Slit-2

Overview
NameSlit-2
Smed IDSMED30034592
Length (bp)1769
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Slit-2 (SMED30034592) t-SNE clustered cells

Violin plots show distribution of expression levels for Slit-2 (SMED30034592) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Slit-2 (SMED30034592) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Slit-2 (SMED30034592) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034592

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30034592SMESG000002157.1 dd_Smed_v4_14579_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30034592SMESG000002157.1 SmedASXL_014864SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30034592SMESG000002157.1 dd_Smed_v6_14579_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30034592SMESG000002157.1 OX_Smed_1.0.12593ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30034592SMESG000002157.1 dd_Smed_v4_14579_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Slit-2 vs. Ensembl Human
Match: LRRC24 (leucine rich repeat containing 24 [Source:HGNC Symbol;Acc:HGNC:28947])

HSP 1 Score: 83.9593 bits (206), Expect = 1.736e-16
Identity = 93/303 (30.69%), Postives = 136/303 (44.88%), Query Frame = 3
Query:  267 GCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLS-LDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKE----VSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELR---CTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHGN--NSGRLSCEAINALETNVKWRHKLFASENYYRFQ 1145
            GCP+ C+   C S  + C    +L  +PL IP     + +   N     L   AL+        LR L L   ++  +E  AF     L  L L++NRL+ L SG F GL+ L  L L  N+   LL+ +F       L L   +L+  S E++++        L  L LS NQL  I ++       L+++ L ENP+ C C L WL   +K      ++ L S  R   C  P  L+ Q+L+ +S S+LIC PP V    + L  N     R++C+A    +  V WR      E   R Q
Sbjct:   22 GCPAACR---CYSATVECGA-LRLRVVPLGIPPGTQTLFLQDNNI--ARLEPGALAPLA----ALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRSGAFVGLAQLRVLYLAGNQLARLLDFTF-------LHLPELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQPLASLQVLRLTENPWRCDCALHWLGAWIK---EGGQRLLTSRDRKIMCAEPPRLALQSLLDVSHSSLICIPPSVHVQPLELTANLGEDLRVACQASGYPQPLVTWRKVPQPREGRPRAQ 304          
BLAST of Slit-2 vs. Ensembl Human
Match: LRRC24 (leucine rich repeat containing 24 [Source:HGNC Symbol;Acc:HGNC:28947])

HSP 1 Score: 83.1889 bits (204), Expect = 3.436e-16
Identity = 93/303 (30.69%), Postives = 137/303 (45.21%), Query Frame = 3
Query:  267 GCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLS-LDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKE----VSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELR---CTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHGN--NSGRLSCEAINALETNVKWRHKLFASENYYRFQ 1145
            GCP+ C+   C S  + C    +L  +PL IP     + +   N     L   AL+        LR L L   ++  +E  AF     L  L L++NRL+ L SG F GL+ L  L L  N+   LL+ +F  L      L+  +L+  S E++++        L  L LS NQL  I ++       L+++ L ENP+ C C L WL   +K      ++ L S  R   C  P  L+ Q+L+ +S S+LIC PP V    + L  N     R++C+A    +  V WR      E   R Q
Sbjct:   22 GCPAACR---CYSATVECGA-LRLRVVPLGIPPGTQTLFLQDNNI--ARLEPGALAPLA----ALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRSGAFVGLAQLRVLYLAGNQLARLLDFTFLHLP----RLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQPLASLQVLRLTENPWRCDCALHWLGAWIK---EGGQRLLTSRDRKIMCAEPPRLALQSLLDVSHSSLICIPPSVHVQPLELTANLGEDLRVACQASGYPQPLVTWRKVPQPREGRPRAQ 307          
BLAST of Slit-2 vs. Ensembl Human
Match: SLIT2 (slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGNC:11086])

HSP 1 Score: 68.9366 bits (167), Expect = 2.204e-11
Identity = 72/258 (27.91%), Postives = 116/258 (44.96%), Query Frame = 3
Query:  252 VEPRAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFIN-TTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLI--LLEGSFRGLV-VSSLSLK----SCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            V P+A CP+ C      SG  V      L ++P NIP+    + ++G N    T   +  L H       LR+LQL    I  IE  AF  L  L+ L L+ N L++    +F G +  Y RLD +EN I  +   +FRG V + +L L     SC +++ ++  +++    L  L L++N ++ +         +L    L  N  +C C L WL+  L+ R       L ++  C  P  L G  +  + +   +C
Sbjct:   23 VAPQA-CPAQCS----CSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRH-------LRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLY-RLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISC-IEDGAFRALRD----LEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV---GLYTQ--CMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 57.3806 bits (137), Expect = 6.981e-8
Identity = 71/273 (26.01%), Postives = 107/273 (39.19%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLE-GSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKP------PGVKEIDIFLHGNNSGRLSC 1067
            CP+ C      S  +V      LT +P N+P+ I  I +  QN I   +   A S Y      LR + L+   I  + P+AF  L +L SL L  N++  L   +F+GL    L L N   +  L   +F+ L                         +L  L L  N+L  I K        ++ + L +NPF C C L+WL   L         A     RCT+P+ L+ + +  +      C        PG ++    L G+    L+C
Sbjct:  277 CPAACT----CSNNIVDCRGKGLTEIPTNLPETITEIRLE-QNTIKV-IPPGAFSPYK----KLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDL------------------------HNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGA-----RCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRSKLSGDCFADLAC 510          

HSP 3 Score: 50.8322 bits (120), Expect = 7.604e-6
Identity = 60/228 (26.32%), Postives = 93/228 (40.79%), Query Frame = 3
Query:  267 GCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNP 947
             CP  C+ +    G  V     KL  +P +IP+    + ++   F  T L    +    P+   LR +  +   I +IE  AF     +  + L++NRL+ +   +FKGL SL  L L +N    +   SF GL  SS+ L                      L L  NQ++ +          L  ++L  NPF C C L WL + L+     K++ +    RC  P
Sbjct:  509 ACPEKCRCE----GTTVDCSNQKLNKIPEHIPQYTAELRLNNNEF--TVLEATGIFKKLPQ---LRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGL--SSVRL----------------------LSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLR-----KKRIVTGNPRCQKP 698          
BLAST of Slit-2 vs. Ensembl Human
Match: SLIT2 (slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGNC:11086])

HSP 1 Score: 68.9366 bits (167), Expect = 2.219e-11
Identity = 72/258 (27.91%), Postives = 116/258 (44.96%), Query Frame = 3
Query:  252 VEPRAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFIN-TTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLI--LLEGSFRGLV-VSSLSLK----SCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            V P+A CP+ C      SG  V      L ++P NIP+    + ++G N    T   +  L H       LR+LQL    I  IE  AF  L  L+ L L+ N L++    +F G +  Y RLD +EN I  +   +FRG V + +L L     SC +++ ++  +++    L  L L++N ++ +         +L    L  N  +C C L WL+  L+ R       L ++  C  P  L G  +  + +   +C
Sbjct:   23 VAPQA-CPAQCS----CSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRH-------LRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLY-RLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISC-IEDGAFRALRD----LEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV---GLYTQ--CMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 57.3806 bits (137), Expect = 6.853e-8
Identity = 71/273 (26.01%), Postives = 107/273 (39.19%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLE-GSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKP------PGVKEIDIFLHGNNSGRLSC 1067
            CP+ C      S  +V      LT +P N+P+ I  I +  QN I   +   A S Y      LR + L+   I  + P+AF  L +L SL L  N++  L   +F+GL    L L N   +  L   +F+ L                         +L  L L  N+L  I K        ++ + L +NPF C C L+WL   L         A     RCT+P+ L+ + +  +      C        PG ++    L G+    L+C
Sbjct:  273 CPAACT----CSNNIVDCRGKGLTEIPTNLPETITEIRLE-QNTIKV-IPPGAFSPYK----KLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDL------------------------HNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGA-----RCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRSKLSGDCFADLAC 506          

