SMED30034594

Overview
NameSMED30034594
Smed IDSMED30034594
Length (bp)1372
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30034594 (SMED30034594) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30034594 (SMED30034594) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30034594 (SMED30034594) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30034594 (SMED30034594) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034594

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 33

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30034594h1SMcG0012205 Contig344newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034594h1SMcG0012205 Contig344uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034594h1SMcG0022598 Contig344newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034594h1SMcG0022598 Contig344uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30034594h1SMcG0012205 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30034594h1SMcG0012205 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30034594h1SMcG0012205 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30034594h1SMcG0012205 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30034594h1SMcG0012205 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034594h1SMcG0012205 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30034594h1SMcG0012205 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30034594h1SMcG0012211 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30034594h1SMcG0012211 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30034594h1SMcG0012211 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30034594h1SMcG0012211 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30034594h1SMcG0012211 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034594h1SMcG0012211 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30034594h1SMcG0012211 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30034594h1SMcG0012210 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30034594h1SMcG0012210 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30034594h1SMcG0012210 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30034594h1SMcG0012210 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30034594h1SMcG0012210 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034594h1SMcG0012210 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30034594h1SMcG0012210 dd_Smed_v6_1137_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
ovarySMED30034594h1SMcG0012205 Contig344newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30034594h1SMcG0012205 Contig344uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30034594h1SMcG0012205 Contig344newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30034594h1SMcG0012205 Contig344uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30034594h1SMcG0022598 Contig344newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30034594h1SMcG0022598 Contig344uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30034594h1SMcG0022598 Contig344newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30034594h1SMcG0022598 Contig344uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Alignments
SMED30034594 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000100:56789..68843 -6357
Homology
BLAST of SMED30034594 vs. Ensembl Fly
Match: dnr1 (gene:FBgn0260866 transcript:FBtr0071837)

HSP 1 Score: 53.9138 bits (128), Expect = 1.993e-7
Identity = 24/52 (46.15%), Postives = 34/52 (65.38%), Query Frame = 2
Query: 1196 NDSIQCNICMDRSIDTVLN-CGHTF-CLNCANEFHKCPNCNLDVSSYTKIFL 1345
            ++++QC ICMDR+I+TV N C H   C  CA     CPNC + ++S  KI+L
Sbjct:  543 SEAMQCKICMDRAINTVFNPCCHVIACAQCAARCSNCPNCRVKITSVVKIYL 594          
BLAST of SMED30034594 vs. Ensembl Fly
Match: dnr1 (gene:FBgn0260866 transcript:FBtr0330229)

HSP 1 Score: 53.9138 bits (128), Expect = 2.088e-7
Identity = 24/52 (46.15%), Postives = 34/52 (65.38%), Query Frame = 2
Query: 1196 NDSIQCNICMDRSIDTVLN-CGHTF-CLNCANEFHKCPNCNLDVSSYTKIFL 1345
            ++++QC ICMDR+I+TV N C H   C  CA     CPNC + ++S  KI+L
Sbjct:  543 SEAMQCKICMDRAINTVFNPCCHVIACAQCAARCSNCPNCRVKITSVVKIYL 594          
BLAST of SMED30034594 vs. Planmine SMEST
Match: SMESG000007087.1 (SMESG000007087.1)

