSYVKRLRPWKLHLFTTIQVLCLVLLWSVK---SSQFSLAFPFFLIMMVPIRQNLTKLYKPE-EMQALDGSE 1191          
BLAST of slc4a-5 vs. Ensembl Zebrafish
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 526.554 bits (1355), Expect = 1.322e-174
Identity = 302/771 (39.17%), Postives = 480/771 (62.26%), Query Frame = 2
Query:  389 LKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQL-AETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTS-FLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQC--------AEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEK-VFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L +F  EVRA  D++ F++ + + L     S++++++ ML ++ +   T E       +E  + LF        +   L++T++ ++   T G+   QSW+  +  + NL +RH+ I+RL  P N G +   V ++IL+L P+K K TK+ +ELGRTF+++ +DI FRQ+LL  + +++F+  L  Q   L A  +K       + D    +    +  F +G GI  D+ RR+P Y SD+ DG  G N     F TTS FLY + LLP+IAFG LN  +T  +IDV++ II Q+IGG+++ +  G PL++ LTTAP+A++  +I  I  +Y++DF+A +AC G++N+++L++  + ++  L+K   +S EEV A F++IAF  DA K   K F  +Y          AE N+++ S+     N +    +            SL +    C R   +L LLL +GT+W+   L+ F ++P+L+ + RE+L+D ALP+++ + S +G+ +F DI L  F + E  VFQ  P++   L   ++LS   LGF L LL F+DQNI  S+ N+P N+L KG+ +HWDL +  LIN  +S+ GLPW+H A PHS LHV+ L+ +EER++ GH +++TIV V+ETRVTS+++NI I +S+FLLP PL +IP  VL GLF+++A+TS+  NQ C+R+ LL  EQ++YPP+HY+R+VPQRK+H FTF Q++QL+ L A G  P PYMKM FP+++ + IPIR+ ++P+ I+  +++ MD
Sbjct:   26 LMNFEEEVRAHRDLDGFLERASILLHEDEASLDDVLKTMLRHVSQDPHTAEPGCNF--EEIMSSLFTDAGSQEVNVHLLSETLQCVTATAT-GIQYQQSWLCILCNVKNLQRRHVCISRLDRPQNWGENCAEVRYVILILAPSKMKSTKTAMELGRTFASMFSDISFRQKLLESKTQEEFKEALVIQRYHLTAAKRKTTAVEGEETDPHSQKPLKCRDFFRVGRGIYEDLCRRLPLYPSDFTDGLVGNNKALVKFMTTSIFLYIAVLLPAIAFGSLNDESTRGEIDVQKTIIGQSIGGIIYSLCAGSPLVIPLTTAPIAIFISVIRGICDDYELDFAAFYACIGLWNSLFLIMGGVFNLSLLVKLFKRSIEEVIALFISIAFVADAVKGTVKIFHDNYHAPTLANGSAAELNRISGSVHLGELNQTEAGPV------------SLPESFILCTRARPLLCLLLMMGTLWVGYTLYQFRRSPFLHVKMREILSDCALPISVLVFSYVGSYVFNDIALPVFNFHEGPVFQVAPLDK--LTGASVLSAMGLGFLLFLLIFIDQNIVVSLTNAPENRLLKGTAYHWDLTLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAIVEERVEGGH-LYETIVSVKETRVTSLVANILIGVSVFLLPVPLQWIPKPVLYGLFLYIALTSIEGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMVQLLFLCAFGMYPLPYMKMIFPLLMFILIPIRNCLLPRIIEAKYLDIMD 778          
BLAST of slc4a-5 vs. Ensembl Zebrafish
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 526.554 bits (1355), Expect = 1.322e-174
Identity = 302/771 (39.17%), Postives = 480/771 (62.26%), Query Frame = 2
Query:  389 LKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQL-AETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTS-FLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQC--------AEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEK-VFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L +F  EVRA  D++ F++ + + L     S++++++ ML ++ +   T E       +E  + LF        +   L++T++ ++   T G+   QSW+  +  + NL +RH+ I+RL  P N G +   V ++IL+L P+K K TK+ +ELGRTF+++ +DI FRQ+LL  + +++F+  L  Q   L A  +K       + D    +    +  F +G GI  D+ RR+P Y SD+ DG  G N     F TTS FLY + LLP+IAFG LN  +T  +IDV++ II Q+IGG+++ +  G PL++ LTTAP+A++  +I  I  +Y++DF+A +AC G++N+++L++  + ++  L+K   +S EEV A F++IAF  DA K   K F  +Y          AE N+++ S+     N +    +            SL +    C R   +L LLL +GT+W+   L+ F ++P+L+ + RE+L+D ALP+++ + S +G+ +F DI L  F + E  VFQ  P++   L   ++LS   LGF L LL F+DQNI  S+ N+P N+L KG+ +HWDL +  LIN  +S+ GLPW+H A PHS LHV+ L+ +EER++ GH +++TIV V+ETRVTS+++NI I +S+FLLP PL +IP  VL GLF+++A+TS+  NQ C+R+ LL  EQ++YPP+HY+R+VPQRK+H FTF Q++QL+ L A G  P PYMKM FP+++ + IPIR+ ++P+ I+  +++ MD
Sbjct:   26 LMNFEEEVRAHRDLDGFLERASILLHEDEASLDDVLKTMLRHVSQDPHTAEPGCNF--EEIMSSLFTDAGSQEVNVHLLSETLQCVTATAT-GIQYQQSWLCILCNVKNLQRRHVCISRLDRPQNWGENCAEVRYVILILAPSKMKSTKTAMELGRTFASMFSDISFRQKLLESKTQEEFKEALVIQRYHLTAAKRKTTAVEGEETDPHSQKPLKCRDFFRVGRGIYEDLCRRLPLYPSDFTDGLVGNNKALVKFMTTSIFLYIAVLLPAIAFGSLNDESTRGEIDVQKTIIGQSIGGIIYSLCAGSPLVIPLTTAPIAIFISVIRGICDDYELDFAAFYACIGLWNSLFLIMGGVFNLSLLVKLFKRSIEEVIALFISIAFVADAVKGTVKIFHDNYHAPTLANGSAAELNRISGSVHLGELNQTEAGPV------------SLPESFILCTRARPLLCLLLMMGTLWVGYTLYQFRRSPFLHVKMREILSDCALPISVLVFSYVGSYVFNDIALPVFNFHEGPVFQVAPLDK--LTGASVLSAMGLGFLLFLLIFIDQNIVVSLTNAPENRLLKGTAYHWDLTLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAIVEERVEGGH-LYETIVSVKETRVTSLVANILIGVSVFLLPVPLQWIPKPVLYGLFLYIALTSIEGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMVQLLFLCAFGMYPLPYMKMIFPLLMFILIPIRNCLLPRIIEAKYLDIMD 778          
BLAST of slc4a-5 vs. Ensembl Zebrafish
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 525.783 bits (1353), Expect = 7.750e-174
Identity = 302/771 (39.17%), Postives = 480/771 (62.26%), Query Frame = 2
Query:  389 LKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQL-AETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTS-FLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQC--------AEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEK-VFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L +F  EVRA  D++ F++ + + L     S++++++ ML ++ +   T E       +E  + LF        +   L++T++ ++   T G+   QSW+  +  + NL +RH+ I+RL  P N G +   V ++IL+L P+K K TK+ +ELGRTF+++ +DI FRQ+LL  + +++F+  L  Q   L A  +K       + D    +    +  F +G GI  D+ RR+P Y SD+ DG  G N     F TTS FLY + LLP+IAFG LN  +T  +IDV++ II Q+IGG+++ +  G PL++ LTTAP+A++  +I  I  +Y++DF+A +AC G++N+++L++  + ++  L+K   +S EEV A F++IAF  DA K   K F  +Y          AE N+++ S+     N +    +            SL +    C R   +L LLL +GT+W+   L+ F ++P+L+ + RE+L+D ALP+++ + S +G+ +F DI L  F + E  VFQ  P++   L   ++LS   LGF L LL F+DQNI  S+ N+P N+L KG+ +HWDL +  LIN  +S+ GLPW+H A PHS LHV+ L+ +EER++ GH +++TIV V+ETRVTS+++NI I +S+FLLP PL +IP  VL GLF+++A+TS+  NQ C+R+ LL  EQ++YPP+HY+R+VPQRK+H FTF Q++QL+ L A G  P PYMKM FP+++ + IPIR+ ++P+ I+  +++ MD
Sbjct:   62 LMNFEEEVRAHRDLDGFLERASILLHEDEASLDDVLKTMLRHVSQDPHTAEPGCNF--EEIMSSLFTDAGSQEVNVHLLSETLQCVTATAT-GIQYQQSWLCILCNVKNLQRRHVCISRLDRPQNWGENCAEVRYVILILAPSKMKSTKTAMELGRTFASMFSDISFRQKLLESKTQEEFKEALVIQRYHLTAAKRKTTAVEGEETDPHSQKPLKCRDFFRVGRGIYEDLCRRLPLYPSDFTDGLVGNNKALVKFMTTSIFLYIAVLLPAIAFGSLNDESTRGEIDVQKTIIGQSIGGIIYSLCAGSPLVIPLTTAPIAIFISVIRGICDDYELDFAAFYACIGLWNSLFLIMGGVFNLSLLVKLFKRSIEEVIALFISIAFVADAVKGTVKIFHDNYHAPTLANGSAAELNRISGSVHLGELNQTEAGPV------------SLPESFILCTRARPLLCLLLMMGTLWVGYTLYQFRRSPFLHVKMREILSDCALPISVLVFSYVGSYVFNDIALPVFNFHEGPVFQVAPLDK--LTGASVLSAMGLGFLLFLLIFIDQNIVVSLTNAPENRLLKGTAYHWDLTLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAIVEERVEGGH-LYETIVSVKETRVTSLVANILIGVSVFLLPVPLQWIPKPVLYGLFLYIALTSIEGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMVQLLFLCAFGMYPLPYMKMIFPLLMFILIPIRNCLLPRIIEAKYLDIMD 814          
BLAST of slc4a-5 vs. Ensembl Zebrafish
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 525.783 bits (1353), Expect = 7.750e-174
Identity = 302/771 (39.17%), Postives = 480/771 (62.26%), Query Frame = 2
Query:  389 LKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQL-AETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTS-FLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQC--------AEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEK-VFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L +F  EVRA  D++ F++ + + L     S++++++ ML ++ +   T E       +E  + LF        +   L++T++ ++   T G+   QSW+  +  + NL +RH+ I+RL  P N G +   V ++IL+L P+K K TK+ +ELGRTF+++ +DI FRQ+LL  + +++F+  L  Q   L A  +K       + D    +    +  F +G GI  D+ RR+P Y SD+ DG  G N     F TTS FLY + LLP+IAFG LN  +T  +IDV++ II Q+IGG+++ +  G PL++ LTTAP+A++  +I  I  +Y++DF+A +AC G++N+++L++  + ++  L+K   +S EEV A F++IAF  DA K   K F  +Y          AE N+++ S+     N +    +            SL +    C R   +L LLL +GT+W+   L+ F ++P+L+ + RE+L+D ALP+++ + S +G+ +F DI L  F + E  VFQ  P++   L   ++LS   LGF L LL F+DQNI  S+ N+P N+L KG+ +HWDL +  LIN  +S+ GLPW+H A PHS LHV+ L+ +EER++ GH +++TIV V+ETRVTS+++NI I +S+FLLP PL +IP  VL GLF+++A+TS+  NQ C+R+ LL  EQ++YPP+HY+R+VPQRK+H FTF Q++QL+ L A G  P PYMKM FP+++ + IPIR+ ++P+ I+  +++ MD
Sbjct:   62 LMNFEEEVRAHRDLDGFLERASILLHEDEASLDDVLKTMLRHVSQDPHTAEPGCNF--EEIMSSLFTDAGSQEVNVHLLSETLQCVTATAT-GIQYQQSWLCILCNVKNLQRRHVCISRLDRPQNWGENCAEVRYVILILAPSKMKSTKTAMELGRTFASMFSDISFRQKLLESKTQEEFKEALVIQRYHLTAAKRKTTAVEGEETDPHSQKPLKCRDFFRVGRGIYEDLCRRLPLYPSDFTDGLVGNNKALVKFMTTSIFLYIAVLLPAIAFGSLNDESTRGEIDVQKTIIGQSIGGIIYSLCAGSPLVIPLTTAPIAIFISVIRGICDDYELDFAAFYACIGLWNSLFLIMGGVFNLSLLVKLFKRSIEEVIALFISIAFVADAVKGTVKIFHDNYHAPTLANGSAAELNRISGSVHLGELNQTEAGPV------------SLPESFILCTRARPLLCLLLMMGTLWVGYTLYQFRRSPFLHVKMREILSDCALPISVLVFSYVGSYVFNDIALPVFNFHEGPVFQVAPLDK--LTGASVLSAMGLGFLLFLLIFIDQNIVVSLTNAPENRLLKGTAYHWDLTLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAIVEERVEGGH-LYETIVSVKETRVTSLVANILIGVSVFLLPVPLQWIPKPVLYGLFLYIALTSIEGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMVQLLFLCAFGMYPLPYMKMIFPLLMFILIPIRNCLLPRIIEAKYLDIMD 814          
BLAST of slc4a-5 vs. Ensembl Zebrafish
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 526.554 bits (1355), Expect = 9.630e-174
Identity = 301/771 (39.04%), Postives = 481/771 (62.39%), Query Frame = 2
Query:  389 LKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQL-AETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTS-FLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQC--------AEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPF-YYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L +F  EVRA  D++ F++ + + L     S++++++ ML ++ +   T E       +E  + LF        +   L++T++ ++   T G+   QSW+  +  + NL +RH+ I+RL  P N G +   V ++IL+L P+K K TK+ +ELGRTF+++ +DI FRQ+LL  + +++F+  L  Q   L A  +K       + D    +    +  F +G GI  D+ RR+P Y SD+ DG  G N     F TTS FLY + LLP+IAFG LN  +T  +IDV++ II Q+IGG+++ +  G PL++ LTTAP+A++  +I  I  +Y++DF+A +AC G++N+++L++  + ++  L+K   +S EEV A F++IAF  DA K   K F  +Y          AE N+++ S+     N +    +            SL +    C R   +L LLL +GT+W+   L+ F ++P+L+ + RE+L+D ALP+++ + S +G+ +F DI L  F +++  VFQ  P++   L   ++LS   LGF L LL F+DQNI  S+ N+P N+L KG+ +HWDL +  LIN  +S+ GLPW+H A PHS LHV+ L+ +EER++ GH +++TIV V+ETRVTS+++NI I +S+FLLP PL +IP  VL GLF+++A+TS+  NQ C+R+ LL  EQ++YPP+HY+R+VPQRK+H FTF Q++QL+ L A G  P PYMKM FP+++ + IPIR+ ++P+ I+  +++ MD
Sbjct:   90 LMNFEEEVRAHRDLDGFLERASILLHEDEASLDDVLKTMLRHVSQDPHTAEPGCNF--EEIMSSLFTDAGSQEVNVHLLSETLQCVTATAT-GIQYQQSWLCILCNVKNLQRRHVCISRLDRPQNWGENCAEVRYVILILAPSKMKSTKTAMELGRTFASMFSDISFRQKLLESKTQEEFKEALVIQRYHLTAAKRKTTAVEGEETDPHSQKPLKCRDFFRVGRGIYEDLCRRLPLYPSDFTDGLVGNNKALVKFMTTSIFLYIAVLLPAIAFGSLNDESTRGEIDVQKTIIGQSIGGIIYSLCAGSPLVIPLTTAPIAIFISVIRGICDDYELDFAAFYACIGLWNSLFLIMGGVFNLSLLVKLFKRSIEEVIALFISIAFVADAVKGTVKIFHDNYHAPTLANGSAAELNRISGSVHLGELNQTEAGPV------------SLPESFILCTRARPLLCLLLMMGTLWVGYTLYQFRRSPFLHVKMREILSDCALPISVLVFSYVGSYVFNDIALPVFNFHEGPVFQVAPLDK--LTGASVLSAMGLGFLLFLLIFIDQNIVVSLTNAPENRLLKGTAYHWDLTLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAIVEERVEGGH-LYETIVSVKETRVTSLVANILIGVSVFLLPVPLQWIPKPVLYGLFLYIALTSIEGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMVQLLFLCAFGMYPLPYMKMIFPLLMFILIPIRNCLLPRIIEAKYLDIMD 842          
BLAST of slc4a-5 vs. Ensembl Xenopus
Match: SLC4A11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:100486382])

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 324/791 (40.96%), Postives = 481/791 (60.81%), Query Frame = 2
Query:  383 LPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQR------LAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQAR---------QLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGAN-TIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHY---------QCAEENK-VNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYY--DEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHS-PLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L LK+F  EVRA  D++ F+ ++ + L+    S+++++  ML + +E     E S             M T F      R      L+ TI+G++   T G+   QSW+  + T+ +L KRH+ I+RL  P N G ++  V F+ILVL P K K TK+  E+GRTFST+ +DI+FRQ+LL  + E++F+  L  Q            L +  K+   + +K++E           F +G GI  DI RR+P Y  D+ DG  G N  I K  +T  FLYF+CLLPSIAFG LN  +T   IDV++ I+ Q IGG+++ +  GQPL+V+LTTAPLALY  +I  I  +Y +DF A +A TG++N+ +L++YSL +   LMK   +STEE+ A F++I F +DA K + K F ++Y            E NK + N  F S   +++ F  +         H  +H G     R+ +VL L+L  GT+WL   L+ F K+PYL++R RE+L+D ALP+++   S++G+  F++I++  F Y   E +F   P+    +G   I S   LGF LS+LFF++QNI +S+ N+P N+L KG+ +HWDL +VALIN  LS+FG+PWIH A  HS      A    +     GH +++TIV VRETR+TS+++N+ + LSLFLLP PL +IP  VL GLF+++A+TS+  +Q  ER+ LL  EQ+AYPP+HY+RRVPQRK+H FT  Q++QL++L   G SP PYMKM FP++++  IPIR+ ++PK I+  +++AMD
Sbjct:  100 LKLKNFEEEVRAHRDLDGFLAKASIILDETATSLDDVLREMLKHFVEDPENAEPSCNF-------NKIMSTLFTDSGAPREGNVHLLSDTIQGVTATAT-GVQYQQSWLCIICTIKSLQKRHVCISRLERPQNWGENSCEVRFVILVLAPPKMKSTKTATEVGRTFSTMFSDINFRQKLLETKTEEEFKEALVHQRHLLTLVNKHSSLNDGHKVQSHKPLKLNEF----------FNVGKGIFDDIARRLPVYPLDFTDGIIGNNKAIGKYITTMIFLYFACLLPSIAFGSLNDESTAGVIDVQKTIVGQCIGGVIYSLFSGQPLVVLLTTAPLALYINVIRGICDDYNLDFKAFYAWTGLWNSCFLILYSLFNCSLLMKLFKRSTEEIIALFISITFVLDALKGIIKIFKKYYLEIPSSHTYPDQEYNKHLPNLNFTSDVLLNSTFNGSVFAPNGSSDHEEIHYG-----RESAVLSLMLMFGTLWLGHTLYQFKKSPYLHSRVREMLSDCALPISVLTFSVVGSYFFKEIHIAKFNYIKTESMFVLAPIGSLPMG--PITSAMGLGFLLSMLFFIEQNIVASLTNAPENRLVKGTAYHWDLLLVALINTGLSVFGMPWIHAAFLHSHNARAGARQSWKREWSTGH-IYETIVSVRETRLTSLVANVLVGLSLFLLPYPLQWIPKPVLYGLFLYIALTSIDGSQLFERVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLVILCGFGMSPLPYMKMIFPLIMIGMIPIRYNLLPKIIESKYLDAMD 864          
BLAST of slc4a-5 vs. Ensembl Xenopus
Match: SLC4A11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:100486382])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 324/791 (40.96%), Postives = 481/791 (60.81%), Query Frame = 2
Query:  383 LPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQR------LAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQAR---------QLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGAN-TIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHY---------QCAEENK-VNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYY--DEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHS-PLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L LK+F  EVRA  D++ F+ ++ + L+    S+++++  ML + +E     E S             M T F      R      L+ TI+G++   T G+   QSW+  + T+ +L KRH+ I+RL  P N G ++  V F+ILVL P K K TK+  E+GRTFST+ +DI+FRQ+LL  + E++F+  L  Q            L +  K+   + +K++E           F +G GI  DI RR+P Y  D+ DG  G N  I K  +T  FLYF+CLLPSIAFG LN  +T   IDV++ I+ Q IGG+++ +  GQPL+V+LTTAPLALY  +I  I  +Y +DF A +A TG++N+ +L++YSL +   LMK   +STEE+ A F++I F +DA K + K F ++Y            E NK + N  F S   +++ F  +         H  +H G     R+ +VL L+L  GT+WL   L+ F K+PYL++R RE+L+D ALP+++   S++G+  F++I++  F Y   E +F   P+    +G   I S   LGF LS+LFF++QNI +S+ N+P N+L KG+ +HWDL +VALIN  LS+FG+PWIH A  HS      A    +     GH +++TIV VRETR+TS+++N+ + LSLFLLP PL +IP  VL GLF+++A+TS+  +Q  ER+ LL  EQ+AYPP+HY+RRVPQRK+H FT  Q++QL++L   G SP PYMKM FP++++  IPIR+ ++PK I+  +++AMD
Sbjct:   97 LKLKNFEEEVRAHRDLDGFLAKASIILDETATSLDDVLREMLKHFVEDPENAEPSCNF-------NKIMSTLFTDSGAPREGNVHLLSDTIQGVTATAT-GVQYQQSWLCIICTIKSLQKRHVCISRLERPQNWGENSCEVRFVILVLAPPKMKSTKTATEVGRTFSTMFSDINFRQKLLETKTEEEFKEALVHQRHLLTLVNKHSSLNDGHKVQSHKPLKLNEF----------FNVGKGIFDDIARRLPVYPLDFTDGIIGNNKAIGKYITTMIFLYFACLLPSIAFGSLNDESTAGVIDVQKTIVGQCIGGVIYSLFSGQPLVVLLTTAPLALYINVIRGICDDYNLDFKAFYAWTGLWNSCFLILYSLFNCSLLMKLFKRSTEEIIALFISITFVLDALKGIIKIFKKYYLEIPSSHTYPDQEYNKHLPNLNFTSDVLLNSTFNGSVFAPNGSSDHEEIHYG-----RESAVLSLMLMFGTLWLGHTLYQFKKSPYLHSRVREMLSDCALPISVLTFSVVGSYFFKEIHIAKFNYIKTESMFVLAPIGSLPMG--PITSAMGLGFLLSMLFFIEQNIVASLTNAPENRLVKGTAYHWDLLLVALINTGLSVFGMPWIHAAFLHSHNARAGARQSWKREWSTGH-IYETIVSVRETRLTSLVANVLVGLSLFLLPYPLQWIPKPVLYGLFLYIALTSIDGSQLFERVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLVILCGFGMSPLPYMKMIFPLIMIGMIPIRYNLLPKIIESKYLDAMD 861          
BLAST of slc4a-5 vs. Ensembl Xenopus
Match: SLC4A11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:100486382])