HSP 3 Score: 50.8322 bits (120), Expect = 7.340e-6
Identity = 60/228 (26.32%), Postives = 93/228 (40.79%), Query Frame = 3
Query:  267 GCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNP 947
             CP  C+ +    G  V     KL  +P +IP+    + ++   F  T L    +    P+   LR +  +   I +IE  AF     +  + L++NRL+ +   +FKGL SL  L L +N    +   SF GL  SS+ L                      L L  NQ++ +          L  ++L  NPF C C L WL + L+     K++ +    RC  P
Sbjct:  505 ACPEKCRCE----GTTVDCSNQKLNKIPEHIPQYTAELRLNNNEF--TVLEATGIFKKLPQ---LRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGL--SSVRL----------------------LSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLR-----KKRIVTGNPRCQKP 694          
BLAST of Slit-2 vs. Ensembl Human
Match: SLIT2 (slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGNC:11086])

HSP 1 Score: 68.5514 bits (166), Expect = 2.459e-11
Identity = 72/258 (27.91%), Postives = 116/258 (44.96%), Query Frame = 3
Query:  252 VEPRAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFIN-TTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLI--LLEGSFRGLV-VSSLSLK----SCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            V P+A CP+ C      SG  V      L ++P NIP+    + ++G N    T   +  L H       LR+LQL    I  IE  AF  L  L+ L L+ N L++    +F G +  Y RLD +EN I  +   +FRG V + +L L     SC +++ ++  +++    L  L L++N ++ +         +L    L  N  +C C L WL+  L+ R       L ++  C  P  L G  +  + +   +C
Sbjct:   23 VAPQA-CPAQCS----CSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRH-------LRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLY-RLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISC-IEDGAFRALRD----LEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV---GLYTQ--CMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 56.225 bits (134), Expect = 1.625e-7
Identity = 70/267 (26.22%), Postives = 106/267 (39.70%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLE-GSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSC 1067
            CP+ C      S  +V      LT +P N+P+ I  I +  QN I   +   A S Y      LR + L+   I  + P+AF  L +L SL L  N++  L   +F+GL    L L N   +  L   +F+ L                         +L  L L  N+L  I K        ++ + L +NPF C C L+WL   L         A     RCT+P+ L+ + +  +      C   G ++    L G+    L+C
Sbjct:  277 CPAACT----CSNNIVDCRGKGLTEIPTNLPETITEIRLE-QNTIKV-IPPGAFSPYK----KLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDL------------------------HNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGA-----RCTSPRRLANKRIGQIKSKKFRCS--GTEDYRSKLSGDCFADLAC 502          

HSP 3 Score: 50.8322 bits (120), Expect = 8.556e-6
Identity = 60/228 (26.32%), Postives = 93/228 (40.79%), Query Frame = 3
Query:  267 GCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNP 947
             CP  C+ +    G  V     KL  +P +IP+    + ++   F  T L    +    P+   LR +  +   I +IE  AF     +  + L++NRL+ +   +FKGL SL  L L +N    +   SF GL  SS+ L                      L L  NQ++ +          L  ++L  NPF C C L WL + L+     K++ +    RC  P
Sbjct:  501 ACPEKCRCE----GTTVDCSNQKLNKIPEHIPQYTAELRLNNNEF--TVLEATGIFKKLPQ---LRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGL--SSVRL----------------------LSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLR-----KKRIVTGNPRCQKP 690          
BLAST of Slit-2 vs. Ensembl Celegans
Match: slt-1 (Slit homolog 1 protein [Source:UniProtKB/Swiss-Prot;Acc:G5EFX6])

HSP 1 Score: 62.7734 bits (151), Expect = 5.696e-10
Identity = 70/252 (27.78%), Postives = 115/252 (45.63%), Query Frame = 3
Query:  264 AGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQ----INLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFK-GLSLDYLRLDNNENLILLEGSFRG-LVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            A CP+ C    C+   + C+   +LT +P NIP           + I   L  N ++  GP      +NL+ LQL    I  I  ++FS L+ L+ L LS NR++ L   +F+  L L +L L  N+  ++ +   +G   +  L+L   ++  L   +I      L  L L+ N+L+      E    R   +DL  NP+ C C+LRW+ K L+ +   + K +     C  P  L G ++  L +  + C
Sbjct:   15 ATCPAECV---CVDRTVSCVG-QQLTEVPQNIP----------NDTIRLDLQDNEITKIGPNDFSSLMNLKALQLMDNQIVTIHNQSFSSLVFLQKLRLSRNRIRHLPDNVFQNNLKLTHLDLSENDITVVSDAQLQGPEFLEVLNLDKNHIFCLENNVISSWVS-LEVLTLNGNRLTTF---EEPSNARFRQLDLFNNPWNCDCRLRWMRKWLE-KAEGQNKTV-----CATPLNLQGSSIEILQDKFMTC 242          
BLAST of Slit-2 vs. Ensembl Celegans
Match: pxn-1 (Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q1ENI8])

HSP 1 Score: 52.7582 bits (125), Expect = 7.166e-7
Identity = 62/266 (23.31%), Postives = 116/266 (43.61%), Query Frame = 3
Query:  456 NLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELR------CTNPKELSGQTLISLSESNLICKPPG-----VKEIDIFLHGNNSGRLSCEAINALETNVKWRHKLFASENYYRFQDYSPALGRSLISIESRNNVDHYSC 1217
            N+R L +    I  ++         L++L L++N++KI+   +   L  L  L L +NE + +         ++SL+LK  +++ +  ++++     LT+L  SHN++  +  K       L    L  NP+ C C+             +K KAL+ +++      CTNP EL  Q L  + +S L C  P       +EI +    N+S +L       +E +        +S + Y   D       ++I++  + NV+  +C
Sbjct:   53 NVRSLVIRNNRIHKLKRSDLEGFNQLETLVLTHNKIKIIEENVLDHLPELKRLSLAHNELVYIPPLCSDSRPLASLNLKRNHIQFIDEQVLRYFPD-LTQLDFSHNRIQSLRTKLFDNLPALSHAHLHSNPWHCDCRA------------SKVKALLQKVKWEKKVYCTNPVELRHQALDEVDDSALTCARPAEESWTGEEIKLTCAKNSSSKLVVWMYENVEVDS-------SSLDGYEIHD-------TVITVPRKTNVNFMTC 291          
BLAST of Slit-2 vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330730)

HSP 1 Score: 85.5001 bits (210), Expect = 6.863e-17
Identity = 75/248 (30.24%), Postives = 110/248 (44.35%), Query Frame = 3
Query:  264 AGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLV-VSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            A CP  C      +G  V      LT++P  I   +  + + G N    T+ Y            LR+LQLT   I  IE  +F  L++L+ LD+SNN +  +   +FKG  SL  L+LDNN+   L E +F+GLV +  L+L +  L +L + I   + G L  L LS                        +NPF C C L WL++ L++        L    RC +P +L GQ +  L +    C
Sbjct:   71 ARCPRVCS----CTGLNVDCSHRGLTSVPRKISADVERLELQGNNL---TVIYETDFQ---RLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGL-GRLRALRLS------------------------DNPFACDCHLSWLSRFLRSATR-----LAPYTRCQSPSQLKGQNVADLHDQEFKC 278          