HSP 1 Score: 521.161 bits (1341), Expect = 8.403e-170
Identity = 274/278 (98.56%), Postives = 276/278 (99.28%), Query Frame = 2
Query:  512 NYELIIKMLLANEGDVNKLNTNQESIFDIANNLRNESFVNVMLDHCKQPLELSVTKSFEMILSNLVESENWDLLSQIIDHARVDEISNKYLMSLSISVLKKQKTTELFGKIMSLCLDKNIIFCGGETFVTALIKSGIHSSTMVSILARKLFDINKTNLGNETPLVLACEGXXXXXXXXXXXXNCDLKRYRHEAIESAVLAKLKAKNENNHLKVDLGSQIIKLLSETIDNDSIQCNICMDRSIDTVLNCGHTFCLNCANEFHKCPNCNLDVSSYTKIFL 1345
            NYELIIKMLLANEGDVNKLNTNQ+SIFDIANNLRNESFVNVMLDHCKQPLELSVTKSFEMILSNLVESENWDLLSQIID+ARVDEISNKYLMSLSISVLKKQKT ELF KIMSLCLDKNIIFCGGETFVTALIKSGIHSSTMVSILARKLFDINKTNLGNETPLVLACEGLLLDVVKVLVALNCDLKRYRHEAIESAVLAKLKAKNENNHLKVDLGSQIIKLLSETIDNDSIQCNICMDRSIDTVLNCGHTFCLNCANEFHKCPNCNLDVSSYTKIFL
Sbjct: 1488 NYELIIKMLLANEGDVNKLNTNQDSIFDIANNLRNESFVNVMLDHCKQPLELSVTKSFEMILSNLVESENWDLLSQIIDNARVDEISNKYLMSLSISVLKKQKTAELFDKIMSLCLDKNIIFCGGETFVTALIKSGIHSSTMVSILARKLFDINKTNLGNETPLVLACEGLLLDVVKVLVALNCDLKRYRHEAIESAVLAKLKAKNENNHLKVDLGSQIIKLLSETIDNDSIQCNICMDRSIDTVLNCGHTFCLNCANEFHKCPNCNLDVSSYTKIFL 1765          
BLAST of SMED30034594 vs. Planmine SMEST
Match: SMESG000074227.1 (SMESG000074227.1)

HSP 1 Score: 440.269 bits (1131), Expect = 1.831e-147
Identity = 235/283 (83.04%), Postives = 252/283 (89.05%), Query Frame = 2
Query:  497 PPQNFNYELIIKMLLANEGDVNKLNTNQESIFDIANNLRNESFVNVMLDHCKQPLELSVTKSFEMILSNLVESENWDLLSQIIDHARVDEISNKYLMSLSISVLKKQKTTELFGKIMSLCLDKNIIFCGGETFVTALIKSGIHSSTMVSILARKLFDINKTNLGNETPLVLACEGXXXXXXXXXXXXNCDLKRYRHEAIESAVLAKLKAKNENNHLKVDLGSQIIKLLSETIDNDSIQCNICMDRSIDTVLNCGHTFCLNCANEFHKCPNCNLDVSSYTKIFL 1345
            P +  NYE IIKMLL NEGDVNKLN NQESIFDIAN L+NESFVNVMLDHC QPL+LSVTKSFE+ILSNLVESENW+LLSQII HA VDEISNKYL+SLSISVLKKQ TTELF KIMSLCL KNII CGGET VTA+IKSGI SSTMVSIL RK+FD NKTNL NE PL+LAC+ LL DVV VLVALNCDLKRYRHEAIESAVLAKL+AKNENNHLKV+ GS+IIKLLSETIDNDSIQC ICMDRS DTVLNCGHTFCLNC NE +KCPNC  D+S+ +KIFL
Sbjct:  516 PIEIENYESIIKMLLTNEGDVNKLNQNQESIFDIANTLKNESFVNVMLDHCNQPLKLSVTKSFEVILSNLVESENWNLLSQIIGHAHVDEISNKYLISLSISVLKKQNTTELFDKIMSLCLYKNIILCGGETVVTAVIKSGIPSSTMVSILERKIFDTNKTNLENEAPLILACKFLLFDVVNVLVALNCDLKRYRHEAIESAVLAKLEAKNENNHLKVEFGSEIIKLLSETIDNDSIQCQICMDRSKDTVLNCGHTFCLNCVNELYKCPNCFSDISTSSKIFL 798          
BLAST of SMED30034594 vs. Planmine SMEST
Match: SMESG000074227.1 (SMESG000074227.1)