HSP 1 Score: 540.806 bits (1392), Expect = 7.045e-179
Identity = 318/781 (40.72%), Postives = 472/781 (60.44%), Query Frame = 2
Query:  368 SRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQR------LAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQAR---------QLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGAN-TIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHY---------QCAEENK-VNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYY--DEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHS-PLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHK 2623
            +++  L LK+F  EVRA  D++ F+ ++ + L+    S+++++  ML + +E     E S             M T F      R      L+ TI+G++   T G+   QSW+  + T+ +L KRH+ I+RL  P N G ++  V F+ILVL P K K TK+  E+GRTFST+ +DI+FRQ+LL  + E++F+  L  Q            L +  K+   + +KV         +   F +G GI  DI RR+P Y  D+ DG  G N  I K  +T  FLYF+CLLPSIAFG LN  +T   IDV++ I+ Q IGG+++ +  GQPL+V+LTTAPLALY  +I  I  +Y +DF A +A TG++N+ +L++YSL +   LMK   +STEE+ A F++I F +DA K + K F ++Y            E NK + N  F S   +++ F  +         H  +H G     R+ +VL L+L  GT+WL   L+ F K+PYL++R RE+L+D ALP+++   S++G+  F++I++  F Y   E +F   P+    +G   I S   LGF LS+LFF++QNI +S+ N+P N+L KG+ +HWDL +VALIN  LS+FG+PWIH A  HS      A    +     GH +++TIV VRETR+TS+++N+ + LSLFLLP PL +IP  VL GLF+++A+TS+  +Q  ER+ LL  EQ+AYPP+HY+RRVPQRK+H FT  Q++QL++L   G SP PYMKM FP++++  IPIR++
Sbjct:   86 TQITYLKLKNFEEEVRAHRDLDGFLAKASIILDETATSLDDVLREMLKHFVEDPENAEPSCNF-------NKIMSTLFTDSGAPREGNVHLLSDTIQGVTATAT-GVQYQQSWLCIICTIKSLQKRHVCISRLERPQNWGENSCEVRFVILVLAPPKMKSTKTATEVGRTFSTMFSDINFRQKLLETKTEEEFKEALVHQRHLLTLVNKHSSLNDGHKVQSHKPLKVRG--SSPPKLNEFFNVGKGIFDDIARRLPVYPLDFTDGIIGNNKAIGKYITTMIFLYFACLLPSIAFGSLNDESTAGVIDVQKTIVGQCIGGVIYSLFSGQPLVVLLTTAPLALYINVIRGICDDYNLDFKAFYAWTGLWNSCFLILYSLFNCSLLMKLFKRSTEEIIALFISITFVLDALKGIIKIFKKYYLEIPSSHTYPDQEYNKHLPNLNFTSDVLLNSTFNGSVFAPNGSSDHEEIHYG-----RESAVLSLMLMFGTLWLGHTLYQFKKSPYLHSRVREMLSDCALPISVLTFSVVGSYFFKEIHIAKFNYIKTESMFVLAPIGSLPMG--PITSAMGLGFLLSMLFFIEQNIVASLTNAPENRLVKGTAYHWDLLLVALINTGLSVFGMPWIHAAFLHSHNARAGARQSWKREWSTGH-IYETIVSVRETRLTSLVANVLVGLSLFLLPYPLQWIPKPVLYGLFLYIALTSIDGSQLFERVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLVILCGFGMSPLPYMKMIFPLIMIGMIPIRYR 848          
BLAST of slc4a-5 vs. Ensembl Xenopus
Match: SLC4A11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:100486382])

HSP 1 Score: 528.865 bits (1361), Expect = 7.650e-176
Identity = 309/765 (40.39%), Postives = 461/765 (60.26%), Query Frame = 2
Query:  383 LPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQR------LAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQAR---------QLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGAN-TIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPV-NLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHS-PLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHK 2623
            L LK+F  EVRA  D++ F+ ++ + L+    S+++++  ML + +E     E S             M T F      R      L+ TI+G++   T G+   QSW+  + T+ +L KRH+ I+RL  P N G ++  V F+ILVL P K K TK+  E+GRTFST+ +DI+FRQ+LL  + E++F+  L  Q            L +  K+   + +K++E  +          +G GI  DI RR+P Y  D+ DG  G N  I K  +T  FLYF+CLLPSIAFG LN  +T   IDV++ I+ Q IGG+++ +  GQPL+V+LTTAPLALY  +I  I  +Y +DF A +A TG++N+ +L++YSL +   LMK   +STEE+ A F++I F +DA K + K  + +Y   + N     ++K L                   +  +H G     R+ +VL L+L  GT+WL   L+ F K+PYL++R RE+L+D ALP+++   S++G+  F++I+         +F   P+ +LP+     I S   LGF LS+LFF++QNI +S+ N+P N+L KG+ +HWDL +VALIN  LS+FG+PWIH A  HS      A    +     GH +++TIV VRETR+TS+++N+ + LSLFLLP PL +IP  VL GLF+++A+TS+  +Q  ER+ LL  EQ+AYPP+HY+RRVPQRK+H FT  Q++QL++L   G SP PYMKM FP++++  IPIR++
Sbjct:   19 LKLKNFEEEVRAHRDLDGFLAKASIILDETATSLDDVLREMLKHFVEDPENAEPSCNF-------NKIMSTLFTDSGAPREGNVHLLSDTIQGVTATAT-GVQYQQSWLCIICTIKSLQKRHVCISRLERPQNWGENSCEVRFVILVLAPPKMKSTKTATEVGRTFSTMFSDINFRQKLLETKTEEEFKEALVHQRHLLTLVNKHSSLNDGHKVQSHKPLKLNEFFN----------VGKGIFDDIARRLPVYPLDFTDGIIGNNKAIGKYITTMIFLYFACLLPSIAFGSLNDESTAGVIDVQKTIVGQCIGGVIYSLFSGQPLVVLLTTAPLALYINVIRGICDDYNLDFKAFYAWTGLWNSCFLILYSLFNCSLLMKLFKRSTEEIIALFISITFVLDALKGIIKSKSIYY--PQTNSNMRLVWKELLG-----------------YTEIHYG-----RESAVLSLMLMFGTLWLGHTLYQFKKSPYLHSRVREMLSDCALPISVLTFSVVGSYFFKEIHSKL----PDMFVLAPIGSLPM---GPITSAMGLGFLLSMLFFIEQNIVASLTNAPENRLVKGTAYHWDLLLVALINTGLSVFGMPWIHAAFLHSHNARAGARQSWKREWSTGH-IYETIVSVRETRLTSLVANVLVGLSLFLLPYPLQWIPKPVLYGLFLYIALTSIDGSQLFERVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLVILCGFGMSPLPYMKMIFPLIMIGMIPIRYR 733          
BLAST of slc4a-5 vs. Ensembl Xenopus
Match: SLC4A11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:100486382])

HSP 1 Score: 517.694 bits (1332), Expect = 1.199e-171
Identity = 304/766 (39.69%), Postives = 450/766 (58.75%), Query Frame = 2
Query:  383 LPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQR------LAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQAR---------QLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGAN-TIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENK-VNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCA-ALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHS-PLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHK 2623
            L LK+F  EVRA  D++ F+ ++ + L+    S+++++  ML + +E     E S             M T F      R      L+ TI+G++   T G+   QSW+  + T+ +L KRH+ I+RL  P N G ++  V F+ILVL P K K TK+  E+GRTFST+ +DI+FRQ+LL  + E++F+  L  Q            L +  K+   + +K++E           F +G GI  DI RR+P Y  D+ DG  G N  I K  +T  FLYF+CLLPSIAFG LN  +T   IDV++ I+ Q IGG+++ +  GQPL+V+LTTAPLALY  +I  I  +Y +DF A +A TG++N+ +L++YSL +   LMK                         ++K  +  Y   E NK + N  F S   +++ F  +         H  +H G     R+ +VL L+L  GT+WL   L+ F K+PYL++R RE+L+D ALP+++   S++G+  F++I+        K+ +   + LP  G      CA  LGF LS+LFF++QNI +S+ N+P N+L KG+ +HWDL +VALIN  LS+FG+PWIH A  HS      A    +     GH +++TIV VRETR+TS+++N+ + LSLFLLP PL +IP  VL GLF+++A+TS+  +Q  ER+ LL  EQ+AYPP+HY+RRVPQRK+H FT  Q++QL++L   G SP PYMKM FP++++  IPIR++
Sbjct:   19 LKLKNFEEEVRAHRDLDGFLAKASIILDETATSLDDVLREMLKHFVEDPENAEPSCNF-------NKIMSTLFTDSGAPREGNVHLLSDTIQGVTATAT-GVQYQQSWLCIICTIKSLQKRHVCISRLERPQNWGENSCEVRFVILVLAPPKMKSTKTATEVGRTFSTMFSDINFRQKLLETKTEEEFKEALVHQRHLLTLVNKHSSLNDGHKVQSHKPLKLNEF----------FNVGKGIFDDIARRLPVYPLDFTDGIIGNNKAIGKYITTMIFLYFACLLPSIAFGSLNDESTAGVIDVQKTIVGQCIGGVIYSLFSGQPLVVLLTTAPLALYINVIRGICDDYNLDFKAFYAWTGLWNSCFLILYSLFNCSLLMK-------------------------LFKS-SHTYPDQEYNKHLPNLNFTSDVLLNSTFNGSVFAPNGSSDHEEIHYG-----RESAVLSLMLMFGTLWLGHTLYQFKKSPYLHSRVREMLSDCALPISVLTFSVVGSYFFKEIH-------SKLPECCTLALPA-GKSVSPQCAMGLGFLLSMLFFIEQNIVASLTNAPENRLVKGTAYHWDLLLVALINTGLSVFGMPWIHAAFLHSHNARAGARQSWKREWSTGH-IYETIVSVRETRLTSLVANVLVGLSLFLLPYPLQWIPKPVLYGLFLYIALTSIDGSQLFERVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLVILCGFGMSPLPYMKMIFPLIMIGMIPIRYR 726          
BLAST of slc4a-5 vs. Ensembl Mouse
Match: Slc4a11 (solute carrier family 4, sodium bicarbonate transporter-like, member 11 [Source:MGI Symbol;Acc:MGI:2138987])

HSP 1 Score: 522.702 bits (1345), Expect = 4.824e-172
Identity = 323/789 (40.94%), Postives = 494/789 (62.61%), Query Frame = 2
Query:  383 LPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERML----INILECEITDEISLEMWIKEAKTKLFMHTSF-LTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKRSVKVDEVMD----QAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKG-ANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQ-----HYQCAEENKV----------NNSIFKSL--SNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L LK+F  EVRA  D++ F+ ++ + L     S+++++  ML    ++    E   ++ L M       KLF      +      L+ TI+G++     G+  +QSW+  + T+  L KRH+ I+RL  P N G ++  V F+ILVL P K K TK+ +E+ RTF+T+ +DI FRQ+LL    E++F+  L  Q RQL  T  + R     +  +      Q    K  F  G GI  DI RR P Y  D+ DG  G + ++ K  +TT FLYF+CLLP+IAFG LN  NT+  IDV++ I  Q+IGGL++ +  GQPL+++LTTAPLA+YT++I  I  +Y +DF+A +A TG++N+ +L +Y+  ++  LM    +STEE+ A F++I F +DA K + K F +     HY     + +          N+S+  +L  S +++P ++ +T SP      S H G +      +VL LL+ +GT+WL   L+ F K+PYL+   RE L+D ALP+A+   S+IG+  F++I +  F Y+     F+   +  L +KAI S   LGF LSLLFF++QN+ +++VN+P N+L KG+ +HWDL ++A+IN  LS+FGLPWIH A PHSPLHV+AL+ +EER++ GH +++TIV V+ETR+T++ +++ + LSL LLP PL +IP  VL GLF+++A+TSL  NQ   R+ LL  EQ++YPP+HY+RRVPQRK+H FT  Q++QL++L A G S  PYMKM FP++++  IPIR+ ++P+ I+  +++ MD
Sbjct:   89 LKLKNFEEEVRAHRDLDGFLAQASIILNETATSLDDVLRTMLNRFALDPNHAEPDCDLDLLM------AKLFTDAGAPMESKVHLLSDTIQGVTAT-VRGVQYEQSWLCIICTMKTLQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDITFRQKLLKTRTEEEFKEALVHQ-RQLL-TMMMPRAAGHSMSSLHTHRHPQPPKCKDFFPFGKGIWMDIMRRFPVYPMDFTDGIIGKSKSVGKYVTTTLFLYFACLLPTIAFGSLNDENTNGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLAIYTQVIRVICDDYNLDFNAFYAWTGLWNSFFLALYAFLNLSLLMNLFKRSTEEIIALFISITFVLDAVKGMVKIFGKYYYGHHYHTKRTSSLVSLLGIGRSPNSSLHTALNASLLASPVEMATTSSP-----GSTHSGQA-----TAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVRETLSDCALPIAVLSFSLIGSYGFQEIEMSKFRYNPSESLFEVAQIHSLSFKAIGSAMGLGFLLSLLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGH-IYETIVDVKETRLTALGASVLVGLSLLLLPFPLQWIPKPVLYGLFLYIALTSLDGNQLFSRVALLLKEQTSYPPTHYIRRVPQRKIHYFTGLQILQLLLLCAFGMSSLPYMKMVFPLIMIAMIPIRYNLLPRIIEAKYLDVMD 857          
BLAST of slc4a-5 vs. Ensembl Mouse
Match: Slc4a1 (solute carrier family 4 (anion exchanger), member 1 [Source:MGI Symbol;Acc:MGI:109393])

HSP 1 Score: 209.149 bits (531), Expect = 1.239e-55
Identity = 181/678 (26.70%), Postives = 318/678 (46.90%), Query Frame = 2
Query:  779 ENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDF-RSMLQF----------------QARQLAETQK-ILRKR----SVKVDEVM--------------DQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGAL--------LFRDINLDPFYYDEKVFQFQPVNLPIL--GWKAILSC--AALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            E V F++++L P  E       +LGR  +T+M +  FR    M  N ++  RS+  F                    L   QK +LR+R      K D  +              D+   ++    I GG++ DI+RR P+YLSD  D         +V +   F+YF+ L P++ FG L G  T   + V  ++IS A+ G++F +LG QPL+V+  + PL ++ +  F+      +++    A  G +  + +M+    +   L+++ ++ T+E+F+F +++ F       +Y+ F++  +  ++  +  +                 + P P       +G  P   + ++  L+L  GT  LA  L  F  + Y   + R ++ DF +P++I IM ++ +         L     L       + +   P+ L  L   W    S   A L F   +L F++  I + +V+ P  K+ KGS FH DL +V  + G  ++FG+PW+      S  H  AL+ + +    G      I  V+E R++ +L ++ + LS+ + P  LS IP+AVL G+F++M VTSL   Q  +RI LLF     +P   +++RV   ++HLFT  Q+I L +L  +  +P+    +  P VL+L +P+R  I+P    E+ +  +D
Sbjct:  273 EPVGFLLVLLGP--EAPHVDYTQLGRAAATLMTERVFRITASMAHNREELLRSLESFLDCSLVLPPTDAPSEKALLNLVPVQKELLRRRYLPSPAKPDPNLYNTLDLNGGKGGPGDEDDPLRRTGRIFGGLIRDIRRRYPYYLSDITDALS-----PQVLAAVIFIYFAALSPAVTFGGLLGEKTRNLMGVSELLISTAVQGILFALLGAQPLLVLGFSGPLLVFEEAFFSFCESNNLEYIVGRAWIGFWLILLVMLVVAFEGSFLVQYISRYTQEIFSFLISLIF-------IYETFSKLIKIFQDYPLQQTY------------APVVMKPKP-------QGPVP---NTALFSLVLMAGTFLLAMTLRKFKNSTYFPGKLRRVIGDFGVPISILIMVLVDSFIKGTYTQKLSVPDGLKVSNSSARGWVIHPLGLYRLFPTWMMFASVLPALLVF---ILIFLESQITTLIVSKPERKMIKGSGFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHANALTVMGKASGPGAAAQ--IQEVKEQRISGLLVSVLVGLSILMEPI-LSRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPFVKRVKTWRMHLFTGIQIICLAVLWVVKSTPA---SLALPFVLILTVPLRRLILPLIFRELELQCLD 905          
BLAST of slc4a-5 vs. Ensembl Mouse
Match: Slc4a4 (solute carrier family 4 (anion exchanger), member 4 [Source:MGI Symbol;Acc:MGI:1927555])

HSP 1 Score: 203.756 bits (517), Expect = 1.695e-53
Identity = 166/564 (29.43%), Postives = 273/564 (48.40%), Query Frame = 2
Query: 1055 GGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVN-NSIFKSLSNMSNPFQIT----STLSP--MPD------FHNS----LHKGHSPCHR--------------DVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVF---QFQPVN------LPILGWKAILSCAALGFP---LSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIR 2617
            GG++ DIKR+ P + SD+ D         +  S   F+Y + +  +I FG L G+ TD    V    +  A+ G +F +  GQPL ++ +T P+ ++ +++F  S ++  D+       G+++A   ++   TD   L+++ T+ TEE F+  ++  F  DA K + K  A +Y    + KV  N+ F       +P  ++    +TL+P  +P       +HN      +     C +              D++++  +L +GT   +  +  F  + Y     R+L++DFA+ L+I I  +I AL+  D          K+    +F+P +      +P  G      C A   P   +++L FMDQ I + +VN   +KLKKG+ +H DLF VA++    S   LPW   A   S  H+ +L    E    G +     + VRE RVT  L  I   LS+F+ P  L +IP+ VL G+F++M V SL   QF +R+ LL       P   YLR VP R++HLFTF Q++ L +L  L    S    + FP+++L  + +R
Sbjct:  435 GGLIKDIKRKAPFFASDFYDALN-----IQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDHNFDYLEFRLWIGLWSAFMCLVLVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIK-LADYYPINSDFKVGYNTHFSCACLPPDPVNLSVSNDTTLAPEDLPTISSTDMYHNVTFDWAYLSKKECVKYGGKLVGNNCDFVPDITLMSFILFLGTYTSSMAMKKFKTSRYFPTTARKLISDFAIILSILIFCVIDALVGVDT--------PKLIVPSEFKPTSPNRGWFVPPFGGNPWWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMALPWYVAATVISIAHIDSLKMETETSAPGEQ--PKFLGVREQRVTGTLVFILTGLSVFMAPI-LKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILK---STVAAIIFPVMILALVAVR 978          
BLAST of slc4a-5 vs. Ensembl Mouse
Match: Slc4a4 (solute carrier family 4 (anion exchanger), member 4 [Source:MGI Symbol;Acc:MGI:1927555])