HSP 2 Score: 60.4622 bits (145), Expect = 3.905e-9
Identity = 76/252 (30.16%), Postives = 108/252 (42.86%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDN-NENLILLEGSFRGLVVSSL------SLKSCYLKNLSYEIIKEVSG-HLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            CP  C+   C  G + C E   LT++P+ +P     + +  QNFI T L   + S +      LR + L+  NI  I  +A S L  L +L L  N++K L SG+FKGL    L L N NE   + + +FR L   SL      +++S  L N +++ +K +   HL K                             NPF C C LRWL   L      K     S  RC +PK +  + + SL E    C
Sbjct:  295 CPHPCR---CADGIVDCRE-KSLTSVPVTLPDDTTELRLE-QNFI-TELPPKSFSSF----RRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQS--LANGTFDAMKSIKTVHLAK-----------------------------NPFICDCNLRWLADYLH-----KNPIETSGARCESPKRMHRRRIESLREEKFKC 500          
BLAST of Slit-2 vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330729)

HSP 1 Score: 85.5001 bits (210), Expect = 7.500e-17
Identity = 75/248 (30.24%), Postives = 110/248 (44.35%), Query Frame = 3
Query:  264 AGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLV-VSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            A CP  C      +G  V      LT++P  I   +  + + G N    T+ Y            LR+LQLT   I  IE  +F  L++L+ LD+SNN +  +   +FKG  SL  L+LDNN+   L E +F+GLV +  L+L +  L +L + I   + G L  L LS                        +NPF C C L WL++ L++        L    RC +P +L GQ +  L +    C
Sbjct:   71 ARCPRVCS----CTGLNVDCSHRGLTSVPRKISADVERLELQGNNL---TVIYETDFQ---RLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGL-GRLRALRLS------------------------DNPFACDCHLSWLSRFLRSATR-----LAPYTRCQSPSQLKGQNVADLHDQEFKC 278          

HSP 2 Score: 60.4622 bits (145), Expect = 4.224e-9
Identity = 76/252 (30.16%), Postives = 108/252 (42.86%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDN-NENLILLEGSFRGLVVSSL------SLKSCYLKNLSYEIIKEVSG-HLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            CP  C+   C  G + C E   LT++P+ +P     + +  QNFI T L   + S +      LR + L+  NI  I  +A S L  L +L L  N++K L SG+FKGL    L L N NE   + + +FR L   SL      +++S  L N +++ +K +   HL K                             NPF C C LRWL   L      K     S  RC +PK +  + + SL E    C
Sbjct:  295 CPHPCR---CADGIVDCRE-KSLTSVPVTLPDDTTELRLE-QNFI-TELPPKSFSSF----RRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQS--LANGTFDAMKSIKTVHLAK-----------------------------NPFICDCNLRWLADYLH-----KNPIETSGARCESPKRMHRRRIESLREEKFKC 500          
BLAST of Slit-2 vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330732)

HSP 1 Score: 85.5001 bits (210), Expect = 7.500e-17
Identity = 75/248 (30.24%), Postives = 110/248 (44.35%), Query Frame = 3
Query:  264 AGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLV-VSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            A CP  C      +G  V      LT++P  I   +  + + G N    T+ Y            LR+LQLT   I  IE  +F  L++L+ LD+SNN +  +   +FKG  SL  L+LDNN+   L E +F+GLV +  L+L +  L +L + I   + G L  L LS                        +NPF C C L WL++ L++        L    RC +P +L GQ +  L +    C
Sbjct:   71 ARCPRVCS----CTGLNVDCSHRGLTSVPRKISADVERLELQGNNL---TVIYETDFQ---RLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGL-GRLRALRLS------------------------DNPFACDCHLSWLSRFLRSATR-----LAPYTRCQSPSQLKGQNVADLHDQEFKC 278          

HSP 2 Score: 60.4622 bits (145), Expect = 4.224e-9
Identity = 76/252 (30.16%), Postives = 108/252 (42.86%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDN-NENLILLEGSFRGLVVSSL------SLKSCYLKNLSYEIIKEVSG-HLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            CP  C+   C  G + C E   LT++P+ +P     + +  QNFI T L   + S +      LR + L+  NI  I  +A S L  L +L L  N++K L SG+FKGL    L L N NE   + + +FR L   SL      +++S  L N +++ +K +   HL K                             NPF C C LRWL   L      K     S  RC +PK +  + + SL E    C
Sbjct:  295 CPHPCR---CADGIVDCRE-KSLTSVPVTLPDDTTELRLE-QNFI-TELPPKSFSSF----RRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQS--LANGTFDAMKSIKTVHLAK-----------------------------NPFICDCNLRWLADYLH-----KNPIETSGARCESPKRMHRRRIESLREEKFKC 500          
BLAST of Slit-2 vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330734)

HSP 1 Score: 77.0258 bits (188), Expect = 2.897e-14
Identity = 75/250 (30.00%), Postives = 110/250 (44.00%), Query Frame = 3
Query:  264 AGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVS----GHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            A CP  C      +G  V      LT++P  I   +  + + G N    T+ Y            LR+LQLT   I  IE  +F  L++L+ L L+NNRLK +    F   S   LRLD + N+I   G  R +   + SL+S  L N     + E +      L  L L++N L+ +         RL  + L +NPF C C L WL++ L++        L    RC +P +L GQ +  L +    C
Sbjct:   71 ARCPRVCS----CTGLNVDCSHRGLTSVPRKISADVERLELQGNNL---TVIYETDFQ---RLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPEN-FVTSSASLLRLDISNNVITTVG--RRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATR-----LAPYTRCQSPSQLKGQNVADLHDQEFKC 302          

HSP 2 Score: 62.3882 bits (150), Expect = 1.028e-9
Identity = 76/252 (30.16%), Postives = 108/252 (42.86%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDN-NENLILLEGSFRGLVVSSL------SLKSCYLKNLSYEIIKEVSG-HLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            CP  C+   C  G + C E   LT++P+ +P     + +  QNFI T L   + S +      LR + L+  NI  I  +A S L  L +L L  N++K L SG+FKGL    L L N NE   + + +FR L   SL      +++S  L N +++ +K +   HL K                             NPF C C LRWL   L      K     S  RC +PK +  + + SL E    C
Sbjct:  319 CPHPCR---CADGIVDCRE-KSLTSVPVTLPDDTTELRLE-QNFI-TELPPKSFSSF----RRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQS--LANGTFDAMKSIKTVHLAK-----------------------------NPFICDCNLRWLADYLH-----KNPIETSGARCESPKRMHRRRIESLREEKFKC 524          
BLAST of Slit-2 vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330733)

HSP 1 Score: 76.2554 bits (186), Expect = 5.943e-14
Identity = 75/250 (30.00%), Postives = 110/250 (44.00%), Query Frame = 3
Query:  264 AGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVS----GHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            A CP  C      +G  V      LT++P  I   +  + + G N    T+ Y            LR+LQLT   I  IE  +F  L++L+ L L+NNRLK +    F   S   LRLD + N+I   G  R +   + SL+S  L N     + E +      L  L L++N L+ +         RL  + L +NPF C C L WL++ L++        L    RC +P +L GQ +  L +    C
Sbjct:   71 ARCPRVCS----CTGLNVDCSHRGLTSVPRKISADVERLELQGNNL---TVIYETDFQ---RLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPEN-FVTSSASLLRLDISNNVITTVG--RRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATR-----LAPYTRCQSPSQLKGQNVADLHDQEFKC 302          