HSP 1 Score: 439.884 bits (1130), Expect = 4.735e-147
Identity = 235/283 (83.04%), Postives = 252/283 (89.05%), Query Frame = 2
Query:  497 PPQNFNYELIIKMLLANEGDVNKLNTNQESIFDIANNLRNESFVNVMLDHCKQPLELSVTKSFEMILSNLVESENWDLLSQIIDHARVDEISNKYLMSLSISVLKKQKTTELFGKIMSLCLDKNIIFCGGETFVTALIKSGIHSSTMVSILARKLFDINKTNLGNETPLVLACEGXXXXXXXXXXXXNCDLKRYRHEAIESAVLAKLKAKNENNHLKVDLGSQIIKLLSETIDNDSIQCNICMDRSIDTVLNCGHTFCLNCANEFHKCPNCNLDVSSYTKIFL 1345
            P +  NYE IIKMLL NEGDVNKLN NQESIFDIAN L+NESFVNVMLDHC QPL+LSVTKSFE+ILSNLVESENW+LLSQII HA VDEISNKYL+SLSISVLKKQ TTELF KIMSLCL KNII CGGET VTA+IKSGI SSTMVSIL RK+FD NKTNL NE PL+LAC+ LL DVV VLVALNCDLKRYRHEAIESAVLAKL+AKNENNHLKV+ GS+IIKLLSETIDNDSIQC ICMDRS DTVLNCGHTFCLNC NE +KCPNC  D+S+ +KIFL
Sbjct:  539 PIEIENYESIIKMLLTNEGDVNKLNQNQESIFDIANTLKNESFVNVMLDHCNQPLKLSVTKSFEVILSNLVESENWNLLSQIIGHAHVDEISNKYLISLSISVLKKQNTTELFDKIMSLCLYKNIILCGGETVVTAVIKSGIPSSTMVSILERKIFDTNKTNLENEAPLILACKFLLFDVVNVLVALNCDLKRYRHEAIESAVLAKLEAKNENNHLKVEFGSEIIKLLSETIDNDSIQCQICMDRSKDTVLNCGHTFCLNCVNELYKCPNCFSDISTSSKIFL 821          
BLAST of SMED30034594 vs. Planmine SMEST
Match: SMESG000007100.1 (SMESG000007100.1)

HSP 1 Score: 323.939 bits (829), Expect = 8.933e-106
Identity = 174/278 (62.59%), Postives = 217/278 (78.06%), Query Frame = 2
Query:  515 YELIIKMLLANEGDVNKLNTNQESIFDIANNLRNESFVNVMLDHCKQPLELSVTKSFEMILSNLVESENWDLLSQIIDHARVDEISNKYLMSLSISVLKKQKTTELFGKIMSLCLDKNIIFCGGETFVTALIKSGIHSSTMVSILARKLFDINKTNLGNETPLVLACEGXXXXXXXXXXXXNCDLKRYRHEAIESAVLAKLKAKNENNHLKVDLGSQIIKLLSETIDNDSIQ-CNICMDRSIDTVLNCGHTFCLNCANEFHKCPNCNLDVSSYTKIFL 1345
            YE IIKMLL NEG+VN L+ N ESIFDIA  LRNE+F+ +MLDHCKQ LELSVTKS E+ILSNLV+SENWDLL Q+ID+A+VDEISN+YL+ L ISVL+K+ T ELF +I+S+C DKN I   GETFVTAL+KS I+ +TMVSIL RKLFDINK NL  + PL+LACE LL  VV  L+ LNCDLK ++ +AIES VLAK KA+ +N+H+K   GS+II+LLSE++D   +  C ICMDR+ DT LNCGHT C  C+++   CP C+L + +  +IFL
Sbjct:  229 YESIIKMLLENEGNVNHLDENNESIFDIARKLRNENFIYLMLDHCKQRLELSVTKSMEIILSNLVDSENWDLLFQVIDNAKVDEISNEYLLFLCISVLRKRNTLELFDEIISICTDKNAILHNGETFVTALLKSDINPATMVSILNRKLFDINKANLHKQVPLILACENLLFVVVNALLKLNCDLKYHKSQAIESVVLAKSKAELQNDHVKAKKGSEIIELLSESVDFKELHLCQICMDRNKDTALNCGHTLCSICSDKLSVCPFCSLAIVNSLRIFL 506          
BLAST of SMED30034594 vs. Planmine SMEST
Match: SMESG000007103.1 (SMESG000007103.1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.890e-18
Identity = 64/192 (33.33%), Postives = 110/192 (57.29%), Query Frame = 2
Query:  545 NEGDVNKLNTNQESIFDIANNLRNESFVNVMLDHCKQPLELSVTKSFEMILSNLVESENWDLLSQIIDHARVDEISNKYLMSLSISVLKKQKTTELFGKIMSLCLDKNIIFCGGETFVTALIKSGIHSSTMVSILARKLFDINKTNLGNETPLVLACEGXXXXXXXXXXXXNCDLKRYRHEAIESAVLAKLK 1120
            +EGD+ K N    S   +A  ++++ + N++L+ C + +EL   +     L  +V  +  D+LS  +D   + +   ++L+ L +  LK QK+ +++  I+  C  K+II   GETF+T L+K+    S +  I+  K FDINK NL NE+ L++ACE L  ++VK LV   CD+    + A+++ + AKLK
Sbjct:   29 HEGDIIKTNAMNNSALSLAYKIKDKKYYNLLLN-CFKSIELLSDEFGRNFLRQIV-IDKADVLSNTLDKCLIKDCHTEFLLDLGLMALK-QKSNDIYKNILDHCKTKDIILKNGETFLTNLVKNKEDISIITDIVTSKYFDINKVNLRNESILMIACEQLNENIVKFLVRSGCDVTYNSYGAVQATINAKLK 217          