HSP 1 Score: 203.371 bits (516), Expect = 1.753e-53
Identity = 166/564 (29.43%), Postives = 273/564 (48.40%), Query Frame = 2
Query: 1055 GGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVN-NSIFKSLSNMSNPFQIT----STLSP--MPD------FHNSL----HKGHSPCHR--------------DVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVF---QFQPVN------LPILGWKAILSCAALGFP---LSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIR 2617
            GG++ DIKR+ P + SD+ D         +  S   F+Y + +  +I FG L G+ TD    V    +  A+ G +F +  GQPL ++ +T P+ ++ +++F  S ++  D+       G+++A   ++   TD   L+++ T+ TEE F+  ++  F  DA K + K  A +Y    + KV  N+ F       +P  ++    +TL+P  +P       +HN      +     C +              D++++  +L +GT   +  +  F  + Y     R+L++DFA+ L+I I  +I AL+  D          K+    +F+P +      +P  G      C A   P   +++L FMDQ I + +VN   +KLKKG+ +H DLF VA++    S   LPW   A   S  H+ +L    E    G +     + VRE RVT  L  I   LS+F+ P  L +IP+ VL G+F++M V SL   QF +R+ LL       P   YLR VP R++HLFTF Q++ L +L  L    S    + FP+++L  + +R
Sbjct:  400 GGLIKDIKRKAPFFASDFYDALN-----IQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDHNFDYLEFRLWIGLWSAFMCLVLVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIK-LADYYPINSDFKVGYNTHFSCACLPPDPVNLSVSNDTTLAPEDLPTISSTDMYHNVTFDWAYLSKKECVKYGGKLVGNNCDFVPDITLMSFILFLGTYTSSMAMKKFKTSRYFPTTARKLISDFAIILSILIFCVIDALVGVDT--------PKLIVPSEFKPTSPNRGWFVPPFGGNPWWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMALPWYVAATVISIAHIDSLKMETETSAPGEQ--PKFLGVREQRVTGTLVFILTGLSVFMAPI-LKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILK---STVAAIIFPVMILALVAVR 943          
BLAST of slc4a-5 vs. Ensembl Mouse
Match: Slc4a4 (solute carrier family 4 (anion exchanger), member 4 [Source:MGI Symbol;Acc:MGI:1927555])

HSP 1 Score: 203.371 bits (516), Expect = 2.387e-53
Identity = 166/564 (29.43%), Postives = 273/564 (48.40%), Query Frame = 2
Query: 1055 GGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVN-NSIFKSLSNMSNPFQIT----STLSP--MPD------FHNS----LHKGHSPCHR--------------DVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVF---QFQPVN------LPILGWKAILSCAALGFP---LSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIR 2617
            GG++ DIKR+ P + SD+ D         +  S   F+Y + +  +I FG L G+ TD    V    +  A+ G +F +  GQPL ++ +T P+ ++ +++F  S ++  D+       G+++A   ++   TD   L+++ T+ TEE F+  ++  F  DA K + K  A +Y    + KV  N+ F       +P  ++    +TL+P  +P       +HN      +     C +              D++++  +L +GT   +  +  F  + Y     R+L++DFA+ L+I I  +I AL+  D          K+    +F+P +      +P  G      C A   P   +++L FMDQ I + +VN   +KLKKG+ +H DLF VA++    S   LPW   A   S  H+ +L    E    G +     + VRE RVT  L  I   LS+F+ P  L +IP+ VL G+F++M V SL   QF +R+ LL       P   YLR VP R++HLFTF Q++ L +L  L    S    + FP+++L  + +R
Sbjct:  444 GGLIKDIKRKAPFFASDFYDALN-----IQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDHNFDYLEFRLWIGLWSAFMCLVLVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIK-LADYYPINSDFKVGYNTHFSCACLPPDPVNLSVSNDTTLAPEDLPTISSTDMYHNVTFDWAYLSKKECVKYGGKLVGNNCDFVPDITLMSFILFLGTYTSSMAMKKFKTSRYFPTTARKLISDFAIILSILIFCVIDALVGVDT--------PKLIVPSEFKPTSPNRGWFVPPFGGNPWWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMALPWYVAATVISIAHIDSLKMETETSAPGEQ--PKFLGVREQRVTGTLVFILTGLSVFMAPI-LKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILK---STVAAIIFPVMILALVAVR 987          
BLAST of slc4a-5 vs. UniProt/SwissProt
Match: sp|Q8NBS3|S4A11_HUMAN (Sodium bicarbonate transporter-like protein 11 OS=Homo sapiens OX=9606 GN=SLC4A11 PE=1 SV=2)

HSP 1 Score: 527.709 bits (1358), Expect = 9.807e-173
Identity = 314/782 (40.15%), Postives = 479/782 (61.25%), Query Frame = 2
Query:  383 LPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSF-LTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQL------AETQKILRKRSVKVDEVMDQAFSVKTKFWI--GGGIVGDIKRRIPHYLSDYCDGFKGAN-TIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQ---CAEENKVNNSIFKSLSNMSNPFQIT-------STLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L LK+F  E+RA  D++ F+ ++ + L     S++ ++  ML         +E +  + +  A   LF      +      L+ TI+G++   T G+   QSW+  + T+  L KRH+ I+RL  P N G ++  V F+ILVL P K K TK+ +E+ RTF+T+ +DI FRQ+LL    E++F+  L  Q RQL             ++RS             K K ++  G GI  DI RR P Y  D+ DG  G N  + K  +TT FLYF+CLLP+IAFG LN  NTD  IDV++ I  Q+IGGL++ +  GQPL+++LTTAPLALY ++I  I  +Y +DF++ +A TG++N+ +L +Y+  ++  +M    +STEE+ A F++I F +DA K   K F ++Y      + +    S   SLS +      +       S L+   +  ++ H G +      +VL LL+ +GT+WL   L+ F K+PYL+   RE+L+D ALP+A+   S+I +  FR+I +  F Y+     F    +  L  +A+     LGF LS+LFF++QN+ +++VN+P N+L KG+ +HWDL ++A+IN  LS+FGLPWIH A PHSPLHV+AL+ +EER++ GH ++ TIV V+ETR+TS+ +++ + LSL LLP PL +IP  VL GLF+++A+TSL  NQ  +R+ LL  EQ+AYPP+HY+RRVPQRK+H FT  Q++QL++L A G S  PYMKM FP++++  IPIR+ ++P+ I+  +++ MD
Sbjct:  115 LKLKNFKEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAM--LFTDAGAPMRGKVHLLSDTIQGVTATVT-GVRYQQSWLCIICTMKALQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKLLETRTEEEFKEALVHQ-RQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLDFTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLALYIQVIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLSLVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGLGASLNASLHTALNASFLASPTELPSATHSGQA-----TAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAMAQIQSLSLRAVSGAMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGH-IYDTIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIPKPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLLLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMD 886          
BLAST of slc4a-5 vs. UniProt/SwissProt
Match: sp|A2AJN7|S4A11_MOUSE (Sodium bicarbonate transporter-like protein 11 OS=Mus musculus OX=10090 GN=Slc4a11 PE=2 SV=1)

HSP 1 Score: 522.702 bits (1345), Expect = 3.374e-171
Identity = 323/789 (40.94%), Postives = 494/789 (62.61%), Query Frame = 2
Query:  383 LPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERML----INILECEITDEISLEMWIKEAKTKLFMHTSF-LTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKRSVKVDEVMD----QAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKG-ANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQ-----HYQCAEENKV----------NNSIFKSL--SNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L LK+F  EVRA  D++ F+ ++ + L     S+++++  ML    ++    E   ++ L M       KLF      +      L+ TI+G++     G+  +QSW+  + T+  L KRH+ I+RL  P N G ++  V F+ILVL P K K TK+ +E+ RTF+T+ +DI FRQ+LL    E++F+  L  Q RQL  T  + R     +  +      Q    K  F  G GI  DI RR P Y  D+ DG  G + ++ K  +TT FLYF+CLLP+IAFG LN  NT+  IDV++ I  Q+IGGL++ +  GQPL+++LTTAPLA+YT++I  I  +Y +DF+A +A TG++N+ +L +Y+  ++  LM    +STEE+ A F++I F +DA K + K F +     HY     + +          N+S+  +L  S +++P ++ +T SP      S H G +      +VL LL+ +GT+WL   L+ F K+PYL+   RE L+D ALP+A+   S+IG+  F++I +  F Y+     F+   +  L +KAI S   LGF LSLLFF++QN+ +++VN+P N+L KG+ +HWDL ++A+IN  LS+FGLPWIH A PHSPLHV+AL+ +EER++ GH +++TIV V+ETR+T++ +++ + LSL LLP PL +IP  VL GLF+++A+TSL  NQ   R+ LL  EQ++YPP+HY+RRVPQRK+H FT  Q++QL++L A G S  PYMKM FP++++  IPIR+ ++P+ I+  +++ MD
Sbjct:   89 LKLKNFEEEVRAHRDLDGFLAQASIILNETATSLDDVLRTMLNRFALDPNHAEPDCDLDLLM------AKLFTDAGAPMESKVHLLSDTIQGVTAT-VRGVQYEQSWLCIICTMKTLQKRHVCISRLVRPQNWGENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDITFRQKLLKTRTEEEFKEALVHQ-RQLL-TMMMPRAAGHSMSSLHTHRHPQPPKCKDFFPFGKGIWMDIMRRFPVYPMDFTDGIIGKSKSVGKYVTTTLFLYFACLLPTIAFGSLNDENTNGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTAPLAIYTQVIRVICDDYNLDFNAFYAWTGLWNSFFLALYAFLNLSLLMNLFKRSTEEIIALFISITFVLDAVKGMVKIFGKYYYGHHYHTKRTSSLVSLLGIGRSPNSSLHTALNASLLASPVEMATTSSP-----GSTHSGQA-----TAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVRETLSDCALPIAVLSFSLIGSYGFQEIEMSKFRYNPSESLFEVAQIHSLSFKAIGSAMGLGFLLSLLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVEERVENGH-IYETIVDVKETRLTALGASVLVGLSLLLLPFPLQWIPKPVLYGLFLYIALTSLDGNQLFSRVALLLKEQTSYPPTHYIRRVPQRKIHYFTGLQILQLLLLCAFGMSSLPYMKMVFPLIMIAMIPIRYNLLPRIIEAKYLDVMD 857          
BLAST of slc4a-5 vs. UniProt/SwissProt
Match: sp|Q9Y6R1|S4A4_HUMAN (Electrogenic sodium bicarbonate cotransporter 1 OS=Homo sapiens OX=9606 GN=SLC4A4 PE=1 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 4.961e-55
Identity = 170/564 (30.14%), Postives = 274/564 (48.58%), Query Frame = 2
Query: 1055 GGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVN-NSIFKSLSNMSNPFQIT----STLSP--MPD------FHNSLHK----GHSPCHR--------------DVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVF---QFQPVN------LPILGWKAILSCAALGFP---LSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIR 2617
            GG++ DIKR+ P + SD+ D         +  S   F+Y + +  +I FG L G+ TD    V    +  A+ G +F +  GQPL ++ +T P+ ++ +++F  S +   D+       G+++A   +I   TD   L+++ T+ TEE F+  ++  F  DA K + K  A +Y      KV  N++F       +P  I+    +TL+P  +P       +HN+           C +              D++++  +L +GT   +  L  F  +PY     R+L++DFA+ L+I I  +I AL+  D          K+    +F+P +      +P  G      C A   P   +++L FMDQ I + +VN   +KLKKG+ +H DLF VA++    S+  LPW   A   S  H+ +L    E    G +     + VRE RVT  L  I   LS+F+ P  L +IP+ VL G+F++M V SL   QF +R+ LL       P   YLR VP R++HLFTF Q++ L +L  L    S    + FP+++L  + +R
Sbjct:  444 GGLIKDIKRKAPFFASDFYDALN-----IQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDNNFDYLEFRLWIGLWSAFLCLILVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIK-LADYYPINSNFKVGYNTLFSCTCVPPDPANISISNDTTLAPEYLPTMSSTDMYHNTTFDWAFLSKKECSKYGGNLVGNNCNFVPDITLMSFILFLGTYTSSMALKKFKTSPYFPTTARKLISDFAIILSILIFCVIDALVGVDT--------PKLIVPSEFKPTSPNRGWFVPPFGENPWWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVICSLMALPWYVAATVISIAHIDSLKMETETSAPGEQ--PKFLGVREQRVTGTLVFILTGLSVFMAPI-LKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILK---STVAAIIFPVMILALVAVR 987          
BLAST of slc4a-5 vs. UniProt/SwissProt
Match: sp|P04919|B3AT_MOUSE (Band 3 anion transport protein OS=Mus musculus OX=10090 GN=Slc4a1 PE=1 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 8.665e-55
Identity = 181/678 (26.70%), Postives = 318/678 (46.90%), Query Frame = 2
Query:  779 ENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDF-RSMLQF----------------QARQLAETQK-ILRKR----SVKVDEVM--------------DQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGAL--------LFRDINLDPFYYDEKVFQFQPVNLPIL--GWKAILSC--AALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            E V F++++L P  E       +LGR  +T+M +  FR    M  N ++  RS+  F                    L   QK +LR+R      K D  +              D+   ++    I GG++ DI+RR P+YLSD  D         +V +   F+YF+ L P++ FG L G  T   + V  ++IS A+ G++F +LG QPL+V+  + PL ++ +  F+      +++    A  G +  + +M+    +   L+++ ++ T+E+F+F +++ F       +Y+ F++  +  ++  +  +                 + P P       +G  P   + ++  L+L  GT  LA  L  F  + Y   + R ++ DF +P++I IM ++ +         L     L       + +   P+ L  L   W    S   A L F   +L F++  I + +V+ P  K+ KGS FH DL +V  + G  ++FG+PW+      S  H  AL+ + +    G      I  V+E R++ +L ++ + LS+ + P  LS IP+AVL G+F++M VTSL   Q  +RI LLF     +P   +++RV   ++HLFT  Q+I L +L  +  +P+    +  P VL+L +P+R  I+P    E+ +  +D
Sbjct:  273 EPVGFLLVLLGP--EAPHVDYTQLGRAAATLMTERVFRITASMAHNREELLRSLESFLDCSLVLPPTDAPSEKALLNLVPVQKELLRRRYLPSPAKPDPNLYNTLDLNGGKGGPGDEDDPLRRTGRIFGGLIRDIRRRYPYYLSDITDALS-----PQVLAAVIFIYFAALSPAVTFGGLLGEKTRNLMGVSELLISTAVQGILFALLGAQPLLVLGFSGPLLVFEEAFFSFCESNNLEYIVGRAWIGFWLILLVMLVVAFEGSFLVQYISRYTQEIFSFLISLIF-------IYETFSKLIKIFQDYPLQQTY------------APVVMKPKP-------QGPVP---NTALFSLVLMAGTFLLAMTLRKFKNSTYFPGKLRRVIGDFGVPISILIMVLVDSFIKGTYTQKLSVPDGLKVSNSSARGWVIHPLGLYRLFPTWMMFASVLPALLVF---ILIFLESQITTLIVSKPERKMIKGSGFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHANALTVMGKASGPGAAAQ--IQEVKEQRISGLLVSVLVGLSILMEPI-LSRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPFVKRVKTWRMHLFTGIQIICLAVLWVVKSTPA---SLALPFVLILTVPLRRLILPLIFRELELQCLD 905          
BLAST of slc4a-5 vs. UniProt/SwissProt
Match: sp|P02730|B3AT_HUMAN (Band 3 anion transport protein OS=Homo sapiens OX=9606 GN=SLC4A1 PE=1 SV=3)

HSP 1 Score: 208.764 bits (530), Expect = 1.291e-54
Identity = 151/554 (27.26%), Postives = 274/554 (49.46%), Query Frame = 2
Query: 1055 GGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVF---QFQPVNLPILGWKAILSCAALGFPLSLLF-------------FMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            GG+V DI+RR P+YLSD  D F       +V +   F+YF+ L P+I FG L G  T  ++ V  ++IS A+ G++F +LG QPL+V+  + PL ++ +  F+      +++       G +  + +++    +   L+++ ++ T+E+F+F +++ F       +Y+ F++  +  +++ +  +         N   +     P+P               + ++L L+L  GT + A  L  F  + Y   + R ++ DF +P++I IM ++     +D       Y +K+     F+  N    GW          FP+ ++F             F++  I + +V+ P  K+ KGS FH DL +V  + G  ++FG+PW+      S  H  AL+ + +    G      I  V+E R++ +L  + + LS+ + P  LS IP+AVL G+F++M VTSL   Q  +RI LLF     +P   Y++RV   ++HLFT  Q+I L +L  +  +P+    +  P VL+L +P+R  ++P     + +  +D
Sbjct:  380 GGLVRDIRRRYPYYLSDITDAFS-----PQVLAAVIFIYFAALSPAITFGGLLGEKTRNQMGVSELLISTAVQGILFALLGAQPLLVVGFSGPLLVFEEAFFSFCETNGLEYIVGRVWIGFWLILLVVLVVAFEGSFLVRFISRYTQEIFSFLISLIF-------IYETFSKLIKIFQDHPLQKTY------NYNVLMVPKPQGPLP---------------NTALLSLVLMAGTFFFAMMLRKFKNSSYFPGKLRRVIGDFGVPISILIMVLVD-FFIQDT------YTQKLSVPDGFKVSNSSARGWVIHPLGLRSEFPIWMMFASALPALLVFILIFLESQITTLIVSKPERKMVKGSGFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHANALTVMGKASTPGAAAQ--IQEVKEQRISGLLVAVLVGLSILMEPI-LSRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPYVKRVKTWRMHLFTGIQIICLAVLWVVKSTPA---SLALPFVLILTVPLRRVLLPLIFRNVELQCLD 887          
BLAST of slc4a-5 vs. TrEMBL
Match: A0A0H3YIT6 (Slc4a-5 OS=Schmidtea mediterranea OX=79327 GN=slc4a-5 PE=2 SV=1)

HSP 1 Score: 1772.67 bits (4590), Expect = 0.000e+0
Identity = 876/876 (100.00%), Postives = 876/876 (100.00%), Query Frame = 2
Query:   50 MFSTHSEANSELGEDCNEATPFTESQYETKSQHLSLSPNFLSHNTSHHSIVLENLNNVTDRRTSNLSQFNNSDGYPDNISMLSGVSGIGLRNLSLFYNSPPPYLVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDKSS 2677
            MFSTHSEANSELGEDCNEATPFTESQYETKSQHLSLSPNFLSHNTSHHSIVLENLNNVTDRRTSNLSQFNNSDGYPDNISMLSGVSGIGLRNLSLFYNSPPPYLVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEVFAFFVAIAFTVDASKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDKSS
Sbjct:    1 MFSTHSEANSELGEDCNEATPFTESQYETKSQHLSLSPNFLSHNTSHHSIVLENLNNVTDRRTSNLSQFNNSDGYPDNISMLSGVSGIGLRNLSLFYNSPPPYLVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEVFAFFVAIAFTVDASKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDKSS 876          
BLAST of slc4a-5 vs. TrEMBL
Match: A0A0H3YK00 (Slc4a-8 OS=Schmidtea mediterranea OX=79327 GN=slc4a-8 PE=2 SV=1)

HSP 1 Score: 937.947 bits (2423), Expect = 0.000e+0
Identity = 477/821 (58.10%), Postives = 617/821 (75.15%), Query Frame = 2
Query:  230 RRTSNLSQFNNSDGYP-DNISMLSGVS-GIGLRNLSLFYNSPPPYLVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITD-EISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHY-QCAEENKVNNSIFKSLSNMSNPFQITSTLSPM---PDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDK 2671
            RR S   Q +++     DN+S +SG +    L+N     +   P L LSRLEK+P+KDFS+EVRA+LDI+KF+KE+VL L+M    +EEII+ ML+ IL  E+TD ++SLE  ++EAK  LF+ +S+LTY+YQRLAKTI+G+S+ +TEGL  DQSW+  M +L  +HKRH+AIARL+ P N+GRS+E ++FIILV+ PTKEKGTKS+IELGRTF+TI AD++FRQQLL  E+ + F+ +LQ+ +  L E Q + R++S+KV EVM+QAF    K+ +G GIV D K+R P YL D+ DGF+G  TIRKV S T FLYF+CLLPSIAFGVLN NNT+ KIDV+RVIISQAIGGL FG   GQPLI++LTTAPLAL+ KII +I  +Y +DF AM++C G+ N++ L++Y++ D+ KLM+WST+S+EE+FA FVAI+F VDA KD+YKEF+ HY  C       ++    LS     F    +   +       NS     + C R+VS+LYL L  GTVWLA  LF  TKTP+LN  KRE+L DFALPLA+ IMS+IG  LF++I + PF   E+  +F+   +  L W AI    AL FPLSLL FMDQNI+S+MVNSP+NKLKKGS++HWDL +VALIN  LS+FGLP +HGA+PHSPLHVKAL+D+EERID  H VHQTIV+VRETR+TSILS++FI +SL +LP PL YIP+AVLDGLF++MAVT+LY NQF ERI LLFTEQSAYPPSHYLRRVPQRKLH+FT  Q+ QL  L  LGFSPSPY+KMGFP++LL  +  RH+++P+ IDE ++NA+DK
Sbjct:   93 RRLSRQRQGSSASNVSVDNMSNISGSTLAYCLQNADETEDDSVPCLFLSRLEKIPMKDFSAEVRATLDIQKFLKEAVLLLDMSGSCLEEIIDSMLLTILANEVTDAKVSLEALVEEAKKTLFIQSSYLTYTYQRLAKTIRGLSLSETEGLMTDQSWLCTMCSLNCIHKRHVAIARLNNPVNMGRSSEGIYFIILVVTPTKEKGTKSDIELGRTFATIFADVEFRQQLLFSESVEQFKELLQYHSGDLMEDQAMNRRKSLKVQEVMNQAFHFDKKYLVGSGIVSDFKKRFPVYLMDFRDGFRGKGTIRKVISATIFLYFACLLPSIAFGVLNYNNTEGKIDVRRVIISQAIGGLCFGFFSGQPLIILLTTAPLALFVKIISSICNDYDLDFFAMYSCVGLINSLLLILYAMFDISKLMRWSTRSSEEIFALFVAISFVVDAVKDIYKEFSTHYFSCYLSANNQSTEHLRLSRFKRAFSGIISNISISLTQTNLNSSLYSSNSCQREVSILYLFLVAGTVWLAIQLFTSTKTPFLNNAKREMLTDFALPLAVVIMSLIGTYLFKEIEMQPFVIVEEKVKFEASGILKLPWLAIAGAIALAFPLSLLMFMDQNISSAMVNSPANKLKKGSSYHWDLLVVALINAGLSVFGLPLVHGALPHSPLHVKALADLEERIDTAHHVHQTIVKVRETRITSILSHVFIGISLQMLPIPLIYIPVAVLDGLFVYMAVTTLYGNQFFERILLLFTEQSAYPPSHYLRRVPQRKLHIFTGLQIFQLAGLCLLGFSPSPYLKMGFPLLLLFHMVFRHQVVPRVIDEKYLNALDK 913          
BLAST of slc4a-5 vs. TrEMBL
Match: A0A0H3YEW7 (Slc4a-4 OS=Schmidtea mediterranea OX=79327 GN=slc4a-4 PE=2 SV=1)