HSP 2 Score: 60.4622 bits (145), Expect = 3.956e-9
Identity = 76/252 (30.16%), Postives = 108/252 (42.86%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDN-NENLILLEGSFRGLVVSSL------SLKSCYLKNLSYEIIKEVSG-HLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            CP  C+   C  G + C E   LT++P+ +P     + +  QNFI T L   + S +      LR + L+  NI  I  +A S L  L +L L  N++K L SG+FKGL    L L N NE   + + +FR L   SL      +++S  L N +++ +K +   HL K                             NPF C C LRWL   L      K     S  RC +PK +  + + SL E    C
Sbjct:  319 CPHPCR---CADGIVDCRE-KSLTSVPVTLPDDTTELRLE-QNFI-TELPPKSFSSF----RRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQS--LANGTFDAMKSIKTVHLAK-----------------------------NPFICDCNLRWLADYLH-----KNPIETSGARCESPKRMHRRRIESLREEKFKC 524          
BLAST of Slit-2 vs. Ensembl Zebrafish
Match: si:dkey-1j5.4 (si:dkey-1j5.4 [Source:ZFIN;Acc:ZDB-GENE-130603-91])

HSP 1 Score: 65.855 bits (159), Expect = 3.778e-11
Identity = 63/213 (29.58%), Postives = 100/213 (46.95%), Query Frame = 3
Query:  384 ISGQNFINTTLSYNALSHYGPEQ----INLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLS-LDYLRLDNNENLILLEGSFRGLV-VSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICK 1004
            I  +N     L  NAL+   P      I L++L L+   I+ I P+AF  L  L  L++ NN+LK + +G F  L+ L+ L LDNN    L   +  GL  +  L ++   +++L  ++    +  LT + LS N+L  ID       + L+ + L +NP+ C C +  L   L   Q     +    LRC +P+E   + +  L    L CK
Sbjct:  147 IGMRNLSELDLPLNALTALPPNAFKPLIALKVLDLSLNRIQRISPKAFVGLEELLFLNMDNNKLKSIQAGTFGPLTGLEMLVLDNNLLSTLTVSTLEGLSNLQELYVRKNEIESLPADVFLH-TPKLTHVGLSGNRLHAIDGNMLANMQGLKEVFLHDNPWKCDCSINSLVHYLA--QTKTNHSPRQRLRCASPEEFRDRAIQELKSEELSCK 356          
BLAST of Slit-2 vs. Ensembl Zebrafish
Match: si:cabz01090165.1 (si:cabz01090165.1 [Source:ZFIN;Acc:ZDB-GENE-161017-71])

HSP 1 Score: 66.6254 bits (161), Expect = 4.528e-11
Identity = 87/374 (23.26%), Postives = 148/374 (39.57%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLV--VSSLSLKSCYLKNLSYEIIKEVSG-----------------------HLTKLYLSHNQLSGIX-----------XXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKE--IDIFLHGNNSGRLSCEAINALETNVKW---RHKLFASENYYRFQDYSPALGRSLISIESRNNVDHYSCYVQNSKGKVNIDVNIM 1265
            CP  C  Q  L    V      L  +P NI +    + +   NFI T+L +   ++      +L  L L+   I  I P AF+ L  L +L L  NRL +L     +GL +L +L L NN+   + EG+F+  +  +  L L    L +L ++ I  ++                         L +L ++ N+L  I             K +       ++    NP  C C+L WL      R+  +E  L +   C +P+EL+G+   ++ E   +C+PP +      +F+       L C ++   E  V W     KL A+ +     D     G   I   +  +   ++C   N+ G+    V ++
Sbjct:   23 CPKRCTCQNLLPSYTVLCAKTGLLFVPPNIDRQTAELRLM-DNFI-TSLRHRDFANMS----SLIHLTLSRNTISQIRPYAFADLQDLHALHLDANRLTVLDDTHLQGLVNLRHLILANNQIHSISEGAFQDFLETLEDLDLSYNNLVDLPWDTIAMLASVNTLSLDHNLIEFVPEGIFSNLHKLARLDMTSNKLKKIPPDPLFLRIPVYAKMKGSPLTALVLSFGGNPLHCNCELVWL------RRLTREDDLET---CASPRELAGKYFWTIREEEFVCEPPMITRHTSKMFVMEGQEVSLRCRSVGDPEPIVHWISPDGKLIANTSRTVCYDN----GSLDILTATVKDSGVFTCIASNAAGEATAPVELV 377          
BLAST of Slit-2 vs. Ensembl Zebrafish
Match: si:cabz01090165.1 (si:cabz01090165.1 [Source:ZFIN;Acc:ZDB-GENE-161017-71])

HSP 1 Score: 66.6254 bits (161), Expect = 4.528e-11
Identity = 87/374 (23.26%), Postives = 148/374 (39.57%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLV--VSSLSLKSCYLKNLSYEIIKEVSG-----------------------HLTKLYLSHNQLSGIX-----------XXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKE--IDIFLHGNNSGRLSCEAINALETNVKW---RHKLFASENYYRFQDYSPALGRSLISIESRNNVDHYSCYVQNSKGKVNIDVNIM 1265
            CP  C  Q  L    V      L  +P NI +    + +   NFI T+L +   ++      +L  L L+   I  I P AF+ L  L +L L  NRL +L     +GL +L +L L NN+   + EG+F+  +  +  L L    L +L ++ I  ++                         L +L ++ N+L  I             K +       ++    NP  C C+L WL      R+  +E  L +   C +P+EL+G+   ++ E   +C+PP +      +F+       L C ++   E  V W     KL A+ +     D     G   I   +  +   ++C   N+ G+    V ++
Sbjct:   23 CPKRCTCQNLLPSYTVLCAKTGLLFVPPNIDRQTAELRLM-DNFI-TSLRHRDFANMS----SLIHLTLSRNTISQIRPYAFADLQDLHALHLDANRLTVLDDTHLQGLVNLRHLILANNQIHSISEGAFQDFLETLEDLDLSYNNLVDLPWDTIAMLASVNTLSLDHNLIEFVPEGIFSNLHKLARLDMTSNKLKKIPPDPLFLRIPVYAKMKGSPLTALVLSFGGNPLHCNCELVWL------RRLTREDDLET---CASPRELAGKYFWTIREEEFVCEPPMITRHTSKMFVMEGQEVSLRCRSVGDPEPIVHWISPDGKLIANTSRTVCYDN----GSLDILTATVKDSGVFTCIASNAAGEATAPVELV 377          
BLAST of Slit-2 vs. Ensembl Zebrafish
Match: slit2 (slit homolog 2 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-010306-3])

HSP 1 Score: 65.4698 bits (158), Expect = 1.631e-10
Identity = 70/262 (26.72%), Postives = 112/262 (42.75%), Query Frame = 3
Query:  249 CVEPRAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFIN-TTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLI--LLEGSFRGLV-VSSLSLK----SCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPP 1010
            C      CPS C      SG  V      L ++P NIP+ +  + ++  N    T   +  L        NLR+LQL    I +IE  AF  L  L+ L L+ N L++L   +F G +    RLD +EN I  +   +FRG   + +L L     SC +++ ++  +++    L  L L++N +S +         +L    L  N   C C + WL+  L+ R       L    +C  P  L G  +  + +   +C  P
Sbjct:   14 CGAGAQSCPSQCS----CSGTAVDCHGQSLRSVPRNIPRNVERLDLNANNLTKITKADFAGLK-------NLRVLQLMENKISSIERGAFQDLQELERLRLNRNNLQVLPELLFLG-TTKLFRLDLSENQIQGIPRKAFRGSTEIKNLQLDYNQISC-IEDGAFRALRD----LEVLTLNNNNISRLSVASFNHMPKLRTFRLHSNNLLCDCNVAWLSDWLRQRPR-----LGLYTQCMAPPSLRGHNIAEVQKKEFMCTGP 253          