HSP 2 Score: 73.9442 bits (180), Expect = 9.108e-14
Identity = 58/222 (26.13%), Postives = 116/222 (52.25%), Query Frame = 2
Query:  491 CYPPQNFNYEL-IIKMLLANEGDVNKLNTNQESIFDIANNLRNESFVNVMLDHCKQPLELSVTKSFEMILSNLVESENWDLLSQIIDHARVDEISNKYLMSLSISVLKKQKTTELFGKIMSLCLDKNIIFCGGETFVTALIKSGIHSSTMVSILARKLFDINKTNLGNETPLVLACEGXXXXXXXXXXXXNCDLKRYRHEAIESAVLAKLKAKNENNHLKVD 1153
             Y P    + L ++KML+ ++G++   N  + +    + + +++S+ + +L+ C   L++   +S   +L  L        L  I+    +   SN+ L+ L++ VLK     E + KI+ +C++ + IF  GETF+++L K+ +  S + S++   LFD  KTN   E  L+LAC  L+  V+ +L+   C++    + A+   ++     K+E + LK++
Sbjct:  280 AYHPHKEQFVLDLLKMLIDSKGNLILENAQKVNFLSKSYDYQDKSYFSQLLERCPGNLQILSNESGIKLLFKLSSETKLKALEFILSKIEMAGNSNENLLKLAVQVLK-NGGIETYNKIIKMCIEFDAIFDDGETFISSLFKNNVKESIIKSVIESGLFDAKKTNNKAENALMLACSRLMTTVIPILLNQGCEIAYSGYNAVIMTIVGNQTLKSEESKLKMN 500          
The following BLAST results are available for this feature:
BLAST of SMED30034594 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034594 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034594 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dnr11.993e-746.15gene:FBgn0260866 transcript:FBtr0071837[more]
dnr12.088e-746.15gene:FBgn0260866 transcript:FBtr0330229[more]
back to top
BLAST of SMED30034594 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034594 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034594 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034594 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034594 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034594 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034594 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034594 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034594 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034594 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034594 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007087.18.403e-17098.56SMESG000007087.1[more]
SMESG000074227.11.831e-14783.04SMESG000074227.1[more]
SMESG000074227.14.735e-14783.04SMESG000074227.1[more]
SMESG000007100.18.933e-10662.59SMESG000007100.1[more]
SMESG000007103.13.890e-1833.33SMESG000007103.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034594 ID=SMED30034594|Name=SMED30034594|organism=Schmidtea mediterranea sexual|type=transcript|length=1372bp
AAATTTGCAGTGGAAATTTTATACTATAAAAGTTTTCAAATTTAAAACTG
TTTTTAATATAAATATTTATTATATTAATAAAAATTAATTTTTTATAAAA
GTGAATAATAAATGATTTTAAAATTTTAAAAAAAGATTCAAATATATTGA
AAAACAATAATTTGTTTTTCTATATTTTTTGAAATCCATATTATTTTGTG
GTTGTTTTTTTAGTCTGATGATGACGGCGAATCAGTTGAAAATAGCGTAA
ATCTGAATGATGCTTTCTTGTAACATAAGATTCTTGGAATAAATTGAATA
ATTTTCTGTGCTTTTCGGTAAATAACACATACCAAATAGGTAATAAAGGA
TGGCGAAGAAATGAATTAGAACAAAATTCCAGAAGTTTGATATCTTATTG
AGAAATTTGAAATTGATTTTAAGGTGGTTTCAATGAATTCCAATAAAGAT
ATTAATGTTTTTCAAAACTTTTAAATTCGGATAACCCTATTGTTATCCAC
CGCAAAATTTTAACTATGAATTAATAATAAAAATGCTTCTGGCTAATGAA
GGAGATGTGAACAAATTGAATACAAATCAAGAGAGTATATTTGATATTGC
AAATAATTTAAGAAATGAAAGTTTTGTCAATGTTATGCTGGATCATTGCA
AGCAACCACTGGAATTGTCAGTTACAAAATCCTTTGAAATGATCTTGTCT
AATTTGGTTGAATCTGAAAATTGGGATTTATTATCTCAAATAATTGACCA
TGCTCGTGTTGATGAAATTAGCAATAAATATCTCATGTCCCTTTCCATCT
CTGTTCTTAAGAAACAAAAAACCACAGAATTATTTGGCAAAATAATGTCC
CTCTGTTTAGACAAAAATATTATTTTTTGCGGAGGAGAAACCTTCGTAAC
TGCTCTAATAAAGTCCGGTATCCACTCGTCCACAATGGTTAGCATTTTGG
CAAGGAAATTATTCGATATCAATAAGACAAATCTTGGAAACGAAACTCCT
TTAGTTCTTGCTTGTGAAGGTTTGCTACTTGATGTGGTGAAGGTTCTTGT
TGCTTTAAATTGTGATCTGAAACGATATAGACACGAGGCTATTGAATCTG
CTGTCTTAGCAAAATTAAAGGCTAAAAATGAGAATAATCATTTGAAAGTT
GATCTGGGAAGCCAAATTATCAAATTATTATCGGAAACAATTGATAATGA
TTCGATTCAGTGTAACATTTGTATGGATAGATCCATAGATACAGTTTTGA
ATTGTGGTCATACATTTTGTTTAAACTGCGCCAATGAATTTCACAAGTGT
CCAAATTGTAATTTAGATGTCTCTAGCTATACAAAAATATTCTTATGAAG
CTGTGATAATTTTGATTTTATA
back to top