HSP 1 Score: 879.011 bits (2270), Expect = 0.000e+0
Identity = 471/884 (53.28%), Postives = 627/884 (70.93%), Query Frame = 2
Query:  146 HLSLSPNFLSHNTSHHSIVLENLN-----NVTDRRT-SNLSQF-----NNSDGYPDNISML-------------------SGVSGIGLRNLSLFYNSPP------PYLVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEIS-LEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENK----VNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPF-YYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDK 2671
            HL++  ++ S++ S   +VL N N     + T+RRT S L  F     NN D    + ++L                     VS   + +L+ +Y +        P LVL+RLEK+P+KDFSSEVRA+LD+EKF+KE VL L+M    ++ I+E +L  I    +   I  ++ +I EAK  LFM   +  +SYQRLAKT+KGI I++ EGL+ DQSWI+AM +L  +HKRH+AIARL TP NLGRS+E V+F++LV+ P KEK TKS+IEL RTF+T+++D++FR QLL  + E +F+ MLQ  AR LAE Q++ R+RS+++ EVM+QAF+ + KF +G GIV D+++RIP Y+SDY DG +G  TIRK+ S  +FLYF+CLLPS+AFGVL   NTD KI+VKRVI+SQ +GGL F ++GGQPLIVMLTTAPL LY K+I+ IS +Y + F  MF+  GIFN+++L++YSL D+ KLM+WST+STEE+FA F++IAF VDA KDV K F + Y     NK    VN ++ K L N +N F   +T                   ++  +L+LLL IGTVWL  +  NFTKTP+LN+ KR L+AD++LPLA+ IMS IG+ LF+DI +D F    E+ F  + VN   +   A+ +   L FPLSLLFFMDQN+ S+MVN PSNKLKKGS +HWDL IVA+IN  LS+FGLPW+HG +PHSPLHVKAL+D+EERID GH++++TIV+VRETR+T ++S+I I LSL LLP PL Y+PIAVLDGLF++MA+T+LY NQ  ER+ LLFTEQ+AYPPSHYLRRVPQRK+HLFT  QL QL +L ALGF+P+PY K+GFPI+LLLQ+PIRH I PKFI   +I+A+DK
Sbjct:   21 HLNMINSYSSNDKSVPKLVLTNCNQSPAIDRTNRRTISGLYNFKKQSTNNDDKDSKDRNLLLSPTNYINRQISETSEMSTDTVSNFSIGSLARYYRTADENGEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNSIFLILYSLLDLSKLMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITT---------------EESRKENGLLFLLLLIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRLTGLISHILIGLSLLLLPIPLIYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHLFTVLQLTQLGLLCALGFAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDK 889          
BLAST of slc4a-5 vs. TrEMBL
Match: A0A267H8X4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030243g1 PE=4 SV=1)

HSP 1 Score: 866.3 bits (2237), Expect = 0.000e+0
Identity = 448/849 (52.77%), Postives = 601/849 (70.79%), Query Frame = 2
Query:  278 DNISMLSGVSGIGLRNLSLFYNSPP------PYLVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEIT-------------------------------------------DEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHK--GHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDK 2671
            DN+S++SG S      L+++Y SP       P LV+SRLEK+PLKDFSSE+RA+LDIE+F+KE+ L L++   ++E II+RML +I + +I                                            ++ +LE  +++AK  LF+  S++ YSYQRLAKTIK IS+ D+EGL  D SW+  M +L  ++KRH+AIARLS+P NLGRS+E VHFI+LV+ PTKEKGTKS+IE+GRTF+TI+AD DFRQ+L++ E+E +F+SM+Q  A+ L E Q+I R++S++  + M QAFS +  + +  GI  DIKRR+ HY SD+ DGF+G  T+ KV ST  FLYF+CLLP IAFGVLN   TD KI V+RV++SQ IGG+VF ++GGQPLIVMLTTAPLALYT+II+ +S  + +DF A+F   G+FNA+ L++Y+  DM KLM+WST+STEE+FA F++IAF V+A K VY  F ++Y CA+    N +   S++N+S+     + ++P+ D  N+         C RD+S+L+L+L  GTV+LA +L NFTKTPYLN  KREL+ADF+LP+A+ +MS  G+ LF D+ L  F   + + + Q      L   AIL    L  PLS+LFFMDQNI+S+MVN P+NKLKKGS +H DL +VALING LS  GLPWIHGA+PHSPLHVKAL+D+EERID+G  V QT+VRVRETR+T IL+N  + LSL + P PLSYIP+ VL+GLF+ MA+TS+  NQ  ERI LLFTEQ+AYPPSH+LRRVPQRK+H+FT  QL+QL  L A+GFS   Y KM FP++L LQ+PIRH +IPK IDE +++A+DK
Sbjct:  145 DNLSLISGGS------LAMYYRSPDGVDETLPCLVVSRLEKIPLKDFSSEIRANLDIERFLKEATLLLDLEGDNIESIIDRMLQSIFKADIEAHGSNHHHHHHHNQHHQHPVSAAAQADQAATSTGAAAADGGDPNDAALEAKVQDAKKTLFLQASWMDYSYQRLAKTIKSISVIDSEGLITDNSWLCTMCSLSGVNKRHVAIARLSSPVNLGRSSEGVHFILLVVTPTKEKGTKSDIEIGRTFATILADADFRQRLMLAESEDEFKSMMQSHAQDLGEEQRIYRRKSLRTKDFMTQAFSYENSWLLCNGIKADIKRRLRHYPSDFVDGFRGPKTLTKVLSTVIFLYFACLLPCIAFGVLNHKQTDGKISVERVVLSQGIGGVVFALIGGQPLIVMLTTAPLALYTRIIYEVSEAHGLDFFALFGWVGVFNALLLLLYATVDMAKLMRWSTRSTEEIFALFISIAFMVEAYKSVYYVFRENYSCAKP-IANATDAASIANLSD----ATLIAPLIDSSNASTPDLAAPSCRRDISILFLMLCAGTVFLAMYLLNFTKTPYLNRAKRELMADFSLPVAVLVMSFCGSYLFSDVGLQKFEC-KSIIRLQFTIATPLPAAAILGAFVLALPLSMLFFMDQNISSAMVNCPTNKLKKGSAYHLDLLVVALINGCLSCVGLPWIHGALPHSPLHVKALADLEERIDLGQHVQQTVVRVRETRITGILANCLVGLSLLMCPSPLSYIPVPVLNGLFVCMAITSVMGNQLFERILLLFTEQAAYPPSHFLRRVPQRKVHIFTLLQLLQLAALCAVGFSGIAYAKMVFPVLLGLQMPIRHLLIPKLIDENYLDALDK 981          
BLAST of slc4a-5 vs. TrEMBL
Match: A0A267H2A6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031769g1 PE=4 SV=1)

HSP 1 Score: 839.336 bits (2167), Expect = 0.000e+0
Identity = 437/829 (52.71%), Postives = 590/829 (71.17%), Query Frame = 2
Query:  278 DNISMLSGVSGIGLRNLSLFYNSPP------PYLVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITD-----------------------EISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSP--CHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDK 2671
            DN+S++SG S      L++FY +        P LV+SRLEK+PLKDFSSE+RA++DI++F+KE+ L L++   ++E IIE+ML +I   +                          +  L+  +++AK  LF+  +++ Y+YQRLAKTIK IS+ D+EGL  D SW+  M +L  + KRH+AIARLSTP NLGRS+E V FI+LV+ PTKEKGTKS+IELGRTF+TI+AD +FRQ+LL+ E E +F+ MLQ  A +L E QKI R++S++  + M QAFS ++ + I  GI  D+KRR+ HYLSD+ D F+   TIRKV +T  FLYF+CL+P IAFGVLN + T+  I V RVI+SQ IGG+ F + GGQPLIVMLTTAPLALYT IIF +S  + +DF A F   G+FNA  L++Y++ D+ KLM+WST+STEE+FA F+++AFTV A K VY  F  +Y   + N    +   +L++ S+ +    TL      + S   G     C RDVS+L+LLL IGTV+L+ +L NFTKTPYLN  KREL+ADF+LP+++  MS +G  LFR++ L+ F     + Q + V    L   AIL    L  PLS+LFFM+QNI+S+MVN P+NKL+KGS +H DL  VAL+NG +S FGLPW+HGA+PHSPLHVKAL+D+EERID+G  VHQ++VRVRETR+T ++SNI I LSL + P PLS+IP+ VLDGLF+ MA+T+L++NQ  ERI LLFTEQ+AYPPSHYLRRVPQRK+H+FT  QL+QL +L ALGF+   Y K+GFP++L LQ+P+RH +IPK IDE +++A+DK
Sbjct:  106 DNLSIMSGGS------LAMFYRNADGTDESLPCLVVSRLEKIPLKDFSSEIRANMDIQRFLKEATLLLDVEGANVECIIEQMLRSIFRADHESHHSSGSGGGGGDGGSVAGAAGAIDSRLDAKVQDAKKTLFLQANWMDYTYQRLAKTIKSISVVDSEGLITDNSWLCTMCSLNGVQKRHVAIARLSTPVNLGRSSEGVSFILLVVTPTKEKGTKSDIELGRTFATILADSEFRQKLLLAETESEFKEMLQGHAHELGEEQKIYRRKSLRTKDFMSQAFSYESSWPICNGIRADLKRRLSHYLSDFIDAFRDNKTIRKVVTTVIFLYFACLMPCIAFGVLNNSLTNGYITVHRVILSQCIGGVTFALFGGQPLIVMLTTAPLALYTHIIFELSQNHGLDFFAFFGWVGVFNAALLLLYAVLDLSKLMRWSTRSTEEIFAMFISVAFTVGAVKSVYGNFDTYY--CDGNGGAETNGGNLTSGSDKWGRNLTLDSQSALNGSSSVGQKQQNCQRDVSILFLLLCIGTVFLSMYLLNFTKTPYLNRAKRELMADFSLPVSVLAMSFVGTYLFRNVQLENFSCLPYI-QLEFVIARPLPGLAILGAFGLAIPLSMLFFMEQNISSAMVNCPANKLRKGSAYHLDLLTVALMNGVMSCFGLPWVHGALPHSPLHVKALADLEERIDLGQHVHQSVVRVRETRITGVVSNILIGLSLLMCPVPLSFIPVPVLDGLFVCMAITALFDNQLFERILLLFTEQAAYPPSHYLRRVPQRKVHIFTCLQLLQLFVLCALGFNSIAYAKLGFPVILFLQMPVRHLLIPKLIDENYLDALDK 925          
BLAST of slc4a-5 vs. Ensembl Cavefish
Match: ENSAMXT00000011908.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000151.1:229098:263825:-1 gene:ENSAMXG00000011585.2 transcript:ENSAMXT00000011908.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 541.576 bits (1394), Expect = 2.219e-180
Identity = 307/769 (39.92%), Postives = 485/769 (63.07%), Query Frame = 2
Query:  389 LKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKRSVKVDEV--MDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGAN-TIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGH-----SPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPF-YYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L +F  EVRA  D+  F+ ++ + L+    S++E++ RML ++       + S +   +E  + LF        S   L +TI+ ++   T G+   QSW+  +  + +L +R + I RL  P N G +   V F+IL+L P + K TK+ IELGRTF+T+ +DI FRQ+LL  + + DF+  L  Q + L+  +    K S++ +    +++   VK     G GI  D+ RR+P+Y+SD+ DG  G+N ++ K  +T  FLY + LLP+IAFG LN  +T  +IDV++ I+ Q+IGG+++ +L G P+++ +TTAPLA++  +I  I  +Y +DF A +AC G++N+++L++  L ++   MK   +STEEV A F++IAF  DA K   K F ++Y       VN+S  + + ++++  Q        PD  +S          + C R+  +L LLL +GT+WL   LF   ++P+L+A+ RE+++D ALP+++ I S +G+ LF DI L  F YY+  +F   P+++  L    +LS   LGF L+LL F+DQNI  S+ N+P N+L KG+ +HWDL +   IN  +S+ GLPW+H A PHS LHV+ L+ +E+R++ GH +++TIV V+ETR+TS+ +N+ I LS+FLLP PL +IP  VL GLF+++A+TS+  NQ C+RI LL  EQ++YPP+HY+RRVPQRK+H FT  QLIQLI+L A G  P PYMKM FP++++  IP+R+ ++PK I+  +++ +D
Sbjct:   42 LMNFQEEVRAHRDLNSFLAQASILLDETAASLDEVLRRMLQHVAR---DGQGSCDQ--REVISALFTDAGGQEASVHLLTETIQAVTATAT-GVRYQQSWLCVLCNVKSLQRRCVCITRLERPQNWGVNCCEVRFVILILAPPRTKSTKTAIELGRTFATLFSDISFRQKLLETKTQDDFKQELVHQMQLLSSAE---HKASIEEETGPHINKPLKVKEFLQAGRGIYEDLSRRLPYYVSDFTDGMYGSNRSLLKYTTTAIFLYIAILLPAIAFGSLNDESTRGEIDVQKTIVGQSIGGVIYSLLAGSPMVIPITTAPLAIFISVIRGICDDYDLDFPAFYACIGLWNSLFLILGGLFNISLFMKLFKRSTEEVIALFISIAFVGDAVKGTIKIFHKYYH--GPTLVNSSAVE-IHHLADMIQ-------HPDSSSSSTAPSLSAVLTLCTRERPILCLLLMLGTLWLGYVLFLIKRSPFLHAKVREVVSDCALPISVVIFSFVGSYLFIDIELPVFNYYNGSIFNIAPLDM--LSGMNVLSACGLGFLLALLIFIDQNIVISLTNAPENRLLKGTAYHWDLMLSGFINILMSVLGLPWMHAAFPHSTLHVRQLAKVEQRVEQGH-LYETIVSVKETRLTSLAANVLIGLSVFLLPVPLQWIPKPVLYGLFLYIALTSIDGNQMCDRIALLLKEQTSYPPTHYIRRVPQRKVHYFTGLQLIQLIILCAFGMYPLPYMKMIFPLLMIFLIPVRNSMLPKIIEAKYLDIID 788          
BLAST of slc4a-5 vs. Ensembl Cavefish
Match: ENSAMXT00000047690.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000151.1:229977:263825:-1 gene:ENSAMXG00000011585.2 transcript:ENSAMXT00000047690.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 531.561 bits (1368), Expect = 1.164e-176
Identity = 303/756 (40.08%), Postives = 475/756 (62.83%), Query Frame = 2
Query:  389 LKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKRSVKVDEV--MDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGAN-TIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGH-----SPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPF-YYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKII 2629
            L +F  EVRA  D+  F+ ++ + L+    S++E++ RML ++       + S +   +E  + LF        S   L +TI+ ++   T G+   QSW+  +  + +L +R + I RL  P N G +   V F+IL+L P + K TK+ IELGRTF+T+ +DI FRQ+LL  + + DF+  L  Q + L+  +    K S++ +    +++   VK     G GI  D+ RR+P+Y+SD+ DG  G+N ++ K  +T  FLY + LLP+IAFG LN  +T  +IDV++ I+ Q+IGG+++ +L G P+++ +TTAPLA++  +I  I  +Y +DF A +AC G++N+++L++  L ++   MK   +STEEV A F++IAF  DA K   K F ++Y       VN+S  + + ++++  Q        PD  +S          + C R+  +L LLL +GT+WL   LF   ++P+L+A+ RE+++D ALP+++ I S +G+ LF DI L  F YY+  +F   P+++  L    +LS   LGF L+LL F+DQNI  S+ N+P N+L KG+ +HWDL +   IN  +S+ GLPW+H A PHS LHV+ L+ +E+R++ GH +++TIV V+ETR+TS+ +N+ I LS+FLLP PL +IP  VL GLF+++A+TS+  NQ C+RI LL  EQ++YPP+HY+RRVPQRK+H FT  QLIQLI+L A G  P PYMKM FP++++  IP+R+  +
Sbjct:   42 LMNFQEEVRAHRDLNSFLAQASILLDETAASLDEVLRRMLQHVAR---DGQGSCDQ--REVISALFTDAGGQEASVHLLTETIQAVTATAT-GVRYQQSWLCVLCNVKSLQRRCVCITRLERPQNWGVNCCEVRFVILILAPPRTKSTKTAIELGRTFATLFSDISFRQKLLETKTQDDFKQELVHQMQLLSSAE---HKASIEEETGPHINKPLKVKEFLQAGRGIYEDLSRRLPYYVSDFTDGMYGSNRSLLKYTTTAIFLYIAILLPAIAFGSLNDESTRGEIDVQKTIVGQSIGGVIYSLLAGSPMVIPITTAPLAIFISVIRGICDDYDLDFPAFYACIGLWNSLFLILGGLFNISLFMKLFKRSTEEVIALFISIAFVGDAVKGTIKIFHKYYH--GPTLVNSSAVE-IHHLADMIQ-------HPDSSSSSTAPSLSAVLTLCTRERPILCLLLMLGTLWLGYVLFLIKRSPFLHAKVREVVSDCALPISVVIFSFVGSYLFIDIELPVFNYYNGSIFNIAPLDM--LSGMNVLSACGLGFLLALLIFIDQNIVISLTNAPENRLLKGTAYHWDLMLSGFINILMSVLGLPWMHAAFPHSTLHVRQLAKVEQRVEQGH-LYETIVSVKETRLTSLAANVLIGLSVFLLPVPLQWIPKPVLYGLFLYIALTSIDGNQMCDRIALLLKEQTSYPPTHYIRRVPQRKVHYFTGLQLIQLIILCAFGMYPLPYMKMIFPLLMIFLIPVRYGTV 775          
BLAST of slc4a-5 vs. Ensembl Cavefish
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 515.768 bits (1327), Expect = 2.261e-170
Identity = 299/771 (38.78%), Postives = 477/771 (61.87%), Query Frame = 2
Query:  389 LKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQ-KILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGAN-TIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRK-------IDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLM-KWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPF-YYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L +F  E+RA  D++ F++ + + L     S++++++ ML +I +   T E       +E  + LF        +   L++T++ ++   T G+   QSW+  +  + NL +RH+ I+RL  P N G +   V ++IL+L P K K TK+ +ELGRTF+++ +DI FRQ+LL  + +++F+  L  Q   L  T+ K       + D    +    +  F +G GI  D+ RR+P Y SD+ DG  G N  + K  +T+ FLY + LLP+IAFG LN  +T  +        DV++ II Q+IGG+++ +  G PL++ LTTAP+A++  +I  I  +Y++DF+A +AC G++N+++L+I  + ++  L+ K   +S EEV A F++IAF  DA K   K F ++Y       + N   + L+ +S    +T  L           +    C R   +L LLL +GT+W+   L+ F ++P+L+A+ RE+L+D ALP+++ I S +G+ +F DI L  F ++   VF+  P  L  L   ++LS   LGF L+LL F+DQNI  S+ N+P N+L KG+ +HWDL +  LIN  +S+ GLPW+H A PHS LHV+ L+ +EER++ GH +++TIV V+ETRVTS+++NI I +S+FLLP PL +IP  VL GLF+++A+TS+  NQ C+R+ LL  EQ++YPP+HY+R+VPQRK+H FTF Q++QL+ L   G  P PYMKM FP+++ + IPIR+ ++P+ ID  +++ MD
Sbjct:   29 LMNFEEEIRAHRDLDGFLERASILLHEDEASLDDVLKTMLRHISQDPHTAEPGCNF--EEIMSSLFTDAGSQEVNVHLLSETLQCVTATAT-GIQYQQSWLCILCNVKNLQRRHVCISRLDRPQNWGENCAEVRYVILILAPLKMKSTKTAMELGRTFASMFSDISFRQKLLESKTQEEFKEALVIQRYHLTATKRKTTTVEEEETDPHSHKPLKCRDFFRVGRGIYEDLCRRLPFYPSDFTDGIVGNNKALVKYMTTSIFLYIAVLLPAIAFGSLNDESTRGENSICVSVSDVQKTIIGQSIGGIIYSLCAGSPLVIPLTTAPIAIFISVIRGICDDYELDFAAFYACIGLWNSLFLIIGGVFNLSLLLVKLFKRSIEEVIALFISIAFVADAMKGTVKIFHKYYHAP---TLANGSIEELNRISRDMNLTGELP----------ESFILCTRARPLLCLLLMLGTLWVGYTLYQFKRSPFLHAKMREILSDCALPISVLIFSYVGSYVFNDIGLPVFDFHKGPVFRVAP--LEKLTGASVLSAMGLGFLLALLIFIDQNIVVSLTNAPENRLLKGTAYHWDLTLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAIVEERVEGGH-LYETIVSVKETRVTSLVANILIGVSVFLLPVPLQWIPKPVLYGLFLYIALTSIDGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMVQLLFLCTFGMYPLPYMKMIFPLLMFILIPIRNCLLPRIIDAKYLDIMD 780          
BLAST of slc4a-5 vs. Ensembl Cavefish
Match: slc4a2b (anion exchange protein 2-like [Source:NCBI gene;Acc:103041005])