HSP 2 Score: 56.6102 bits (135), Expect = 7.498e-8
Identity = 73/268 (27.24%), Postives = 113/268 (42.16%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKN-LSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSC 1067
            CP  C      S  +V      LT +P N+P+ I  I +                    EQ +++I          I   AF+    L+ +DLSNN++  L S  F+GL SL+ L L  N+   L +G F GL    L L +    N L  +  +++  +L  L L  N+L  I K        ++ + L +NPF C C L+WL   L+        A     RCT+P+ L+ + +  +      C   GV++    L G+    L+C
Sbjct:  264 CPELCT----CSNNVVDCRGKGLTEIPTNLPETITEIRL--------------------EQNSIKI----------IPAGAFAPYKRLRRIDLSNNQITELASDSFQGLRSLNSLVLYGNKITELPKGLFDGLFSLQLLLLNANKINCLRVDSFQDLQ-NLNLLSLYDNKLQTIAKGTFSSLRAIQTLHLAQNPFMCDCHLKWLADYLQDNPIETSGA-----RCTSPRRLANKRIGQIKSKKFRCS--GVEDYRSKLGGDCFADLAC 489          

HSP 3 Score: 54.299 bits (129), Expect = 4.917e-7
Identity = 65/228 (28.51%), Postives = 96/228 (42.11%), Query Frame = 3
Query:  267 GCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLS-LDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNP 947
             CP  C+ +    G  V     KLT +P +IP+    + ++   F  T L    +    P+   LR + L+   I +IE   F     +  L L++NRL+ +H  + KGL  L  L L +N    +  GSF GL  SS+ L S Y  NL   I     G    L+     LS ++                 NPF C C L WL + L+     K++ +    RC +P
Sbjct:  488 ACPEKCRCE----GTTVDCSGQKLTKIPDHIPQYTAELRLNNNEF--TVLEATGIFKKLPQ---LRKINLSNNKITDIEEGTFEGASGVNELILTSNRLEGVHYSMLKGLGGLRTLMLRSNRISCVNNGSFTGL--SSVRLLSLY-DNL---ITSMSPGAFDTLH----SLSTLNLLA--------------NPFNCNCHLAWLGEWLR-----KKRIVTGNPRCQSP 677          
BLAST of Slit-2 vs. Ensembl Zebrafish
Match: slit2 (slit homolog 2 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-010306-3])

HSP 1 Score: 65.0846 bits (157), Expect = 1.806e-10
Identity = 70/262 (26.72%), Postives = 112/262 (42.75%), Query Frame = 3
Query:  249 CVEPRAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFIN-TTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLI--LLEGSFRGLV-VSSLSLK----SCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPP 1010
            C      CPS C      SG  V      L ++P NIP+ +  + ++  N    T   +  L        NLR+LQL    I +IE  AF  L  L+ L L+ N L++L   +F G +    RLD +EN I  +   +FRG   + +L L     SC +++ ++  +++    L  L L++N +S +         +L    L  N   C C + WL+  L+ R       L    +C  P  L G  +  + +   +C  P
Sbjct:   14 CGAGAQSCPSQCS----CSGTAVDCHGQSLRSVPRNIPRNVERLDLNANNLTKITKADFAGLK-------NLRVLQLMENKISSIERGAFQDLQELERLRLNRNNLQVLPELLFLG-TTKLFRLDLSENQIQGIPRKAFRGSTEIKNLQLDYNQISC-IEDGAFRALRD----LEVLTLNNNNISRLSVASFNHMPKLRTFRLHSNNLLCDCNVAWLSDWLRQRPR-----LGLYTQCMAPPSLRGHNIAEVQKKEFMCTGP 253          

HSP 2 Score: 56.6102 bits (135), Expect = 8.299e-8
Identity = 73/268 (27.24%), Postives = 113/268 (42.16%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKN-LSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSC 1067
            CP  C      S  +V      LT +P N+P+ I  I +                    EQ +++I          I   AF+    L+ +DLSNN++  L S  F+GL SL+ L L  N+   L +G F GL    L L +    N L  +  +++  +L  L L  N+L  I K        ++ + L +NPF C C L+WL   L+        A     RCT+P+ L+ + +  +      C   GV++    L G+    L+C
Sbjct:  264 CPELCT----CSNNVVDCRGKGLTEIPTNLPETITEIRL--------------------EQNSIKI----------IPAGAFAPYKRLRRIDLSNNQITELASDSFQGLRSLNSLVLYGNKITELPKGLFDGLFSLQLLLLNANKINCLRVDSFQDLQ-NLNLLSLYDNKLQTIAKGTFSSLRAIQTLHLAQNPFMCDCHLKWLADYLQDNPIETSGA-----RCTSPRRLANKRIGQIKSKKFRCS--GVEDYRSKLGGDCFADLAC 489          

HSP 3 Score: 53.9138 bits (128), Expect = 5.215e-7
Identity = 65/228 (28.51%), Postives = 96/228 (42.11%), Query Frame = 3
Query:  267 GCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLS-LDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNP 947
             CP  C+ +    G  V     KLT +P +IP+    + ++   F  T L    +    P+   LR + L+   I +IE   F     +  L L++NRL+ +H  + KGL  L  L L +N    +  GSF GL  SS+ L S Y  NL   I     G    L+     LS ++                 NPF C C L WL + L+     K++ +    RC +P
Sbjct:  488 ACPEKCRCE----GTTVDCSGQKLTKIPDHIPQYTAELRLNNNEF--TVLEATGIFKKLPQ---LRKINLSNNKITDIEEGTFEGASGVNELILTSNRLEGVHYSMLKGLGGLRTLMLRSNRISCVNNGSFTGL--SSVRLLSLY-DNL---ITSMSPGAFDTLH----SLSTLNLLA--------------NPFNCNCHLAWLGEWLR-----KKRIVTGNPRCQSP 677          
BLAST of Slit-2 vs. Ensembl Xenopus
Match: ENSXETT00000007893.1 (leucine rich repeat and fibronectin type III domain containing 4 [Source:NCBI gene;Acc:101734445])

HSP 1 Score: 70.0922 bits (170), Expect = 5.810e-12
Identity = 92/374 (24.60%), Postives = 156/374 (41.71%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNK-LTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKG-LSLDYLRLDNNENLILLEGSFRG--LVVSSLSLK----------------SCYLKNLSYEIIKEV-SGHLTKLY------LSHNQL-----------SGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKE--IDIFLHGNNSGRLSCEAINALETNVKW---RHKLFASENYYRFQDYSPALGRSLISIESRNNVDHYSCYVQNSKGKVNIDVNI 1262
            CP +C  Q  LS  L  +  NK L  +P  I +    + ++  NFI      + L+  G     L  L L+   I+NI+P AF  L +L+SL L  NRL ++H    +G L+L +L ++NN+ + +   +F    L +  L L                 S +  NL + +I+ V  G  ++LY      ++ N+L           S         +    +++   NPF C C+L WL      R+  +E  + +   C +P +L+G+   S+ E    C+PP +      +++       L C AI   E  + W     K+    N  R   Y    G   I + +  +   Y+C   N+ G+    V++
Sbjct:   21 CPFHCTCQN-LSESLSTLCANKGLLYVPPYIDRRTVELRLA-DNFIRVVEQEDFLNMTG-----LVDLTLSRNTIDNIKPYAFGDLESLRSLHLDGNRLTLIHEEALRGMLNLQHLIINNNQLVTIPVATFDDFHLTLEDLDLSYNNLVSVPWEAIQNMVSLHTLNLDHNLIESVMEGTFSELYKLSRLDMTSNRLHTLPPDPLFVRSQTGVISPTPYTSTIVLNFGGNPFHCNCELLWL------RRLVREDDMET---CASPSQLAGRYFWSIPEEEFTCEPPLITRHTHQLWVLEGQRATLKCRAIGDPEPVIHWVSPDDKIMP--NSSRTASYRN--GTLDILVTTIRDDGSYTCIAINAAGESTAQVDL 374          
BLAST of Slit-2 vs. Ensembl Xenopus
Match: rrn3 (RRN3 homolog, RNA polymerase I transcription factor [Source:Xenbase;Acc:XB-GENE-990491])