protein sequence of SMED30034594-orf-1

>SMED30034594-orf-1 ID=SMED30034594-orf-1|Name=SMED30034594-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=272bp
MLLANEGDVNKLNTNQESIFDIANNLRNESFVNVMLDHCKQPLELSVTKS
FEMILSNLVESENWDLLSQIIDHARVDEISNKYLMSLSISVLKKQKTTEL
FGKIMSLCLDKNIIFCGGETFVTALIKSGIHSSTMVSILARKLFDINKTN
LGNETPLVLACEGLLLDVVKVLVALNCDLKRYRHEAIESAVLAKLKAKNE
NNHLKVDLGSQIIKLLSETIDNDSIQCNICMDRSIDTVLNCGHTFCLNCA
NEFHKCPNCNLDVSSYTKIFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0000484secretory system
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR001841Znf_RING
IPR020683Ankyrin_rpt-contain_dom
IPR013083Znf_RING/FYVE/PHD
IPR017907Znf_RING_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
Vocabulary: biological process
TermDefinition
GO:0002814negative regulation of biosynthetic process of antibacterial peptides active against Gram-negative bacteria
GO:0007476imaginal disc-derived wing morphogenesis
GO:0016567protein ubiquitination
GO:0030431sleep
GO:0042787protein ubiquitination involved in ubiquitin-dependent protein catabolic process
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 227..259
e-value: 1.5E-5
score: 34.5
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 227..260
score: 12.268
NoneNo IPR availablePFAMPF13920zf-C3HC4_3coord: 226..265
e-value: 5.0E-8
score: 32.7
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 212..266
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 217..271
e-value: 3.8E-12
score: 47.5
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 1..208
e-value: 1.7E-8
score: 35.9
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 2..181
IPR017907Zinc finger, RING-type, conserved sitePROSITEPS00518ZF_RING_1coord: 241..250