HSP 1 Score: 223.787 bits (569), Expect = 4.927e-60
Identity = 189/726 (26.03%), Postives = 339/726 (46.69%), Query Frame = 2
Query:  680 QSWITAMATLPNLHKRHLAIARLSTPANLGRSNE---NVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDF--------------------------------RSMLQFQARQ----LAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPC------HRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYY--------------DEKVFQFQP----VNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            ++ +  + ++  L +  +A  RL     L    E    V F+ ++L P        +I  GR+ ST+M+D  F +   + +  QD                                 R ML+ +  Q    LA+  K L ++    D   D       + +  GG++ DI+RR P YLSD+ D         +  +   F+YF+ L P+I FG L G  T+  I V  +I++  I G+VF +LG QPL+V+  + PL ++ +  ++      +++       G +  + +++    +   L+++ ++ T+E+F+F +++ F       +Y+ F++  +  +++ +    F ++S ++      S +SPM +F  S    +S          + ++L L+L  GT ++A +L  F  + +   R R ++ DF +P+AI IM ++      D ++   Y               D++ +   P    V  P+    A +  A L F   +L FM+  I + +V+     L KGS FH DL ++  + G  ++FGLPW+  A   S  HV AL+ + + +  G K    I  V+E RVT +L  I + LS+ ++   L  IPIAVL G+F++M V SL   Q  ER+ LL      +P   Y+R+V   ++HLFT    +Q++ L+AL    S    + FP VL+L +P++  ++P+      +  +D
Sbjct:  468 EATVVLVGSVDFLEQPTMAFVRLQEAVELDSVLEVPVPVRFLFVLLGPPSTNMDYHQI--GRSISTLMSDKSFHEAAYLADERQDLLNAINSFLDCSIVLPPSEMGGEELLRSVAHFQREMLRKREEQEVSLLAKEPKSLEEKGQLADCPEDDPLQRTGRPF--GGMIRDIRRRYPKYLSDFKDALNP-----QCMAAVIFIYFAALSPAITFGGLLGEKTEGLIGVSELIVATCIQGVVFCLLGAQPLLVVGFSGPLLVFEEAFYSFCKSNGLEYLTGRVWIGFWLIIIVVVMVAFEGSFLVRFVSRFTQEIFSFLISLIF-------IYETFSKLAKIFQQHPLQRCSFVNVSVLNE-----SEISPMENFTWSSEATNSSSTIVIKGEPNTALLSLVLMSGTFFIAFYLRKFKNSAFFPGRLRRVIGDFGVPIAILIMVLV------DYSIQETYTQKLSVPSGFSVTSPDKRGWIVNPLGSEVQFPVWMMAASVLPALLVF---ILIFMETQITTLIVSKKERMLIKGSGFHLDLLVIVAMGGICALFGLPWMAAATVRSVTHVNALTVMSKAVAPGDKPR--IQEVKEQRVTGLLVAILVGLSI-VIGDLLRQIPIAVLFGIFLYMGVMSLNGIQLTERMQLLLMPPKYHPDHTYVRKVRTLRMHLFT---ALQVVCLAALWAVMSTSASLAFPFVLILTVPLKMFLLPRIFSTREMQCLD 1157          
BLAST of slc4a-5 vs. Ensembl Cavefish
Match: slc4a2b (anion exchange protein 2-like [Source:NCBI gene;Acc:103041005])

HSP 1 Score: 221.476 bits (563), Expect = 2.605e-59
Identity = 191/733 (26.06%), Postives = 344/733 (46.93%), Query Frame = 2
Query:  680 QSWITAMATLPNLHKRHLAIARLSTPANLGRSNE---NVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDF-------------------------RSMLQFQARQLAETQKILRKRS-------VKVDEVMDQAFSVKTKF--------WIG---GGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPC------HRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYY--------------DEKVFQFQP----VNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            ++ +  + ++  L +  +A  RL     L    E    V F+ ++L P        +I  GR+ ST+M+D  F +   + +  QD                          RS+  FQ       +++LRKR         K  + +++  ++ T F          G   GG++ DI+RR P YLSD+ D         +  +   F+YF+ L P+I FG L G  T+  I V  +I++  I G+VF +LG QPL+V+  + PL ++ +  ++      +++       G +  + +++    +   L+++ ++ T+E+F+F +++ F       +Y+ F++  +  +++ +    F ++S ++      S +SPM +F  S    +S          + ++L L+L  GT ++A +L  F  + +   R R ++ DF +P+AI IM ++      D ++   Y               D++ +   P    V  P+    A +  A L F   +L FM+  I + +V+     L KGS FH DL ++  + G  ++FGLPW+  A   S  HV AL+ + + +  G K    I  V+E RVT +L  I + LS+ ++   L  IPIAVL G+F++M V SL   Q  ER+ LL      +P   Y+R+V   ++HLFT    +Q++ L+AL    S    + FP VL+L +P++  ++P+      +  +D
Sbjct:  474 EATVVLVGSVDFLEQPTMAFVRLQEAVELDSVLEVPVPVRFLFVLLGPPSTNMDYHQI--GRSISTLMSDKSFHEAAYLADERQDLLNAINSFLDCSIVLPPSEMGGEELLRSVAHFQ-------REMLRKREEQEVSLLAKEPKSLEEKEALLTPFKPEDDPLQRTGRPFGGMIRDIRRRYPKYLSDFKDALNP-----QCMAAVIFIYFAALSPAITFGGLLGEKTEGLIGVSELIVATCIQGVVFCLLGAQPLLVVGFSGPLLVFEEAFYSFCKSNGLEYLTGRVWIGFWLIIIVVVMVAFEGSFLVRFVSRFTQEIFSFLISLIF-------IYETFSKLAKIFQQHPLQRCSFVNVSVLNE-----SEISPMENFTWSSEATNSSSTIVIKGEPNTALLSLVLMSGTFFIAFYLRKFKNSAFFPGRLRRVIGDFGVPIAILIMVLV------DYSIQETYTQKLSVPSGFSVTSPDKRGWIVNPLGSEVQFPVWMMAASVLPALLVF---ILIFMETQITTLIVSKKERMLIKGSGFHLDLLVIVAMGGICALFGLPWMAAATVRSVTHVNALTVMSKAVAPGDKPR--IQEVKEQRVTGLLVAILVGLSI-VIGDLLRQIPIAVLFGIFLYMGVMSLNGIQLTERMQLLLMPPKYHPDHTYVRKVRTLRMHLFT---ALQVVCLAALWAVMSTSASLAFPFVLILTVPLKMFLLPRIFSTREMQCLD 1165          
BLAST of slc4a-5 vs. Ensembl Sea Lamprey
Match: slc4a11 (solute carrier family 4 member 11 [Source:ZFIN;Acc:ZDB-GENE-090313-183])

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 325/775 (41.94%), Postives = 482/775 (62.19%), Query Frame = 2
Query:  377 EKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLA---ETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLD----PFYY--DEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPL-SYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDK 2671
            + + +K+FS EVRA  D+++F+ ++ + L++P  S+E  +  ML ++LE     E       +EA+  L + T  +      L++TI+ ++++ + GL   QSW+  + T   L  R + IARL    N G +   V F+ILVL P K K TK+  E+GRTF+TI  DI FRQQL+   + ++F+  L  +   L    E Q+   K SV +    +Q F      W   GI  DI+RR+P+Y SD+ DG      I K      FLYF+CLLPSIAFG LN  NT   IDV++ +++Q++GG++F +L GQPLIV+LTTAPLALY   I TI  E+++DF A +AC G++N+ +L +Y+L  M   +  S +S EE+FA F++IAF VDA KD+ K F Q+Y   E     ++     +N S+     +           +  G     RDV++L LLL +GTVWL   L+ F K PYL+ + RE+L+D A+PL++   S +G+ +FRDI+       F Y   E  F   P+NL  +G  +I S   +GF LS+LFFM+  +A+S+ N+P N+LKKG+++HWDL +VA++N   S+FGLPW+H A PHSPLHV+AL+ +EER++ GH V +T     +TRV  +L+++ + LSLF L      +IP  VLDG+F+++A+TSL  NQ  +R+ LLFTEQ+AYPP+HY+RRVPQRK+H FT  QL+QL +L  +GFSP PYMKM FP+++L  +P+R   +PK I+  +++ MD+
Sbjct:    1 QSVKIKNFSEEVRAGRDVDRFLSQAAVLLDLPSRSLESTLCHMLESVLEDNPCAEP------REARCSL-LKTDCIN-KVHLLSETIQAVTVNPS-GLHYQQSWLCVLCTETTLQHREVCIARLERAQNWGENCCEVRFVILVLAPPKSKSTKTATEVGRTFATIFVDIGFRQQLIEARSPEEFKHALLLRRHDLTAQHEEQEDSSKSSVSIQHPHEQVFGAVV--WPLMGIWEDIRRRLPYYSSDFTDGILRNRCIGKYIIAMIFLYFACLLPSIAFGSLNDINTRGAIDVQKTLVAQSMGGVLFAVLSGQPLIVLLTTAPLALYIYAIRTICDEFELDFHAYYACIGLWNSFFLTLYALLHMSTRLHLSKRSIEEIFALFISIAFVVDAIKDIIKIFKQNYLPGEPGGCGSAG----NNTSDDGWEGAA---------GVDSGGPKGSRDVALLALLLMLGTVWLGSTLYQFRKRPYLHLQAREILSDCAMPLSVIAFSFLGSYVFRDIDRMVTGLKFSYTPSESYFALAPLNLLTVG--SICSAMGIGFLLSILFFMEHTMAASLTNAPHNRLKKGTSYHWDLLLVAVLNATFSLFGLPWMHAAFPHSPLHVRALATVEERVEDGH-VDETQGNSLKTRVPVLLAHMLLGLSLFFLLPLPLQWIPRPVLDGIFLYIALTSLDGNQLFQRLALLFTEQTAYPPTHYVRRVPQRKIHYFTGLQLLQLAVLCGVGFSPIPYMKMVFPVIMLAALPVRFFAVPKIIESRYLDVMDE 748          
BLAST of slc4a-5 vs. Ensembl Sea Lamprey
Match: SLC4A2 (solute carrier family 4 member 2 [Source:HGNC Symbol;Acc:HGNC:11028])

HSP 1 Score: 219.164 bits (557), Expect = 1.749e-59
Identity = 180/685 (26.28%), Postives = 322/685 (47.01%), Query Frame = 2
Query:  785 VHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDF-------------------------RSMLQFQA------RQLAETQKI--------LRKRSV--KVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVF---QFQPVNLPILGWKA-------------ILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            V F+ ++L P++      EI  GR+ ST+M+D DF +   + +  QD                          RS+  FQ       RQ  E++K+        L++ +V  +  E  D    ++    + GG+V D +RR PHYLSD  D         +  +   F+YF+ L P+I FG L    T   + V  +IIS  + G++F +LG QPL+++  + PL ++ +  F+  +   +++       G +  + +++    +   ++++ ++ T+E+F+  +++ F  +    +YK F  H   +    ++N    + S+ SN   +  T +  P   N           + ++L LLL  GT ++A  L  F  + +L  + R ++ DF +P+AI +M ++      D  + P  Y +K+     F   +    GW               + +C   G  + +L FM+  I + +V+     L KGS FH DL ++ ++    +IFGLPW+  A   S  HV AL+ + +    G K    I  V+E R+T +L  I + LS+ +L + L  IP+AVL G+F++M VTSL   QF +R+ L+F     +P + Y  +V   +++L+T    IQ + L  L    S    + FP VL+L +P+R  ++ +   +  +  +D
Sbjct:  338 VRFLFVLLGPSEAHMDYHEI--GRSISTLMSDKDFHEAAYVADERQDLLNAMTEFLDVSIVLPPSELTDDGLLRSVAAFQRDMLQKRRQEDESKKLNIVPTSAELKQTAVPSQRKEDDDPDDPLRRSGRLFGGLVRDARRRYPHYLSDLRDALNP-----QCLAAVIFIYFAALSPAITFGGLLSEKTQGLMGVSELIISTCLQGILFALLGAQPLLIIGFSGPLLVFEEAFFSFCSSQGVEYLTGRVWIGFWMVLIVLLLVAFEGSFMVRFISRFTQEIFSILISLIFIYETFSKLYKVFQDHPLLSTYPVISN--MTTNSDTSNSSIVNGTTAATPKVLN---------QPNTALLSLLLMSGTFFIAFFLRKFKNSRFLAGKVRRVIGDFGVPIAILVMVLV------DFGV-PNTYTQKLNVPDGFSVTSPSKRGWVINPLGAEGTFPVWLMFACVIPGLLVFILIFMESQITTLIVSKKERMLLKGSGFHLDLLLIVVMGAICTIFGLPWLTAATVRSVTHVNALTVMSKATAPGDKPR--IECVKEQRITGLLVAIIVGLSM-VLGQVLRQIPLAVLFGIFLYMGVTSLNGIQFYDRLMLVFMPAKYHPDTAYATKVRTLRMNLYTG---IQFVCLGGLWAVMSTAASLAFPFVLILTVPLRRFLLSRIFTDRELKCLD 991          
BLAST of slc4a-5 vs. Ensembl Sea Lamprey
Match: slc4a7 (solute carrier family 4 member 7 [Source:ZFIN;Acc:ZDB-GENE-140106-104])

HSP 1 Score: 208.764 bits (530), Expect = 8.370e-56
Identity = 165/558 (29.57%), Postives = 263/558 (47.13%), Query Frame = 2
Query: 1049 IGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSK------DVYK-------EFAQHYQCA--EENKVNNSIFKSLSNMSNP--------FQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALL------------FRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIR 2617
            I GG+V DIKR+IP Y SDY D         +  ++  FLY +C+ P I FG L G  T+ +I     +   ++ G+ + +  GQPL ++ +T P+ ++ KI++    +Y + + ++ AC G++ A   ++   TD   L+ + T+ TEE FA  + I F  +A +      + Y+       E    Y C   E +  +N    + SNM+            ++  L     F  +    H P   DV    ++L   T +L+G L  F    Y   + R  ++DFA+ L I  M +I   L            F+         D++ +   P+      W  IL+ A      ++L FMDQ I + ++N   +KLKKG  +H DL  VA++    SI GLPW   A   S  HV +L    E    G +     + +RE RVT ++  + +  S+F+    L +IP+ VL G+F++M  +SL   QF +RI L        P   YLR VP RK+HLFT  Q   L++L  +  SP+  +   FP+++L  + IR
Sbjct:  485 IFGGLVRDIKRKIPFYWSDYRDSLN-----LQCIASFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFAGQPLTILGSTGPVLVFEKILYKFCKDYNLSYLSLRACIGLWTAFLCLLLVATDASSLVCYITRFTEEAFASLICIIFIYEALEKLVHLGETYEVNMHADPELLTQYSCVCVEPSVPSNETLDAWSNMNRSADSIPWGNLTVSKCLELHGQFVGTACGHHGPYIPDVLFWSIILFFATFFLSGFLKQFKTMRYFPTKVRSTVSDFAVFLTILSMVVIDYFLGIPSPKLQVPSEFKPTR------DDRGWIVDPIGPN--PWWTILAAAIPALLCTILVFMDQQITAVIINRKEHKLKKGCGYHLDLLWVAIMLAVCSIMGLPWFVAATVLSISHVNSLKVESECSAPGEQ--PKFLGIREQRVTGLMIFVLMGCSVFMT-GVLKFIPMPVLYGVFLYMGASSLKGIQFFDRIKLFVMPAKHQPDFIYLRHVPLRKVHLFTAVQFTCLVLLWVIKASPAAIV---FPMMVLALVFIR 1023          
BLAST of slc4a-5 vs. Ensembl Sea Lamprey
Match: SLC4A2 (solute carrier family 4 member 2 [Source:HGNC Symbol;Acc:HGNC:11028])

HSP 1 Score: 199.519 bits (506), Expect = 8.722e-53
Identity = 177/690 (25.65%), Postives = 319/690 (46.23%), Query Frame = 2
Query:  785 VHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDF-------------------------RSMLQFQARQLAE------------------TQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQH-----YQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINL-----DPFYY---DEKVFQFQPVNL----PILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDKS 2674
            V F+ ++L P  ++ +    E+GR+ ST+M+D DF +   + +  QD                          RS+  FQ   L +                  T+  L    V++ +V D        F   GG+V D +RR P Y SD  D         +  +   F+YF+ L P+I FG L G  T   I V  +IIS +I  + F +L  QPL+++  + PL ++ +  F+      +++       G +  + +++    +   L+++ ++ T+E+F+  ++I F  +    ++K F +H     Y     +   + ++ + S +     I S  +   +  ++  K   P   + S+L L+L  GT ++A  L     + +L  + R ++ DF +P+AI IM ++ + +           D F     D++ +   P+ +    P+    A +  AAL F   +L FM+  I + +V+    +L KGS FH DL ++ L+ G  ++ G+PW+  A   S  HV AL+ + +    G K    I  V+E R T +L  + I LS+ +L + L  IP+AVL G+F++M VTS+   Q  +R+ L F     +P S Y  +V   +++++T    IQ + L+ L    S    + FP VL+L +P+RH ++P+      +  +D +
Sbjct:  551 VRFLFVLLGP--QQASVDYHEIGRSISTLMSDKDFHEAAYLADERQDLLTAITEFLDCSIVLPPSELTDEGLLRSVAAFQRDMLQKRREEDGRRHPREEPPVQSTRGALVGGGVRLYDVEDPLQRTGRPF---GGVVRDARRRYPFYPSDIKDAVDP-----QCLAAVIFIYFAALSPAITFGGLLGEKTQGLIGVSELIISTSIQSIFFALLSAQPLLIVGFSGPLLVFEEAFFSFCWSQDVEYLTGRLWIGFWLILIVLLTVAFEGSFLVRYISRFTQEIFSILISIIFIYETFYKLFKVFKEHPLLKTYTIGGTDLAGSGVWGNASMV-----IGSATAAARNDTDAPTK--MPSQPNTSLLSLVLMSGTFFIAFFLRKLKNSRFLAGKVRRVIGDFGVPIAILIMVLVDSAIPDTYTQKLAVPDGFSVTSPDQRSWLVNPLGVRSTFPVWMMFACVVPAALVF---ILIFMETQITTLIVSKSERRLVKGSGFHLDLLLIVLMGGASALLGVPWLTAATVRSVTHVNALTVMSKATAPGEKPR--IECVKEQRATGLLVAVLIGLSV-VLGEVLRRIPLAVLFGIFLYMGVTSVNGIQMYDRLLLAFMPAKHHPDSAYASKVKTWRMNMYT---AIQFVCLALLWVVMSTAASLAFPFVLILTVPLRHFLLPRIFTAHELRCLDSA 1214          
BLAST of slc4a-5 vs. Ensembl Sea Lamprey
Match: SLC4A4 (solute carrier family 4 member 4 [Source:HGNC Symbol;Acc:HGNC:11030])