HSP 1 Score: 67.0106 bits (162), Expect = 5.127e-11
Identity = 88/375 (23.47%), Postives = 153/375 (40.80%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNK-LTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLV--VSSLSLKSCYLKNLSYEIIKEVSG-----------------------HLTKLYLSHNQL-----------SGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEID---IFLHGNNSGRLSCEAINALETNVKW---RHKLFASENYYRFQDYSPALGRSLISIESRNNVDHYSCYVQNSKGKVNIDVNI 1262
            CP YC  Q  LS  L  + P K L  +P++I +    + + G NFI +    +  +  G     L  L L+   I  I+P +F  L +L+SL L +NRL  L   +F+GL +L +L ++NN+   + E +F  L+  +  L L    LK + ++ ++ +                          L +L L+ N+L           S I       F     +    NP  C C+L WL      R+  +E  + +   C +P  L G+    + E   +C+PP + +     + L G  +  L C+A+      + W     +L  + +     D     G   I I +  +   ++C   N+ G++   V +
Sbjct:   20 CPKYCVCQN-LSESLGTLCPTKGLLFVPMDIDRRTVELRLGG-NFIISINRQDFANMTG-----LVDLTLSRNTISYIQPYSFIDLESLRSLHLDSNRLTNLGDDVFRGLINLQHLIMNNNQLNSIAEDAFEDLLQTLEDLDLSYNNLKTVPWDAVRRMVNLHQLSLDHNLIYYITEGTFQDLNKLARLDLTSNRLQKLPPDPIFARSQISMTSATPFSPPLSLSFGGNPLHCNCELLWL------RRLDREDDMET---CASPSALKGRYFWYVREEEFVCEPPLITQYTQRLLVLEG-QTASLKCKAVGDPLPVIHWVAPDGRLIGNSSRTTVYDN----GTLDILITTSKDYGTFTCIAANAAGELTAPVEL 373          
BLAST of Slit-2 vs. Ensembl Xenopus
Match: slit1 (slit guidance ligand 1 [Source:NCBI gene;Acc:100036682])

HSP 1 Score: 67.0106 bits (162), Expect = 7.639e-11
Identity = 74/254 (29.13%), Postives = 113/254 (44.49%), Query Frame = 3
Query:  249 CVEPRAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLI--LLEGSFRGLV-VSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            CV    GCP+ C      SG  V      L  +P NIP+    + + G N   T ++ N  S  G +Q  LR+LQL    I N+E  AF  +  L+ L L+ N+L  L   +F+  +    RLD +ENLI  +   +FRG   + +L L    +  +     + + G L  L L++N ++ I         +L    L  N  FC C L WL++ L+ R       L ++  CT P  L G  +  + +    C
Sbjct:   13 CVLCANGCPALCT----CSGTTVDCHGLALKGVPKNIPRSTERLELYGNNI--TRINKNDFS--GLKQ--LRVLQLMENQISNVERGAFDDMKELERLRLNRNQLHTLPELLFQN-NQALSRLDLSENLIQAIPRKTFRGATELKNLQLDKNQISCIEDGAFRALRG-LEVLTLNNNNITAIPVSSFNHMPKLRTFRLHSNNLFCDCHLAWLSQWLRQRPTI---GLFTQ--CTGPSPLRGLNVAEIQKHEFSC 249          

HSP 2 Score: 57.7658 bits (138), Expect = 5.218e-8
Identity = 61/209 (29.19%), Postives = 84/209 (40.19%), Query Frame = 3
Query:  333 KLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKEL 956
            KLT +P  IP+    + ++       TL    L    P   +L+ + L+   I  IE  AF    ++  L L+ N L+ + SG+F+GL  L  L L NN    +   SF GL    L                        L L  NQ+S I        + L  ++L  NPF C CQL WL   L+ R     K +    RC NP  L
Sbjct:  512 KLTKIPDRIPQSTAELRLNNNEI--ATLEATGLFRKLP---HLKKINLSNNKISEIEDAAFEGAASVSELHLTANHLESVRSGMFRGLEGLRTLMLRNNRVSCVHNDSFTGLRNVRL------------------------LSLYDNQISTITPGAFDTLQSLSTLNLLANPFNCNCQLAWLGDWLRKR-----KIVTGNPRCQNPDFL 686          

HSP 3 Score: 55.8398 bits (133), Expect = 1.882e-7
Identity = 66/256 (25.78%), Postives = 105/256 (41.02%), Query Frame = 3
Query:  264 AGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLEG-SFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC--KPPGVKE 1022
              CP+ C    C +G + C     LTA+P N+P+ +  I +        ++   A S Y      LR + L+   I  I P+AF  L +L SL L  N++  L  G+F GL    L L N   +  +   +F+             L+NLS             L L  N++  + K        ++ + L +NPF C C L+WL   L+        A     RC +P+ L+ + +  +      C  K PG ++
Sbjct:  266 GSCPAMCT---CSNGIVDC-RGKGLTAIPANLPETMTEIRLELNGI--KSVPPGAFSPYK----KLRRIDLSNNQISEIAPDAFQGLRSLNSLVLYGNKITDLPKGVFSGLHALQLLLLNANKINCIRADTFQD------------LQNLSL------------LSLYDNKIQSLAKGTFAALRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSGA-----RCASPRRLANKRIGQIKSKKFRCSGKMPGTED 482          
BLAST of Slit-2 vs. Ensembl Xenopus
Match: slit1 (slit guidance ligand 1 [Source:NCBI gene;Acc:100036682])

HSP 1 Score: 66.2402 bits (160), Expect = 1.243e-10
Identity = 72/248 (29.03%), Postives = 111/248 (44.76%), Query Frame = 3
Query:  267 GCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLI--LLEGSFRGLV-VSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            GCP+ C      SG  V      L  +P NIP+    + + G N   T ++ N  S  G +Q  LR+LQL    I N+E  AF  +  L+ L L+ N+L  L   +F+  +    RLD +ENLI  +   +FRG   + +L L    +  +     + + G L  L L++N ++ I         +L    L  N  FC C L WL++ L+ R       L ++  CT P  L G  +  + +    C
Sbjct:   32 GCPALCT----CSGTTVDCHGLALKGVPKNIPRSTERLELYGNNI--TRINKNDFS--GLKQ--LRVLQLMENQISNVERGAFDDMKELERLRLNRNQLHTLPELLFQN-NQALSRLDLSENLIQAIPRKTFRGATELKNLQLDKNQISCIEDGAFRALRG-LEVLTLNNNNITAIPVSSFNHMPKLRTFRLHSNNLFCDCHLAWLSQWLRQRPTI---GLFTQ--CTGPSPLRGLNVAEIQKHEFSC 262          