HSP 1 Score: 150.214 bits (378), Expect = 3.582e-39
Identity = 129/448 (28.79%), Postives = 207/448 (46.21%), Query Frame = 2
Query: 1055 GGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSK-------------DVYKEFAQHYQCAEENKVNNSIFK-SLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVN------LPILG---WKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLP 2329
            GG+  DIKR++P + SD  D    A +I+ + S T F+Y + +  +I FG L G+ TD    V    +  A+ G VF +  GQPLI++ +T P+ ++ +++F  S E   D+       G+++A   +I   TD   L+++ T+ TEE F+  ++  F  DA K             D   ++   Y C  +      + K  L N + P     +      +  SL         DV+++ LLL +GT +    L  F    Y     R+L++DF++ L  +I + +G  +   +            +F+P +      +P  G   W   L  A     +++L FMDQ I + +VN   NKLKKGS +H DLF VA++    S  GLPW   A   S  H+ +L    E    G       + VRE R+T +L  +   +S+FL P
Sbjct:    4 GGLFKDIKRKLPFFCSDIYD----ALSIQSL-SATLFIYLATITNAITFGGLLGDATDNMQGVLESFLGTALSGAVFCLFAGQPLIILSSTGPVLVFERLLFNFSKENDFDYLEFRLWIGLWSAFMSLILVATDASYLVQYFTRFTEEGFSALISFIFIYDAIKKMLGLFNYYPINLDYKPDYITLYSCTCQAPDPVLMIKPDLGNATGPDWSALSKKECSKYGGSLSGKACKFVPDVALVSLLLFMGTYYTTMALKRFKTGRYFPTTIRKLISDFSIIL--SIFTFVGLDILIGLETPKLVVPT---EFKPTSAKRGWFVPPFGGNPWWVYLVSAVPAILITILVFMDQQITAIIVNRKENKLKKGSGYHLDLFWVAVLMATCSFLGLPWYVAATVLSIAHIDSLKMETETSAPGE--QPKFLGVREQRITGVLVFVLTGVSVFLAP 439          
BLAST of slc4a-5 vs. Ensembl Yeast
Match: BOR1 (Boron efflux transporter of the plasma membrane; binds HCO3-, I-, Br-, NO3- and Cl-; has similarity to the characterized boron efflux transporter A. thaliana BOR1 [Source:SGD;Acc:S000005219])

HSP 1 Score: 142.895 bits (359), Expect = 4.211e-36
Identity = 122/506 (24.11%), Postives = 214/506 (42.29%), Query Frame = 2
Query: 1049 IGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSII---GALLFRDINLDPFYYDEKVFQFQPVNLPILGW--------KAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKP----LSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQL 2521
            +G GI  D+K RIP+Y SD+ D F       +V  +    YF+ LLP+IAF     + TD    V  V++S A+ G+VFG+LGGQPL ++  T P++++   ++ I       +        +++ ++ ++ + T+   L+++ T                     D++                  +F ++  +    QI +          S+  G +     V V  ++   G  +   H +     P  + R R  ++D++  L++   S     G  L  D+        +  F    VN P   W        K +      G  L++LF+ D N++S M      KLKK S+FH+D  ++ L      + G+P  +G IP +PLH + L        +    +Q ++   E R T+    + I   L  + +P    L  IP AVL GLF  M +  L  N   +R+  LF++ +    +  L +V ++ + +F  F L
Sbjct:   58 LGIGIWLDLKDRIPYYKSDWVDAFN-----YRVIPSIVDTYFNNLLPAIAFAQDMFDRTDNSYGVNEVLLSSAMAGIVFGVLGGQPLCIVGVTGPISIFNYTVYEIIKPLNTSYFGFMFWICMWSMIFHLVLAFTNAVCLLQYVTT-----------------FPCDIF-----------------GLFINVVYIQKGIQILTRQFSAKSGEKSVQDGFA----SVVVALVMTAFGLFFKLFHYY-----PLFSHRIRTFISDYSTALSVLFWSSFTHFGGYL-HDVKFKKLPITKAFFPTSKVNRPQNTWLAYEPIPVKDVFIALPFGIFLTILFYFDHNVSSLMAQRHQYKLKKPSSFHYDFALLGLTTCISGVLGIPAPNGLIPQAPLHTETL--------LVRDSNQKVISCVEQRFTNTFQGLMI---LGTMTRPLLVCLGEIPQAVLSGLFFIMGINGLMTNSIIQRLVFLFSDPNRRDNTSPLMKVSKKSMLIFLSFSL 503          
BLAST of slc4a-5 vs. Ensembl Nematostella
Match: EDO40610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6T5])

HSP 1 Score: 351.288 bits (900), Expect = 5.902e-114
Identity = 183/319 (57.37%), Postives = 239/319 (74.92%), Query Frame = 2
Query: 1712 CHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            C R+   LYLLL++GTV L   L+NF K+P+L+A KRE LAD+ALP+A+   S IG   F   +L  F     V   +P +L +L   A+     LGF LSLLFFMDQNI+S+MVN+P N+LKKGS FH DL +VA+ING LS FGLPWIHGA+PHSPLHV+AL+D+EER+D GH V   IV+VRETR+T+++++I I LSL +LP PL YIP AVLDGLF+ +AVTSL +NQ  ER+ L  TEQSAYPP+HY+RRVPQRK+H +T  Q++QL +L   GFSP PY+KM FP++LLL +PIRH ++P+ I+  F++A+D
Sbjct:    4 CSREAGTLYLLLSLGTVLLGVTLYNFKKSPFLDANKREALADYALPVAVLFFSFIGTYFFSGESLHTFKSSGAV-TLKPSSLSLLSAGAVFGACGLGFCLSLLFFMDQNISSAMVNNPGNRLKKGSAFHLDLLVVAIINGILSAFGLPWIHGALPHSPLHVRALADVEERVDQGH-VFDIIVKVRETRLTTLIAHILIGLSLLMLPTPLDYIPTAVLDGLFLFVAVTSLDDNQMFERLLLFVTEQSAYPPNHYIRRVPQRKMHAYTGMQMLQLGILCGFGFSPMPYLKMVFPVLLLLLLPIRHLVVPRVIERKFLDAID 320          
BLAST of slc4a-5 vs. Ensembl Nematostella
Match: EDO40611 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6T6])

HSP 1 Score: 253.062 bits (645), Expect = 5.341e-73
Identity = 138/339 (40.71%), Postives = 210/339 (61.95%), Query Frame = 2
Query:  359 LVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQ-------KILRKRSVKVDEVMDQ-AFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTK 1351
            L+L + +K+ +K+FS+EVRA  DI++F+++  + L +    +E+II+ ML  I+E    D+   ++    A+T  F   S        L+  I+G  I +  G    Q+W+ AMA LP++ + H+A++RL    NLGR+ +  H ++L+L+P K K TK+ +ELGRTF+T+++DIDFRQ LL  E++++F  +L  +   L+  +       K++R  S   +       F   +      GI  D  RR+PHYLSD+ DG  G  T+ K+ ST  FLYF+C+LPS+AFGVLN  NT  K+DV++V++SQ  GGL F +LGGQPLI++LTTAPLALY K
Sbjct:   14 LMLVKHQKIDMKNFSTEVRARKDIDRFLEKPTVLLNVHKTKIEDIIDLMLDKIIE----DKQLQKVNFSAARTAFFTKDSV-----HCLSHVIQGTEISEGGGWEETQNWLVAMADLPSIQQSHIAMSRLRHATNLGRTLQGTHLVVLILSPVKTKKTKNSLELGRTFATLLSDIDFRQSLLEAESKEEFVKVLAERKSDLSNNRNKPEINSKLVRSASKGFNPYHCVFNFQETSTMKPCRGIRDDFMRRMPHYLSDFKDGVVGHRTLFKLVSTVIFLYFACILPSVAFGVLNSKNTKGKMDVQKVLVSQVFGGLFFSLLGGQPLIILLTTAPLALYIK 343          

HSP 2 Score: 248.44 bits (633), Expect = 2.578e-71
Identity = 144/303 (47.52%), Postives = 188/303 (62.05%), Query Frame = 2
Query: 1712 CHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQ-FCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIR 2617
            C R+   LYLLL++GTV L   L+NF K+P+L+A KRE LAD+ALP+A+   S IG   F   + D                       ++ C++                     +   +LKKGS FH DL +VA+ING LS FGLPWIHGA+PHSPLHV+AL+D+EER+D GH V   IV+VRETR+T+++++I I LSL +LP PL YIP AVLDGL       S +N Q F       F  QSAYPP+HY+RRVPQRK+H +T  Q++QL +L   GFSP PY+KM FP++LLL +PIR
Sbjct:  404 CSREAGTLYLLLSLGTVLLGVTLYNFKKSPFLDANKREALADYALPVAVLFFSFIGTYFFSGESCDIV--------------------VVVLCSS---------------------THIQELKKGSAFHLDLLVVAIINGILSAFGLPWIHGALPHSPLHVRALADVEERVDQGH-VFDIIVKVRETRLTTLIAHILIGLSLLMLPTPLDYIPTAVLDGL------ASSHNAQVFALLENNCFLLQSAYPPNHYIRRVPQRKMHAYTGMQMLQLGILCGFGFSPMPYLKMVFPVLLLLLLPIR 658          
BLAST of slc4a-5 vs. Ensembl Nematostella
Match: EDO45844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRK7])

HSP 1 Score: 206.453 bits (524), Expect = 3.254e-55
Identity = 187/688 (27.18%), Postives = 323/688 (46.95%), Query Frame = 2
Query:  698 MATLPNLHKRHLAIARLSTPANLGRSNE---NVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDF---------RQQLLMIENE---------------QDFRSMLQFQARQLAETQKILRKRSVKVDEVMDQAFS-----VKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYY--DEKVFQFQPVNLPILGW-----------KAILSCAAL--GFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRH 2620
            + TL  L     A  RL+    LG   E    V F+ ++L P  +  T  EI  GR+ +T+M+D  F         R+ +LM  NE               Q    +L  Q++ +A+     RK++ +++ +  QA       +K      GG++ DIK R   Y+SD+ DGF       +    T FLYF+   P++AFG L    TD+ + V  VI +    GL+F +  GQPLI++  T P+ ++ + IF    +  I+F       G +  V L +    + C L+++ T+ TEE+FA  +++ F       +Y+     Y+  ++N ++     +L+N+ +P+ I   + P+    N+            ++L  +L  GT ++A ++  F  + +   + R L++DF + +A+  M II   + RD  + P     D     F P      GW           KA    AA+     + +L FM+  +   ++N   N L+K   ++ DL ++ +I    S+FGLPW+  A   S  H  ALS        G K +  +V VRE R+T+IL ++   +S+ L P  L ++P+ VL G+ +++ ++SL N Q   R+ ++      +P   Y+R+VP  K+H +T  QL  L++L A+  +    +   FP  ++  IP+R 
Sbjct:  247 VGTLDCLKNPVTAFVRLAKGCYLGNVTEVAIPVRFLFVMLGPETQSDTYHEI--GRSIATLMSDQVFHDLAYYSESREDILMAINEFLDDTVVLPPGEWDKQLLIPVLLSQSKTMAKR----RKQAKEINAIATQAAEEEDNPLKRTGRFCGGLIQDIKHRSKTYISDFKDGFNW-----QCLLVTVFLYFAVFAPNVAFGGLLAEKTDQWLGVSEVIFASCFCGLLFALFSGQPLIIIGATGPVMVFEQTIFKFCEQSNIEFLPWRCWIGFWVLVILFLVVAFEGCFLVRYFTRFTEELFACLISLIF-------IYEAINFLYKVFKKNPLSRDPVTNLTNI-DPY-IKENIVPVTGEPNT------------ALLCAILMFGTYFVAFYMRKFRNSHFFGKKARRLVSDFGIAIAMITMVIIDVAI-RDTVITPKISIGDVTKVGFHPTLKTKRGWFINPMGLVDSMKAGWVFAAIIPALFVGILLFMETELTGVLINKKENCLQKRPGYNMDLLLMGVITLICSLFGLPWMCPATVRSVSHFNALSVWSTSHAPGEKPY--LVEVREQRITNILIHVLTGMSILLAPV-LHHVPVPVLFGVLLYLGLSSLSNLQLINRLIMMLMPPKHHPDVRYVRKVPTAKIHGYTLIQLACLLVLMAVKLT---ILAPSFPFFIICLIPVRR 895          
BLAST of slc4a-5 vs. Ensembl Nematostella
Match: EDO31793 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWX4])

HSP 1 Score: 201.06 bits (510), Expect = 1.362e-53
Identity = 186/691 (26.92%), Postives = 319/691 (46.16%), Query Frame = 2
Query:  737 IARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDF--------------------RSMLQFQARQLA-ETQKI-LRKRS-----------VKVDEVMDQAFSV-----KTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDM--CKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTI---GTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSII----GALLFRDINL-DPFYYDEKVFQFQPVNLPI-----LGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFS-PSPYMKMGFPIVLLLQIPIRHKIIPKFIDE 2647
            +AR     NL   N  V F+ ++L P  +     E+  GR  +T+M+D  F       E  QD                     R++L      LA ET+K  LR+R            ++  E + ++  +     K      GG++ D+KRR P+Y SD  D F       +    T  +Y +CL P+I+FG L    T   + V  +I+S A+ G++F +  GQPLI++  T PL L+   +F +S  +  ++    A  GI+  V L+ ++L  M  C L+++ T+ TEE+FA  +++ F  D  K +Y  F                          + +TS  +   D             +DVS   L  TI   GT ++A  + +   + +LN   R +++DF + +AI  M ++     ++  + +N+ D F       +   VN P+     LG  AI         +S+L FM+    + +++   N+LKKG  ++ DLF+V  + G  S+ GLPW+     H+  H+ AL  +    +     H  ++ V+E RVT+I+ ++ I L++ L P  +   P+ VL G+F+H+  +SL + QF ER  LLF   + +P   Y+R V   K++ FT  Q++ L+ L A+  +  +P+    FP  ++  +P+R  +   + D+
Sbjct:  224 LARGCRLRNLAEVNIPVRFLFILLGPDDKSIDYHEV--GRCVATLMSDRLFLDCAYDAEELQDLYDAMDSFLSDTVIIPPGEWDRNVLAQSLPSLAKETKKTALRRRGALLRKQRHFSDLETQETVTESLELEDDPLKRTGLFCGGLLRDVKRRFPYYKSDMTDSFNW-----RCVMATILVYVACLAPAISFGGLLYKKTKGWMGVAEMIVSTALSGVIFALFAGQPLIIIGATGPLLLFETNVFNLSESFDFEYMPWRAWVGIW--VMLICWALVAMEGCFLIRYFTRFTEEIFACMISLIFIYDGIKYIYDIFGL------------------------YPLTSGTTENVD------------GKDVSNTALFTTILFFGTFFVAHIIRDVRHSRFLNHTLRRVISDFGVLIAIVAMILVELSAQSIYVQRLNVPDGFDVTSPHLRGWYVN-PMGTERRLGADAIFGALVPAILVSILVFMEVEFCNVILDKKDNQLKKGPGYNLDLFVVGFLMGMCSVLGLPWMCATPVHTVSHLHAL--MVHSTNHAPGEHPQLLEVKEQRVTNIIIHVLIGLTMLLAPV-IRLTPVVVLFGVFVHLGFSSLSHLQFVERFKLLFVSPNHHPDRRYVRSVSTGKMNAFTLVQVVCLLFLVAIKVTVVAPF----FPFFVICLVPLRRMLERFYTDQ 861          
BLAST of slc4a-5 vs. Ensembl Nematostella
Match: EDO27089 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TA82])

HSP 1 Score: 54.6842 bits (130), Expect = 4.735e-9
Identity = 23/82 (28.05%), Postives = 49/82 (59.76%), Query Frame = 2
Query: 1253 IISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEE 1498
            ++  AIGG++F +  GQPLI++  T P+ ++ +I++T      +++ +     GI+  ++ +I  +TD   ++ + T+ TEE
Sbjct:    5 MLGGAIGGILFALFSGQPLIILGATGPMLVFEEIVYTFCERVGLEYLSFRLWIGIWTMLFCLILVVTDASAMICYFTRFTEE 86          
BLAST of slc4a-5 vs. Ensembl Medaka
Match: slc4a11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:101165271])

HSP 1 Score: 543.117 bits (1398), Expect = 2.988e-180
Identity = 306/765 (40.00%), Postives = 483/765 (63.14%), Query Frame = 2
Query:  389 LKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQL-AETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGAN-TIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNM--SNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPF-YYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L +F  EVRA  D++ F+ ++ + L+    S++++++RML ++ +     E S     +E  + LF        +   L++TI+G++   T G+   QSW+  +  + +L +RH+ I+RL  P N G +   V ++IL+L P+K K TK+ +ELGRTF+T+ +DI FRQ+LL  + +++F+  L FQ  QL A  Q+       + D    +    K  F +G GI  D  RR+P Y SD+ DG  G+N T+ K  +T  FLY + LLP+IAFG LN  +T  +IDV++ I+ Q+IGG+++ +  G PL++ LTTAPLA++  +I  I  +Y +DF A +AC G++N ++L++  + ++  LMK   +STEEV A F++IAF VDA K   K F ++Y        +   F+    +   N  ++ + L       N+L +    C R+  VL LLL +GT+W+   L+ F ++P+L+A+ RE+L+D ALP+++ + S IG+ +F DI L  F  ++  +F   P     L    ++S   LGF L+LL F+DQNI  S+ N+P N+L KG+ +HWDL +  LIN  +S+ GLPW+H A PHS LHV+ L+ +E+R++ GH +++TIV+V+ETR+TS+ +NIFI +SL LLP PL +IP  VL GLF+++A+TS+  NQ C+R+ LL  EQ++YPP+HY+R+VPQRK+H FTF Q++QL++L   G  P PYMKM FP+V++  IPIR+ ++P  I+  +++ MD
Sbjct:   87 LMNFEEEVRALRDLDGFLAKASILLDETAASLDDVLKRMLHHVGQDGHAYEPSCNF--EEVMSLLFTDAGAQEVNVHLLSETIQGVTATAT-GIQYQQSWLCILCNVKHLQRRHVCISRLERPQNWGENCCEVRYVILILAPSKMKSTKTAMELGRTFATLFSDISFRQKLLETKTQEEFKEALLFQRHQLTAANQQPTALGKEETDPRSHKPLKCKDFFKVGRGIYEDFCRRLPFYPSDFTDGIVGSNKTLLKYMTTAIFLYIAILLPAIAFGSLNDESTRGEIDVRKTIVGQSIGGIIYSLFAGSPLVIPLTTAPLAIFISVIRGICDDYNLDFPAFYACIGLWNCLFLILGGIFNVSLLMKLFKRSTEEVIALFISIAFVVDAVKGTVKIFQRYYNAPTSTNRSLEDFRQGGELLEGNRSEVAARL-----MLNALPETIIQCSRERPVLCLLLMLGTLWMGYTLYQFKRSPFLHAKVREVLSDCALPISVLLFSFIGSYIFSDIELPVFKVHNRPIFNVAPFER--LSAMNVVSAMGLGFLLALLIFIDQNIVVSLTNAPENRLLKGTAYHWDLMLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAFVEQRVEGGH-LYETIVQVKETRLTSLAANIFIGVSLLLLPVPLQWIPKPVLYGLFLYIALTSIDGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMMQLLVLCTFGMYPIPYMKMIFPLVMIFLIPIRNNVLPHIIEAKYLDIMD 840          
BLAST of slc4a-5 vs. Ensembl Medaka
Match: slc4a11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:101165271])

HSP 1 Score: 541.962 bits (1395), Expect = 7.389e-180
Identity = 306/765 (40.00%), Postives = 483/765 (63.14%), Query Frame = 2
Query:  389 LKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQL-AETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGAN-TIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNM--SNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPF-YYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L +F  EVRA  D++ F+ ++ + L+    S++++++RML ++ +     E S     +E  + LF        +   L++TI+G++   T G+   QSW+  +  + +L +RH+ I+RL  P N G +   V ++IL+L P+K K TK+ +ELGRTF+T+ +DI FRQ+LL  + +++F+  L FQ  QL A  Q+       + D    +    K  F +G GI  D  RR+P Y SD+ DG  G+N T+ K  +T  FLY + LLP+IAFG LN  +T  +IDV++ I+ Q+IGG+++ +  G PL++ LTTAPLA++  +I  I  +Y +DF A +AC G++N ++L++  + ++  LMK   +STEEV A F++IAF VDA K   K F ++Y        +   F+    +   N  ++ + L       N+L +    C R+  VL LLL +GT+W+   L+ F ++P+L+A+ RE+L+D ALP+++ + S IG+ +F DI L  F  ++  +F   P     L    ++S   LGF L+LL F+DQNI  S+ N+P N+L KG+ +HWDL +  LIN  +S+ GLPW+H A PHS LHV+ L+ +E+R++ GH +++TIV+V+ETR+TS+ +NIFI +SL LLP PL +IP  VL GLF+++A+TS+  NQ C+R+ LL  EQ++YPP+HY+R+VPQRK+H FTF Q++QL++L   G  P PYMKM FP+V++  IPIR+ ++P  I+  +++ MD
Sbjct:   85 LMNFEEEVRALRDLDGFLAKASILLDETAASLDDVLKRMLHHVGQDGHAYEPSCNF--EEVMSLLFTDAGAQEVNVHLLSETIQGVTATAT-GIQYQQSWLCILCNVKHLQRRHVCISRLERPQNWGENCCEVRYVILILAPSKMKSTKTAMELGRTFATLFSDISFRQKLLETKTQEEFKEALLFQRHQLTAANQQPTALGKEETDPRSHKPLKCKDFFKVGRGIYEDFCRRLPFYPSDFTDGIVGSNKTLLKYMTTAIFLYIAILLPAIAFGSLNDESTRGEIDVRKTIVGQSIGGIIYSLFAGSPLVIPLTTAPLAIFISVIRGICDDYNLDFPAFYACIGLWNCLFLILGGIFNVSLLMKLFKRSTEEVIALFISIAFVVDAVKGTVKIFQRYYNAPTSTNRSLEDFRQGGELLEGNRSEVAARL-----MLNALPETIIQCSRERPVLCLLLMLGTLWMGYTLYQFKRSPFLHAKVREVLSDCALPISVLLFSFIGSYIFSDIELPVFKVHNRPIFNVAPFER--LSAMNVVSAMGLGFLLALLIFIDQNIVVSLTNAPENRLLKGTAYHWDLMLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAFVEQRVEGGH-LYETIVQVKETRLTSLAANIFIGVSLLLLPVPLQWIPKPVLYGLFLYIALTSIDGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMMQLLVLCTFGMYPIPYMKMIFPLVMIFLIPIRNNVLPHIIEAKYLDIMD 838          
BLAST of slc4a-5 vs. Ensembl Medaka
Match: slc4a11 (solute carrier family 4 member 11 [Source:NCBI gene;Acc:101165271])

HSP 1 Score: 538.88 bits (1387), Expect = 2.094e-178
Identity = 307/774 (39.66%), Postives = 486/774 (62.79%), Query Frame = 2
Query:  389 LKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILE--------CEITDEISLEMWIKEAKTKLFMHTSFLTYS-YQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQL-AETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGAN-TIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNM--SNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPF-YYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            L +F  EVRA  D++ F+ ++ + L+    S++++++RML ++ +        C   + +SL      A+       SF+ +     L++TI+G++   T G+   QSW+  +  + +L +RH+ I+RL  P N G +   V ++IL+L P+K K TK+ +ELGRTF+T+ +DI FRQ+LL  + +++F+  L FQ  QL A  Q+       + D    +    K  F +G GI  D  RR+P Y SD+ DG  G+N T+ K  +T  FLY + LLP+IAFG LN  +T  +IDV++ I+ Q+IGG+++ +  G PL++ LTTAPLA++  +I  I  +Y +DF A +AC G++N ++L++  + ++  LMK   +STEEV A F++IAF VDA K   K F ++Y        +   F+    +   N  ++ + L       N+L +    C R+  VL LLL +GT+W+   L+ F ++P+L+A+ RE+L+D ALP+++ + S IG+ +F DI L  F  ++  +F   P     L    ++S   LGF L+LL F+DQNI  S+ N+P N+L KG+ +HWDL +  LIN  +S+ GLPW+H A PHS LHV+ L+ +E+R++ GH +++TIV+V+ETR+TS+ +NIFI +SL LLP PL +IP  VL GLF+++A+TS+  NQ C+R+ LL  EQ++YPP+HY+R+VPQRK+H FTF Q++QL++L   G  P PYMKM FP+V++  IPIR+ ++P  I+  +++ MD
Sbjct:   87 LMNFEEEVRALRDLDGFLAKASILLDETAASLDDVLKRMLHHVGQDGHAYEPSCNFEEVMSLLFTDAGAQEVNDNSQSFVFFDDVHLLSETIQGVTATAT-GIQYQQSWLCILCNVKHLQRRHVCISRLERPQNWGENCCEVRYVILILAPSKMKSTKTAMELGRTFATLFSDISFRQKLLETKTQEEFKEALLFQRHQLTAANQQPTALGKEETDPRSHKPLKCKDFFKVGRGIYEDFCRRLPFYPSDFTDGIVGSNKTLLKYMTTAIFLYIAILLPAIAFGSLNDESTRGEIDVRKTIVGQSIGGIIYSLFAGSPLVIPLTTAPLAIFISVIRGICDDYNLDFPAFYACIGLWNCLFLILGGIFNVSLLMKLFKRSTEEVIALFISIAFVVDAVKGTVKIFQRYYNAPTSTNRSLEDFRQGGELLEGNRSEVAARL-----MLNALPETIIQCSRERPVLCLLLMLGTLWMGYTLYQFKRSPFLHAKVREVLSDCALPISVLLFSFIGSYIFSDIELPVFKVHNRPIFNVAPFER--LSAMNVVSAMGLGFLLALLIFIDQNIVVSLTNAPENRLLKGTAYHWDLMLSGLINILMSVLGLPWMHAAFPHSTLHVRQLAFVEQRVEGGH-LYETIVQVKETRLTSLAANIFIGVSLLLLPVPLQWIPKPVLYGLFLYIALTSIDGNQMCDRMALLLKEQTSYPPTHYIRKVPQRKIHYFTFLQMMQLLVLCTFGMYPIPYMKMIFPLVMIFLIPIRNNVLPHIIEAKYLDIMD 851          
BLAST of slc4a-5 vs. Ensembl Medaka
Match: SLC4A11 (sodium bicarbonate transporter-like protein 11 [Source:NCBI gene;Acc:101168050])

HSP 1 Score: 494.582 bits (1272), Expect = 1.658e-163
Identity = 282/678 (41.59%), Postives = 416/678 (61.36%), Query Frame = 2
Query:  701 ATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQ-KILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGAN-TIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSP-------------------CHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPF-YYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMD 2668
            +T+ NL +R + IARL  P N G +     ++IL+L P + K TK+ IELGRTF+T+ +DI FR++LL    + +F+  L  Q RQL+E     + +   + D    +    +  F  G G+  D++RR+P Y SD+ DG  G +  + K  +T  FLY + LLP+IAFG LN  +T  +IDV++ I+ Q+IGG+++ +  G PL++ LTTAPLA++  II  I  +Y +DF A +AC G++N  +L++  L ++  LMK   +STEEV A F++IAF  DA K   K F  ++        N+S    L  ++   +  +  +P    H   HKG                      C R+  +L LLL +GT+WL   L+   ++PYLN + RE+++D ALP+++ I S IG+ LF DI L  F  +D  VF++       L   A+LS   LGF L+LL F+DQNI  S+ + P +KL KG+TFHWDL +   IN  +S  GLPW+H A PHS LH + L+ +E  ++ GH +H TIV V+ETRVTS+++NI I LS F+LP PL +IP  VL GLF+++A TSL  NQ  +R+TLL  EQ++YPP+HY+RRVPQRK+H FT  Q++QLI+L A G  P PYMKM FP++++L +P+R  ++P+ ID  +++ MD
Sbjct:   13 STVKNLQRRQVCIARLDKPQNWGVNCAEARYVILILAPPRTKSTKTAIELGRTFATMFSDISFREKLLDPRTQDEFKQELVSQRRQLSEVNANTIVEEVEESDPRRGKPLECRDFFKAGRGVYNDLRRRLPLYPSDFTDGITGKDRCLVKYITTAIFLYIAILLPAIAFGSLNDESTRGEIDVQKTIVGQSIGGVIYSLFAGSPLVIPLTTAPLAIFISIIRGICDDYNLDFEAFYACIGLWNCFFLVLGGLFNVSLLMKLFKRSTEEVIALFISIAFVGDAIKGTIKIFDHYFHGPILATTNSS--AVLQQINEILEKANNQTPHLTEH---HKGDMSQFEQAETQVLVFLPETLVICTRERPILCLLLMLGTLWLGYALYLMKRSPYLNDKIREVVSDCALPISVMIFSFIGSYLFIDIQLPVFNVHDGPVFKYP--EFEKLSGMAVLSAVGLGFLLALLIFIDQNIVISLTHVPEHKLLKGTTFHWDLVLTGFINILMSCLGLPWMHAAFPHSSLHARQLAKVEHHLENGH-LHSTIVSVKETRVTSLVANILIGLSAFMLPIPLQWIPKPVLYGLFLYVAATSLDGNQMVDRMTLLLKEQTSYPPTHYIRRVPQRKVHYFTALQMLQLIILCAFGMYPLPYMKMVFPLLMILLVPVRTGLLPRLIDAKYLDIMD 682          
BLAST of slc4a-5 vs. Ensembl Medaka
Match: slc4a1a (band 3 anion exchange protein [Source:NCBI gene;Acc:101155769])

HSP 1 Score: 219.935 bits (559), Expect = 2.254e-59
Identity = 182/698 (26.07%), Postives = 329/698 (47.13%), Query Frame = 2
Query:  680 QSWITAMATLPNLHKRHLAIARLSTPANLGRSNEN---VHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSML-------------QFQARQLAE-----TQKILRKR------------SVKVDEVMDQAFS---VKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFH-NSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQ--FQPVNLPILGW-------------KAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIR 2617
            ++ I     L  L K  +A  RLS    +    E    V F+ +++ P++     SE   GR    +MAD  F  ++ + + ++D  + +             + Q   + E      +K+LR R             VK DE  ++       +T +  GG +V D+KRR  HY SD+ DG        +V S   F+YF+ L P+I FG L  + T + + V  ++I+ ++ G+VF +   QP++++  + PL L+ +          I++       G++  + +++    +   L+++ ++ T+E+F+  +++ F  +    + + FA H      +++N++    L +  +P   T T++P P  +   + + H     + ++L + L  G  ++A  L  F  + YL    R L+ +F +P+AI IM  I      DI++   Y  + V     +  N    GW               + +C      + +L FM+  I + +V+ P  K+ KGS FH+DL ++  + G  SIFG+PW+  A   S  HV AL+ + +    G K    I +V E R++ ++  + + +S+F+ P  L  IP+  L G+F++M +TSL   Q  +R+ LL T +  +P   Y  RV   ++HLFT  Q++ L +L A+  SP     +  P VL+L IP+R
Sbjct:  209 EASIVLTGVLDLLQKPVVAFVRLSDSVVMESVLETHVPVRFVFVLVGPSQSGMDYSET--GRAMGALMADWVFCLEVFLAQTDKDVTNAIADFMDCSIIIPPTEIQETSMLEPIIDFQKKMLRDRLRPADARLAFGDRVKADEGPEEVREDPLARTGYPFGG-MVKDVKRRYRHYFSDFTDGLNP-----QVLSAIIFIYFAALSPAITFGGLLADKTKKMMGVSELMIATSLQGIVFCLFAAQPVLIIGFSGPLLLFEEAFHVFCDSQNIEYIVGRTWVGMWLILIVVVIVAVEGSFLVRYISRFTQEIFSILISLIFIYETFAKLLRIFATHPLVLNYDQINHT----LEDPFHPIIKTFTVTPHPGGNITVIQEEHERAFPNTALLSMCLMFGCFFIAFFLREFKNSQYLPGWLRRLIGNFGVPIAIFIMIAI------DISIADAYTQKLVVPKGIEVTNPKERGWIINPMGEKKDFPAWMMGACCVPALLVFILIFMESQITTLIVSKPERKMIKGSGFHFDLLLLVTMGGIFSIFGMPWLSAATVRSVTHVNALTVMSK----GPK--PVIEKVVEQRISGLIVALLVGVSIFMEPI-LKMIPMTALFGVFLYMGITSLSGVQMWDRMLLLITPKKYHPSDPYATRVKTLRMHLFTLVQVVCLAVLWAVKMSP---FSLALPFVLILTIPLR 878          
BLAST of slc4a-5 vs. Planmine SMEST
Match: SMESG000061700.1 (SMESG000061700.1)

HSP 1 Score: 1772.67 bits (4590), Expect = 0.000e+0
Identity = 876/876 (100.00%), Postives = 876/876 (100.00%), Query Frame = 2
Query:   50 MFSTHSEANSELGEDCNEATPFTESQYETKSQHLSLSPNFLSHNTSHHSIVLENLNNVTDRRTSNLSQFNNSDGYPDNISMLSGVSGIGLRNLSLFYNSPPPYLVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDKSS 2677
            MFSTHSEANSELGEDCNEATPFTESQYETKSQHLSLSPNFLSHNTSHHSIVLENLNNVTDRRTSNLSQFNNSDGYPDNISMLSGVSGIGLRNLSLFYNSPPPYLVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEVFAFFVAIAFTVDASKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDKSS
Sbjct:    1 MFSTHSEANSELGEDCNEATPFTESQYETKSQHLSLSPNFLSHNTSHHSIVLENLNNVTDRRTSNLSQFNNSDGYPDNISMLSGVSGIGLRNLSLFYNSPPPYLVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEVFAFFVAIAFTVDASKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDKSS 876          
BLAST of slc4a-5 vs. Planmine SMEST
Match: SMESG000009949.1 (SMESG000009949.1)

HSP 1 Score: 938.332 bits (2424), Expect = 0.000e+0
Identity = 477/821 (58.10%), Postives = 617/821 (75.15%), Query Frame = 2
Query:  230 RRTSNLSQFNNSDGYP-DNISMLSGVS-GIGLRNLSLFYNSPPPYLVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITD-EISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHY-QCAEENKVNNSIFKSLSNMSNPFQITSTLSPM---PDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDK 2671
            RR S   Q +++     DN+S +SG +    L+N     +   P L LSRLEK+P+KDFS+EVRA+LDI+KF+KE+VL L+M    +EEII+ ML+ IL  E+TD ++SLE  ++EAK  LF+ +S+LTY+YQRLAKTI+G+S+ +TEGL  DQSW+  M +L  +HKRH+AIARL+ P N+GRS+E ++FIILV+ PTKEKGTKS+IELGRTF+TI AD++FRQQLL  E+ + F+ +LQ+ +  L E Q + R++S+KV EVM+QAF    K+ +G GIV D K+R P YL D+ DGF+G  TIRKV S T FLYF+CLLPSIAFGVLN NNT+ KIDV+RVIISQAIGGL FG   GQPLI++LTTAPLAL+ KII +I  +Y +DF AM++C G+ N++ L++Y++ D+ KLM+WST+S+EE+FA FVAI+F VDA KD+YKEF+ HY  C       ++    LS     F    +   +       NS     + C R+VS+LYL L  GTVWLA  LF  TKTP+LN  KRE+L DFALPLA+ IMS+IG  LF++I + PF   E+  +F+   +  L W AI    AL FPLSLL FMDQNI+S+MVNSP+NKLKKGS++HWDL +VALIN  LS+FGLP +HGA+PHSPLHVKAL+D+EERID  H VHQTIV+VRETR+TSILS++FI +SL +LP PL YIP+AVLDGLF++MAVT+LY NQF ERI LLFTEQSAYPPSHYLRRVPQRKLH+FT  Q+ QL  L  LGFSPSPY+KMGFP++LL  +  RH+++P+ IDE ++NA+DK
Sbjct:   93 RRLSRQRQGSSASNVSVDNMSNISGSTLAYCLQNADETEDDSVPCLFLSRLEKIPMKDFSAEVRATLDIQKFLKEAVLLLDMSGSCLEEIIDSMLLTILANEVTDAKVSLEALVEEAKKTLFIQSSYLTYTYQRLAKTIRGLSLSETEGLMTDQSWLCTMCSLNCIHKRHVAIARLNNPVNMGRSSEGIYFIILVVTPTKEKGTKSDIELGRTFATIFADVEFRQQLLFSESVEQFKELLQYHSGDLMEDQAMNRRKSLKVQEVMNQAFHFDKKYLVGSGIVSDFKKRFPVYLMDFRDGFRGKGTIRKVISATIFLYFACLLPSIAFGVLNYNNTEGKIDVRRVIISQAIGGLCFGFFSGQPLIILLTTAPLALFVKIISSICNDYDLDFFAMYSCVGLINSLLLILYAMFDISKLMRWSTRSSEEIFALFVAISFVVDAVKDIYKEFSTHYFSCYLSANNQSTDHLRLSRFKRAFSGIISNISISLTQTNLNSSLYSSNSCQREVSILYLFLVAGTVWLAIQLFTSTKTPFLNNAKREMLTDFALPLAVVIMSLIGTYLFKEIEMQPFVIVEEKVKFEASGILKLPWLAIAGAIALAFPLSLLMFMDQNISSAMVNSPANKLKKGSSYHWDLLVVALINAGLSVFGLPLVHGALPHSPLHVKALADLEERIDTAHHVHQTIVKVRETRITSILSHVFIGISLQMLPIPLIYIPVAVLDGLFVYMAVTTLYGNQFFERILLLFTEQSAYPPSHYLRRVPQRKLHIFTGLQIFQLAGLCLLGFSPSPYLKMGFPLLLLFHMVFRHQVVPRVIDEKYLNALDK 913          
BLAST of slc4a-5 vs. Planmine SMEST
Match: SMESG000039045.1 (SMESG000039045.1)

HSP 1 Score: 875.544 bits (2261), Expect = 0.000e+0
Identity = 452/802 (56.36%), Postives = 596/802 (74.31%), Query Frame = 2
Query:  302 VSGIGLRNLSLFYNSPP------PYLVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEIS-LEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENK----VNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPF-YYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDK 2671
            VS   + +L+ +Y +        P LVL+RLEK+P+KDFSSEVRA+LD+EKF+KE VL L+M    ++ I+E +L  I    +   I  ++ +I EAK  LFM   +  +SYQRLAKT+KGI I++ EGL+ DQSWI+AM +L  +HKRH+AIARL TP NLGRS+E V+F++LV+ P KEK TKS+IEL RTF+T+++D++FR QLL  + E +F+ MLQ  AR LAE Q++ R+RS+++ EVM+QAF+ + KF +G GIV D+++RIP Y+SDY DG +G  TIRK+ S  +FLYF+CLLPS+AFGVL   NTD KI+VKRVI+SQ +GGL F ++GGQPLIVMLTTAPL LY K+I+ IS +Y + F  MF+  GIFN+++L++YSL D+ KLM+WST+STEE+FA F++IAF VDA KDV K F + Y     NK    VN ++ K L N +N F   +T                   ++  +L+LLL IGTVWL  +  NFTKTP+LN+ KR L+AD++LPLA+ IMS IG+ LF+DI +D F    E+ F  + VN   +   A+ +   L FPLSLLFFMDQN+ S+MVN PSNKLKKGS +HWDL IVA+IN  LS+FGLPW+HG +PHSPLHVKAL+D+EERID GH++++TIV+VRETR+T ++S+I I LSL LLP PL Y+PIAVLDGLF++MA+T+LY NQ  ER+ LLFTEQ+AYPPSHYLRRVPQRK+HLFT  QL QL +L ALGF+P+PY K+GFPI+LLLQ+PIRH I PKFI   +I+A+DK
Sbjct:   80 VSNFSIGSLARYYRTADENGEGLPCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNSIFLILYSLLDLSKLMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITT---------------EESRKENGLLFLLLLIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRLTGLISHILIGLSLLLLPIPLIYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHLFTVLQLTQLGLLCALGFAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDK 866          
BLAST of slc4a-5 vs. Planmine SMEST
Match: SMESG000039045.1 (SMESG000039045.1)

HSP 1 Score: 873.233 bits (2255), Expect = 0.000e+0
Identity = 448/779 (57.51%), Postives = 587/779 (75.35%), Query Frame = 2
Query:  353 PYLVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEIS-LEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQARQLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENK----VNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPF-YYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDK 2671
            P LVL+RLEK+P+KDFSSEVRA+LD+EKF+KE VL L+M    ++ I+E +L  I    +   I  ++ +I EAK  LFM   +  +SYQRLAKT+KGI I++ EGL+ DQSWI+AM +L  +HKRH+AIARL TP NLGRS+E V+F++LV+ P KEK TKS+IEL RTF+T+++D++FR QLL  + E +F+ MLQ  AR LAE Q++ R+RS+++ EVM+QAF+ + KF +G GIV D+++RIP Y+SDY DG +G  TIRK+ S  +FLYF+CLLPS+AFGVL   NTD KI+VKRVI+SQ +GGL F ++GGQPLIVMLTTAPL LY K+I+ IS +Y + F  MF+  GIFN+++L++YSL D+ KLM+WST+STEE+FA F++IAF VDA KDV K F + Y     NK    VN ++ K L N +N F   +T                   ++  +L+LLL IGTVWL  +  NFTKTP+LN+ KR L+AD++LPLA+ IMS IG+ LF+DI +D F    E+ F  + VN   +   A+ +   L FPLSLLFFMDQN+ S+MVN PSNKLKKGS +HWDL IVA+IN  LS+FGLPW+HG +PHSPLHVKAL+D+EERID GH++++TIV+VRETR+T ++S+I I LSL LLP PL Y+PIAVLDGLF++MA+T+LY NQ  ER+ LLFTEQ+AYPPSHYLRRVPQRK+HLFT  QL QL +L ALGF+P+PY K+GFPI+LLLQ+PIRH I PKFI   +I+A+DK
Sbjct:   72 PCLVLARLEKIPIKDFSSEVRATLDVEKFLKEVVLILDMEANDVDTIVEHLLREIYPLAMDVSIGQMDTFITEAKNALFMKAHYENFSYQRLAKTLKGILINENEGLSTDQSWISAMCSLTCVHKRHVAIARLKTPVNLGRSSEGVYFVMLVITPKKEKDTKSDIELSRTFATLLSDMEFRSQLLFAQTEDEFKEMLQNHARDLAEEQRLYRRRSIRITEVMNQAFAYEEKFPLGNGIVDDLRKRIPVYISDYKDGIQGPGTIRKLVSAATFLYFACLLPSMAFGVLYDQNTDGKINVKRVILSQTVGGLCFALIGGQPLIVMLTTAPLTLYIKVIYAISAKYSLHFYTMFSWVGIFNSIFLILYSLLDLSKLMRWSTRSTEEIFALFISIAFIVDAVKDVLKVFYKSYVTTLVNKTVPIVNTTLAKGLLNSTNEFITITT---------------EESRKENGLLFLLLLIGTVWLGIYFLNFTKTPFLNSSKRLLMADYSLPLAVLIMSFIGSYLFKDIKIDTFKTRSEEEFSIKFVNFSQISISAVFAALGLAFPLSLLFFMDQNVTSAMVNCPSNKLKKGSAYHWDLLIVAIINLVLSLFGLPWVHGTLPHSPLHVKALADLEERIDSGHRIYETIVKVRETRLTGLISHILIGLSLLLLPIPLIYVPIAVLDGLFVYMAITALYGNQLVERVILLFTEQAAYPPSHYLRRVPQRKVHLFTVLQLTQLGLLCALGFAPTPYAKIGFPILLLLQMPIRHWIFPKFISLTYIDALDK 835          
BLAST of slc4a-5 vs. Planmine SMEST
Match: SMESG000012150.1 (SMESG000012150.1)