HSP 2 Score: 57.7658 bits (138), Expect = 5.435e-8
Identity = 61/209 (29.19%), Postives = 84/209 (40.19%), Query Frame = 3
Query:  333 KLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKEL 956
            KLT +P  IP+    + ++       TL    L    P   +L+ + L+   I  IE  AF    ++  L L+ N L+ + SG+F+GL  L  L L NN    +   SF GL    L                        L L  NQ+S I        + L  ++L  NPF C CQL WL   L+ R     K +    RC NP  L
Sbjct:  529 KLTKIPDRIPQSTAELRLNNNEI--ATLEATGLFRKLP---HLKKINLSNNKISEIEDAAFEGAASVSELHLTANHLESVRSGMFRGLEGLRTLMLRNNRVSCVHNDSFTGLRNVRL------------------------LSLYDNQISTITPGAFDTLQSLSTLNLLANPFNCNCQLAWLGDWLRKR-----KIVTGNPRCQNPDFL 703          

HSP 3 Score: 54.299 bits (129), Expect = 6.377e-7
Identity = 63/247 (25.51%), Postives = 100/247 (40.49%), Query Frame = 3
Query:  264 AGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLEG-SFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
              CP+ C    C +G + C     LTA+P N+P+ +  I +        ++   A S Y      LR + L+   I  I P+AF  L +L SL L  N++  L  G+F GL    L L N   +  +   +F+             L+NLS             L L  N++  + K        ++ + L +NPF C C L+WL   L+        A     RC +P+ L+ + +  +      C
Sbjct:  279 GSCPAMCT---CSNGIVDC-RGKGLTAIPANLPETMTEIRLELNGI--KSVPPGAFSPYK----KLRRIDLSNNQISEIAPDAFQGLRSLNSLVLYGNKITDLPKGVFSGLHALQLLLLNANKINCIRADTFQD------------LQNLSL------------LSLYDNKIQSLAKGTFAALRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSGA-----RCASPRRLANKRIGQIKSKKFRC 486          
BLAST of Slit-2 vs. Ensembl Xenopus
Match: slit1 (slit guidance ligand 1 [Source:NCBI gene;Acc:100036682])

HSP 1 Score: 66.2402 bits (160), Expect = 1.253e-10
Identity = 72/248 (29.03%), Postives = 111/248 (44.76%), Query Frame = 3
Query:  267 GCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLI--LLEGSFRGLV-VSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            GCP+ C      SG  V      L  +P NIP+    + + G N   T ++ N  S  G +Q  LR+LQL    I N+E  AF  +  L+ L L+ N+L  L   +F+  +    RLD +ENLI  +   +FRG   + +L L    +  +     + + G L  L L++N ++ I         +L    L  N  FC C L WL++ L+ R       L ++  CT P  L G  +  + +    C
Sbjct:   32 GCPALCT----CSGTTVDCHGLALKGVPKNIPRSTERLELYGNNI--TRINKNDFS--GLKQ--LRVLQLMENQISNVERGAFDDMKELERLRLNRNQLHTLPELLFQN-NQALSRLDLSENLIQAIPRKTFRGATELKNLQLDKNQISCIEDGAFRALRG-LEVLTLNNNNITAIPVSSFNHMPKLRTFRLHSNNLFCDCHLAWLSQWLRQRPTI---GLFTQ--CTGPSPLRGLNVAEIQKHEFSC 262          

HSP 2 Score: 57.7658 bits (138), Expect = 5.161e-8
Identity = 61/209 (29.19%), Postives = 84/209 (40.19%), Query Frame = 3
Query:  333 KLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKEL 956
            KLT +P  IP+    + ++       TL    L    P   +L+ + L+   I  IE  AF    ++  L L+ N L+ + SG+F+GL  L  L L NN    +   SF GL    L                        L L  NQ+S I        + L  ++L  NPF C CQL WL   L+ R     K +    RC NP  L
Sbjct:  520 KLTKIPDRIPQSTAELRLNNNEI--ATLEATGLFRKLP---HLKKINLSNNKISEIEDAAFEGAASVSELHLTANHLESVRSGMFRGLEGLRTLMLRNNRVSCVHNDSFTGLRNVRL------------------------LSLYDNQISTITPGAFDTLQSLSTLNLLANPFNCNCQLAWLGDWLRKR-----KIVTGNPRCQNPDFL 694          

HSP 3 Score: 56.225 bits (134), Expect = 1.753e-7
Identity = 66/256 (25.78%), Postives = 105/256 (41.02%), Query Frame = 3
Query:  264 AGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLEG-SFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC--KPPGVKE 1022
              CP+ C    C +G + C     LTA+P N+P+ +  I +        ++   A S Y      LR + L+   I  I P+AF  L +L SL L  N++  L  G+F GL    L L N   +  +   +F+             L+NLS             L L  N++  + K        ++ + L +NPF C C L+WL   L+        A     RC +P+ L+ + +  +      C  K PG ++
Sbjct:  274 GSCPAMCT---CSNGIVDC-RGKGLTAIPANLPETMTEIRLELNGI--KSVPPGAFSPYK----KLRRIDLSNNQISEIAPDAFQGLRSLNSLVLYGNKITDLPKGVFSGLHALQLLLLNANKINCIRADTFQD------------LQNLSL------------LSLYDNKIQSLAKGTFAALRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSGA-----RCASPRRLANKRIGQIKSKKFRCSGKMPGTED 490          
BLAST of Slit-2 vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 70.4774 bits (171), Expect = 3.842e-12
Identity = 72/258 (27.91%), Postives = 117/258 (45.35%), Query Frame = 3
Query:  252 VEPRAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFIN-TTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLI--LLEGSFRGLV-VSSLSLK----SCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            V P+A CP+ C      SG  V      L ++P NIP+    + ++G N    T + +  L H       LR+LQL    I  IE  AF  L  L+ L L+ N L++    +F G +  Y RLD +EN I  +   +FRG V + +L L     SC +++ ++  +++    L  L L++N ++ +         +L    L  N  +C C L WL+  L+ R       L ++  C  P  L G  +  + +   +C
Sbjct:   23 VAPQA-CPAQCS----CSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKIDFAGLRH-------LRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQLFPELLFLGTAKLY-RLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISC-IEDGAFRALRD----LEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV---GLYTQ--CMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 57.3806 bits (137), Expect = 5.008e-8
Identity = 70/267 (26.22%), Postives = 106/267 (39.70%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLE-GSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSC 1067
            CP+ C      S  +V      LT +P N+P+ I  I +  QN I   +   A S Y      LR L L+   I  + P+AF  L +L SL L  N++  L   +F+GL    L L N   +  L   +F+ L                         +L  L L  N+L  + K        ++ + L +NPF C C L+WL   L         A     RCT+P+ L+ + +  +      C   G ++    L G+    L+C
Sbjct:  273 CPAACT----CSNNIVDCRGKGLTEIPTNLPETITEIRLE-QNSIRV-IPPGAFSPYK----KLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDL------------------------HNLNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGA-----RCTSPRRLANKRIGQIKSKKFRCS--GTEDYRSKLSGDCFADLAC 498          