HSP 1 Score: 525.398 bits (1352), Expect = 3.475e-172
Identity = 306/785 (38.98%), Postives = 457/785 (58.22%), Query Frame = 2
Query:  359 LVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIERMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGISIDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFIILVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIE-NEQDFRSMLQFQARQLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYLSDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKRVIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAMFACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEXXXXXXXXXXXXXXSKDVYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHKGH---------SPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALPLAITIMSIIGALLFRDINLDPF----YYDEKVFQFQPVNLPILGWKAILSCAALGFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFGLPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNIFIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQSAYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLLLQIPIRHKIIPKFIDEIFINAMDK 2671
            LV++R     +   S E+RA  D EKF   S + L    +  E I++ +L  +    I D   L++ ++ A  +L +  +     Y + AKTI G        +  D SW+ AMA+L  +  R +       P N+G S+ +V  + +V+ P KEK  K +IE  R  + IM+D +FRQ +   +  E  FR   +  A +L  +    + +S   +   ++   +  K  +G GI  D + R+PHY SDY D F   N+I K  +T   L+FS LLP+IAFG+LN   T+ KI+V   +++Q IGG+ F + GGQP+I+MLTT+PL+L     +T+++     F   +   GIFNAVYL +YS T    +MK+S +STEE F                                   +F S++     F I S  +    FHN  + GH           C ++ S+L++LL + T+ L   L   T+TP+LN+  R++L++FALP+++  MS IG+ +F+++ +  F    + +  +       LPI G   I+  AA+ FPLS+LFFM+QNIASS+VN P NKLKKG  +H+DL +V +IN  LSIFGLPW+HGA+PHSP+HV AL+ IEE ID G+K+ Q +V+V ETR+  I++NI I   +FL+P PL YIP  VL+GLF++MA T+L++NQ  ER+ L  TEQSAYPP+HYL+RVPQ+K+H+FT  Q +QL++L  LGF+P  Y+K+ FP +L+LQ+P RH I PK I + +++A+DK
Sbjct:   41 LVITRNRPTNVPFLSEEIRARADAEKFSSTSSIVLNNYHIKTEIIVKDLLQKMFLTTIRDHDKLDLSVELAFAELIVSNNDKEGDYFQFAKTINGFEHGKGGIMTADPSWLIAMASLSWIDHRLVGFTTTVHPINMGPSHSSVQMLAIVIAPIKEKTMKRDIETSRNIAAIMSDPEFRQTIRGYDVTETTFRDAFKETALRLQNS----KPKSDNSEGEHEEHSGLHNKVSLGRGIYKDFRGRLPHYWSDYKDAFMDKNSIFKTITTIFVLFFSNLLPTIAFGMLNEYGTNHKINVASGLLAQLIGGVGFALFGGQPMIIMLTTSPLSLLIAAFYTMNSSLGYKFLQFYTWIGIFNAVYLFVYSFTGFSMIMKFSRRSTEETF----------------------------------ELFVSVT-----FVIDSVKACTKSFHNYYYGGHCVNATIAVTGSCTKEESLLFVLLLLSTMALGLWLNGLTETPFLNSMSRKMLSEFALPVSVLFMSFIGSYVFKEVKIHSFTAPPWRNISMIATDIRELPIAG---IMLAAAVAFPLSILFFMEQNIASSIVNCPLNKLKKGPAYHYDLLVVGIINLILSIFGLPWVHGALPHSPMHVTALATIEEHIDEGNKIDQKVVKVTETRIPVIIANILIGCCIFLMPYPLLYIPAPVLNGLFLYMAFTALHSNQLFERLLLFITEQSAYPPNHYLKRVPQKKVHIFTSIQFLQLLLLCILGFTPITYVKLVFPFILILQLPFRHIIFPKIISKKYLDALDK 779          
The following BLAST results are available for this feature:
BLAST of slc4a-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC4A111.648e-17340.15solute carrier family 4 member 11 [Source:HGNC Sym... [more]
SLC4A112.042e-17340.15solute carrier family 4 member 11 [Source:HGNC Sym... [more]
SLC4A117.922e-17340.15solute carrier family 4 member 11 [Source:HGNC Sym... [more]
SLC4A112.955e-16942.37solute carrier family 4 member 11 [Source:HGNC Sym... [more]
SLC4A117.829e-14837.47solute carrier family 4 member 11 [Source:HGNC Sym... [more]
back to top
BLAST of slc4a-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abts-30.000e+045.66Anion/Bicarbonate TranSporter family [Source:UniP... [more]
abts-30.000e+045.66Anion/Bicarbonate TranSporter family [Source:UniP... [more]
abts-30.000e+045.66Anion/Bicarbonate TranSporter family [Source:UniP... [more]
abts-30.000e+045.66Anion/Bicarbonate TranSporter family [Source:UniP... [more]
abts-30.000e+045.66Anion/Bicarbonate TranSporter family [Source:UniP... [more]
back to top
BLAST of slc4a-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG81773.882e-5628.90gene:FBgn0036043 transcript:FBtr0076323[more]
CG81774.049e-5628.85gene:FBgn0036043 transcript:FBtr0076322[more]
CG81774.361e-5628.85gene:FBgn0036043 transcript:FBtr0076326[more]
CG81774.811e-5628.90gene:FBgn0036043 transcript:FBtr0076327[more]
CG81775.592e-5628.85gene:FBgn0036043 transcript:FBtr0331848[more]
back to top
BLAST of slc4a-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc4a111.322e-17439.17solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
slc4a111.322e-17439.17solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
slc4a117.750e-17439.17solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
slc4a117.750e-17439.17solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
slc4a119.630e-17439.04solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc4a-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC4A110.000e+040.96solute carrier family 4 member 11 [Source:NCBI gen... [more]
SLC4A110.000e+040.96solute carrier family 4 member 11 [Source:NCBI gen... [more]
SLC4A117.045e-17940.72solute carrier family 4 member 11 [Source:NCBI gen... [more]
SLC4A117.650e-17640.39solute carrier family 4 member 11 [Source:NCBI gen... [more]
SLC4A111.199e-17139.69solute carrier family 4 member 11 [Source:NCBI gen... [more]
back to top
BLAST of slc4a-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc4a114.824e-17240.94solute carrier family 4, sodium bicarbonate transp... [more]
Slc4a11.239e-5526.70solute carrier family 4 (anion exchanger), member ... [more]
Slc4a41.695e-5329.43solute carrier family 4 (anion exchanger), member ... [more]
Slc4a41.753e-5329.43solute carrier family 4 (anion exchanger), member ... [more]
Slc4a42.387e-5329.43solute carrier family 4 (anion exchanger), member ... [more]
back to top
BLAST of slc4a-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NBS3|S4A11_HUMAN9.807e-17340.15Sodium bicarbonate transporter-like protein 11 OS=... [more]
sp|A2AJN7|S4A11_MOUSE3.374e-17140.94Sodium bicarbonate transporter-like protein 11 OS=... [more]
sp|Q9Y6R1|S4A4_HUMAN4.961e-5530.14Electrogenic sodium bicarbonate cotransporter 1 OS... [more]
sp|P04919|B3AT_MOUSE8.665e-5526.70Band 3 anion transport protein OS=Mus musculus OX=... [more]
sp|P02730|B3AT_HUMAN1.291e-5427.26Band 3 anion transport protein OS=Homo sapiens OX=... [more]
back to top
BLAST of slc4a-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YIT60.000e+0100.00Slc4a-5 OS=Schmidtea mediterranea OX=79327 GN=slc4... [more]
A0A0H3YK000.000e+058.10Slc4a-8 OS=Schmidtea mediterranea OX=79327 GN=slc4... [more]
A0A0H3YEW70.000e+053.28Slc4a-4 OS=Schmidtea mediterranea OX=79327 GN=slc4... [more]
A0A267H8X40.000e+052.77Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H2A60.000e+052.71Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of slc4a-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000011908.22.219e-18039.92pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000047690.11.164e-17640.08pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
slc4a112.261e-17038.78solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
slc4a2b4.927e-6026.03anion exchange protein 2-like [Source:NCBI gene;Ac... [more]
slc4a2b2.605e-5926.06anion exchange protein 2-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of slc4a-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc4a110.000e+041.94solute carrier family 4 member 11 [Source:ZFIN;Acc... [more]
SLC4A21.749e-5926.28solute carrier family 4 member 2 [Source:HGNC Symb... [more]
slc4a78.370e-5629.57solute carrier family 4 member 7 [Source:ZFIN;Acc:... [more]
SLC4A28.722e-5325.65solute carrier family 4 member 2 [Source:HGNC Symb... [more]
SLC4A43.582e-3928.79solute carrier family 4 member 4 [Source:HGNC Symb... [more]
back to top
BLAST of slc4a-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BOR14.211e-3624.11Boron efflux transporter of the plasma membrane; b... [more]
back to top
BLAST of slc4a-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO406105.902e-11457.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406115.341e-7340.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458443.254e-5527.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317931.362e-5326.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO270894.735e-928.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc4a-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc4a112.988e-18040.00solute carrier family 4 member 11 [Source:NCBI gen... [more]
slc4a117.389e-18040.00solute carrier family 4 member 11 [Source:NCBI gen... [more]
slc4a112.094e-17839.66solute carrier family 4 member 11 [Source:NCBI gen... [more]
SLC4A111.658e-16341.59sodium bicarbonate transporter-like protein 11 [So... [more]
slc4a1a2.254e-5926.07band 3 anion exchange protein [Source:NCBI gene;Ac... [more]
back to top
BLAST of slc4a-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061700.10.000e+0100.00SMESG000061700.1[more]
SMESG000009949.10.000e+058.10SMESG000009949.1[more]
SMESG000039045.10.000e+056.36SMESG000039045.1[more]
SMESG000039045.10.000e+057.51SMESG000039045.1[more]
SMESG000012150.13.475e-17238.98SMESG000012150.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30034606
GenBankAKN21411.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034606 ID=SMED30034606|Name=slc4a-5|organism=Schmidtea mediterranea sexual|type=transcript|length=2735bp
CTGAGTTTACTTTGAATTTAATTCCATCATTTATATTTTCTTTTACAAAA
TGTTTTCAACACATAGTGAGGCTAATTCTGAGCTTGGTGAAGATTGCAAT
GAAGCGACTCCGTTTACTGAATCGCAATATGAAACAAAATCCCAACATTT
GTCCCTTTCACCGAACTTTTTGTCCCATAATACAAGTCATCACAGTATTG
TATTGGAGAATTTAAATAACGTCACCGATAGGCGTACGAGCAACTTATCA
CAATTCAATAATTCTGATGGTTATCCAGATAACATAAGTATGCTCAGTGG
AGTTAGTGGAATAGGACTAAGGAATCTCAGTTTATTCTATAATTCTCCTC
CTCCATATTTGGTATTATCAAGATTAGAAAAATTACCACTGAAGGATTTT
TCCTCTGAGGTTAGAGCTTCGTTGGACATTGAAAAGTTTGTAAAAGAATC
TGTTCTTTTCCTTGAAATGCCATGTTTATCTATGGAAGAAATAATTGAAA
GAATGCTTATAAATATTTTGGAATGTGAAATTACTGATGAAATCTCTTTG
GAAATGTGGATCAAAGAAGCGAAAACTAAACTATTTATGCATACTTCTTT
TCTCACATATTCTTATCAGCGTCTGGCAAAAACTATAAAAGGAATATCAA
TTGATGACACTGAAGGTCTAGCCATGGATCAGTCATGGATAACAGCCATG
GCCACATTACCGAACTTACATAAAAGACATTTAGCAATTGCCCGACTATC
TACTCCGGCTAATCTTGGACGATCAAATGAAAATGTACATTTTATAATTC
TAGTATTGAATCCCACTAAAGAAAAAGGTACAAAAAGTGAAATCGAATTG
GGAAGAACGTTTTCCACTATTATGGCCGACATTGACTTTCGTCAGCAATT
ACTTATGATTGAAAATGAGCAGGATTTCCGTTCGATGTTGCAATTTCAAG
CTCGTCAATTGGCTGAGACTCAGAAGATTTTAAGGAAACGAAGTGTAAAA
GTAGATGAAGTTATGGACCAAGCGTTCTCTGTTAAAACTAAATTCTGGAT
TGGAGGTGGAATAGTTGGAGATATTAAAAGAAGAATTCCGCATTACTTAA
GTGACTATTGTGATGGATTCAAAGGGGCAAACACAATAAGGAAAGTATTT
TCAACAACAAGCTTTTTATATTTTTCATGCTTGCTGCCGTCAATTGCCTT
CGGTGTTCTCAATGGAAACAATACTGATAGAAAAATAGATGTAAAACGTG
TGATAATTTCCCAGGCAATTGGAGGATTAGTGTTTGGAATTCTTGGTGGT
CAACCTCTTATAGTCATGTTAACAACTGCTCCACTGGCTTTATATACAAA
AATTATATTTACAATTAGTACAGAATATAAAATAGACTTTTCTGCAATGT
TTGCTTGTACGGGTATTTTCAACGCAGTTTACCTCATGATTTATTCGTTG
ACGGATATGTGCAAACTAATGAAATGGTCGACAAAATCTACTGAAGAGGT
TTTTGCATTTTTTGTTGCTATAGCATTTACAGTGGATGCATCAAAGGATG
TTTATAAAGAATTTGCACAACATTATCAATGTGCTGAAGAAAACAAAGTA
AATAATTCAATTTTTAAGTCACTTTCAAATATGTCAAATCCGTTTCAAAT
AACCTCCACCTTATCCCCTATGCCGGATTTCCATAACAGTTTGCATAAAG
GTCATTCTCCGTGTCATCGTGATGTTTCTGTACTCTATCTTTTGCTAACA
ATCGGCACTGTGTGGTTAGCAGGTCATCTGTTCAACTTCACTAAAACACC
TTATCTCAATGCCCGTAAACGAGAATTGTTGGCAGATTTCGCATTACCTC
TTGCCATAACAATAATGTCAATAATAGGAGCTCTACTCTTTCGCGATATT
AATCTTGATCCATTTTACTATGATGAGAAGGTATTCCAATTTCAGCCAGT
AAACTTGCCAATTTTGGGTTGGAAAGCAATCTTAAGTTGTGCAGCTCTTG
GGTTTCCCCTTTCCCTCTTATTTTTTATGGATCAAAATATAGCAAGTTCA
ATGGTTAACAGCCCAAGTAACAAATTGAAAAAAGGTTCAACATTTCACTG
GGATTTATTTATAGTTGCTCTTATTAATGGATTTTTATCTATTTTTGGAT
TGCCTTGGATTCATGGTGCTATTCCTCACTCTCCTCTTCATGTCAAAGCA
CTGTCAGATATAGAGGAGCGAATAGATATTGGTCACAAAGTTCATCAGAC
AATTGTCAGAGTCAGGGAAACTAGAGTTACAAGCATTTTATCAAATATTT
TCATTGCTCTATCCTTGTTTTTGTTACCGAAACCCCTTAGTTATATTCCT
ATAGCTGTTCTAGATGGTCTCTTTATTCATATGGCTGTTACGTCTTTATA
TAACAATCAATTCTGTGAACGGATAACACTATTATTTACAGAACAATCAG
CCTATCCTCCATCTCACTATCTTCGACGAGTGCCGCAAAGAAAATTGCAT
TTGTTCACATTTTTTCAACTGATTCAATTGATCATGCTCTCTGCACTTGG
TTTCTCTCCCAGTCCTTACATGAAAATGGGATTCCCAATTGTTTTACTGC
TTCAAATTCCTATCAGGCACAAAATTATACCGAAATTCATTGATGAAATT
TTCATCAATGCTATGGATAAATCGTCTTGATTGGGGCAGTTAATAAAATT
ATAACTCAAATTTTATTCTGATACATTTAGATTGT
back to top

protein sequence of SMED30034606-orf-1

>SMED30034606-orf-1 ID=SMED30034606-orf-1|Name=SMED30034606-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=877bp
MFSTHSEANSELGEDCNEATPFTESQYETKSQHLSLSPNFLSHNTSHHSI
VLENLNNVTDRRTSNLSQFNNSDGYPDNISMLSGVSGIGLRNLSLFYNSP
PPYLVLSRLEKLPLKDFSSEVRASLDIEKFVKESVLFLEMPCLSMEEIIE
RMLINILECEITDEISLEMWIKEAKTKLFMHTSFLTYSYQRLAKTIKGIS
IDDTEGLAMDQSWITAMATLPNLHKRHLAIARLSTPANLGRSNENVHFII
LVLNPTKEKGTKSEIELGRTFSTIMADIDFRQQLLMIENEQDFRSMLQFQ
ARQLAETQKILRKRSVKVDEVMDQAFSVKTKFWIGGGIVGDIKRRIPHYL
SDYCDGFKGANTIRKVFSTTSFLYFSCLLPSIAFGVLNGNNTDRKIDVKR
VIISQAIGGLVFGILGGQPLIVMLTTAPLALYTKIIFTISTEYKIDFSAM
FACTGIFNAVYLMIYSLTDMCKLMKWSTKSTEEVFAFFVAIAFTVDASKD
VYKEFAQHYQCAEENKVNNSIFKSLSNMSNPFQITSTLSPMPDFHNSLHK
GHSPCHRDVSVLYLLLTIGTVWLAGHLFNFTKTPYLNARKRELLADFALP
LAITIMSIIGALLFRDINLDPFYYDEKVFQFQPVNLPILGWKAILSCAAL
GFPLSLLFFMDQNIASSMVNSPSNKLKKGSTFHWDLFIVALINGFLSIFG
LPWIHGAIPHSPLHVKALSDIEERIDIGHKVHQTIVRVRETRVTSILSNI
FIALSLFLLPKPLSYIPIAVLDGLFIHMAVTSLYNNQFCERITLLFTEQS
AYPPSHYLRRVPQRKLHLFTFFQLIQLIMLSALGFSPSPYMKMGFPIVLL
LQIPIRHKIIPKFIDEIFINAMDKSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR003020HCO3_transpt_euk
IPR002178PTS_EIIA_type-2_dom
IPR011531HCO3_transpt_C
IPR016152PTrfase/Anion_transptr
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006820anion transport
GO:0006810transport
GO:0015698inorganic anion transport
Vocabulary: molecular function
TermDefinition
GO:0005452inorganic anion exchanger activity
GO:0005215transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003020Bicarbonate transporter, eukaryoticPRINTSPR01231HCO3TRNSPORTcoord: 258..270
score: 31.59
coord: 611..620
score: 52.5
coord: 685..698
score: 47.96
coord: 486..498
score: 29.4
coord: 671..680
score: 44.64
IPR003020Bicarbonate transporter, eukaryoticPANTHERPTHR11453ANION EXCHANGE PROTEINcoord: 122..890
IPR011531Bicarbonate transporter, C-terminalPFAMPF00955HCO3_cotranspcoord: 349..836
e-value: 2.1E-151
score: 505.2
NoneNo IPR availableGENE3DG3DSA:1.10.287.570coord: 359..405
e-value: 1.3E-8
score: 36.5
NoneNo IPR availablePANTHERPTHR11453:SF92SOLUTE CARRIER FAMILY 4 MEMBER 11coord: 122..890
NoneNo IPR availableTMHMMTMhelixcoord: 495..512
NoneNo IPR availableTMHMMTMhelixcoord: 608..630
NoneNo IPR availableTMHMMTMhelixcoord: 423..445
NoneNo IPR availableTMHMMTMhelixcoord: 701..723
NoneNo IPR availableTMHMMTMhelixcoord: 460..482
NoneNo IPR availableTMHMMTMhelixcoord: 652..674
NoneNo IPR availableTMHMMTMhelixcoord: 574..596
NoneNo IPR availableTMHMMTMhelixcoord: 381..403
NoneNo IPR availableTMHMMTMhelixcoord: 831..850
NoneNo IPR availableTMHMMTMhelixcoord: 778..800
IPR016152Phosphotransferase/anion transporterGENE3DG3DSA:3.40.930.10coord: 227..318
e-value: 3.7E-5
score: 25.0
IPR016152Phosphotransferase/anion transporterSUPERFAMILYSSF55804Phoshotransferase/anion transport proteincoord: 140..312
IPR002178PTS EIIA type-2 domainPFAMPF00359PTS_EIIA_2coord: 237..313
e-value: 3.8E-5
score: 23.6