HSP 3 Score: 50.447 bits (119), Expect = 6.404e-6
Identity = 56/228 (24.56%), Postives = 91/228 (39.91%), Query Frame = 3
Query:  267 GCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNP 947
             CP  C+ +    G  V     +L  +P +IP+    + ++   F  T L    +    P+   LR +  +   I +IE  AF     +  + L++NRL+ +   +FKGL SL  L L +N    +   SF GL                        G +  L L  NQ++ +          L  ++L  NPF C C L WL + L+     +++ +    RC  P
Sbjct:  497 ACPEKCRCE----GTTVDCSNQRLNKIPDHIPQYTAELRLNNNEF--TVLEATGIFKKLPQ---LRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFIGL------------------------GSVRLLSLYDNQITTVAPGAFDSLHSLSTLNLLANPFNCNCHLAWLGEWLR-----RKRIVTGNPRCQKP 686          
BLAST of Slit-2 vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 70.0922 bits (170), Expect = 6.980e-12
Identity = 72/258 (27.91%), Postives = 117/258 (45.35%), Query Frame = 3
Query:  252 VEPRAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFIN-TTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLI--LLEGSFRGLV-VSSLSLK----SCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            V P+A CP+ C      SG  V      L ++P NIP+    + ++G N    T + +  L H       LR+LQL    I  IE  AF  L  L+ L L+ N L++    +F G +  Y RLD +EN I  +   +FRG V + +L L     SC +++ ++  +++    L  L L++N ++ +         +L    L  N  +C C L WL+  L+ R       L ++  C  P  L G  +  + +   +C
Sbjct:   23 VAPQA-CPAQCS----CSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKIDFAGLRH-------LRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQLFPELLFLGTAKLY-RLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISC-IEDGAFRALRD----LEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV---GLYTQ--CMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 58.151 bits (139), Expect = 3.343e-8
Identity = 71/273 (26.01%), Postives = 107/273 (39.19%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLE-GSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKP------PGVKEIDIFLHGNNSGRLSC 1067
            CP+ C      S  +V      LT +P N+P+ I  I +  QN I   +   A S Y      LR L L+   I  + P+AF  L +L SL L  N++  L   +F+GL    L L N   +  L   +F+ L                         +L  L L  N+L  + K        ++ + L +NPF C C L+WL   L         A     RCT+P+ L+ + +  +      C        PG ++    L G+    L+C
Sbjct:  277 CPAACT----CSNNIVDCRGKGLTEIPTNLPETITEIRLE-QNSIRV-IPPGAFSPYK----KLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDL------------------------HNLNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGA-----RCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRSKLSGDCFADLAC 510          
BLAST of Slit-2 vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 69.707 bits (169), Expect = 7.658e-12
Identity = 72/258 (27.91%), Postives = 117/258 (45.35%), Query Frame = 3
Query:  252 VEPRAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFIN-TTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLI--LLEGSFRGLV-VSSLSLK----SCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            V P+A CP+ C      SG  V      L ++P NIP+    + ++G N    T + +  L H       LR+LQL    I  IE  AF  L  L+ L L+ N L++    +F G +  Y RLD +EN I  +   +FRG V + +L L     SC +++ ++  +++    L  L L++N ++ +         +L    L  N  +C C L WL+  L+ R       L ++  C  P  L G  +  + +   +C
Sbjct:   23 VAPQA-CPAQCS----CSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKIDFAGLRH-------LRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQLFPELLFLGTAKLY-RLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISC-IEDGAFRALRD----LEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV---GLYTQ--CMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 56.9954 bits (136), Expect = 7.026e-8
Identity = 70/267 (26.22%), Postives = 106/267 (39.70%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLE-GSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSC 1067
            CP+ C      S  +V      LT +P N+P+ I  I +  QN I   +   A S Y      LR L L+   I  + P+AF  L +L SL L  N++  L   +F+GL    L L N   +  L   +F+ L                         +L  L L  N+L  + K        ++ + L +NPF C C L+WL   L         A     RCT+P+ L+ + +  +      C   G ++    L G+    L+C
Sbjct:  273 CPAACT----CSNNIVDCRGKGLTEIPTNLPETITEIRLE-QNSIRV-IPPGAFSPYK----KLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDL------------------------HNLNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGA-----RCTSPRRLANKRIGQIKSKKFRCS--GTEDYRSKLSGDCFADLAC 498          
BLAST of Slit-2 vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 69.707 bits (169), Expect = 8.068e-12
Identity = 72/258 (27.91%), Postives = 117/258 (45.35%), Query Frame = 3
Query:  252 VEPRAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFIN-TTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLI--LLEGSFRGLV-VSSLSLK----SCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            V P+A CP+ C      SG  V      L ++P NIP+    + ++G N    T + +  L H       LR+LQL    I  IE  AF  L  L+ L L+ N L++    +F G +  Y RLD +EN I  +   +FRG V + +L L     SC +++ ++  +++    L  L L++N ++ +         +L    L  N  +C C L WL+  L+ R       L ++  C  P  L G  +  + +   +C
Sbjct:   23 VAPQA-CPAQCS----CSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKIDFAGLRH-------LRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQLFPELLFLGTAKLY-RLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISC-IEDGAFRALRD----LEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV---GLYTQ--CMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 56.9954 bits (136), Expect = 7.273e-8
Identity = 70/267 (26.22%), Postives = 106/267 (39.70%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLE-GSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSC 1067
            CP+ C      S  +V      LT +P N+P+ I  I +  QN I   +   A S Y      LR L L+   I  + P+AF  L +L SL L  N++  L   +F+GL    L L N   +  L   +F+ L                         +L  L L  N+L  + K        ++ + L +NPF C C L+WL   L         A     RCT+P+ L+ + +  +      C   G ++    L G+    L+C
Sbjct:  277 CPAACT----CSNNIVDCRGKGLTEIPTNLPETITEIRLE-QNSIRV-IPPGAFSPYK----KLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDL------------------------HNLNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGA-----RCTSPRRLANKRIGQIKSKKFRCS--GTEDYRSKLSGDCFADLAC 502          
BLAST of Slit-2 vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 69.707 bits (169), Expect = 8.442e-12
Identity = 72/258 (27.91%), Postives = 117/258 (45.35%), Query Frame = 3
Query:  252 VEPRAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFIN-TTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLI--LLEGSFRGLV-VSSLSLK----SCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            V P+A CP+ C      SG  V      L ++P NIP+    + ++G N    T + +  L H       LR+LQL    I  IE  AF  L  L+ L L+ N L++    +F G +  Y RLD +EN I  +   +FRG V + +L L     SC +++ ++  +++    L  L L++N ++ +         +L    L  N  +C C L WL+  L+ R       L ++  C  P  L G  +  + +   +C
Sbjct:   23 VAPQA-CPAQCS----CSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKIDFAGLRH-------LRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQLFPELLFLGTAKLY-RLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISC-IEDGAFRALRD----LEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV---GLYTQ--CMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 57.7658 bits (138), Expect = 3.708e-8
Identity = 71/273 (26.01%), Postives = 107/273 (39.19%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLE-GSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKP------PGVKEIDIFLHGNNSGRLSC 1067
            CP+ C      S  +V      LT +P N+P+ I  I +  QN I   +   A S Y      LR L L+   I  + P+AF  L +L SL L  N++  L   +F+GL    L L N   +  L   +F+ L                         +L  L L  N+L  + K        ++ + L +NPF C C L+WL   L         A     RCT+P+ L+ + +  +      C        PG ++    L G+    L+C
Sbjct:  277 CPAACT----CSNNIVDCRGKGLTEIPTNLPETITEIRLE-QNSIRV-IPPGAFSPYK----KLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDL------------------------HNLNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGA-----RCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRSKLSGDCFADLAC 510          
BLAST of Slit-2 vs. UniProt/SwissProt
Match: sp|Q50LG9|LRC24_HUMAN (Leucine-rich repeat-containing protein 24 OS=Homo sapiens OX=9606 GN=LRRC24 PE=2 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 1.650e-15
Identity = 93/303 (30.69%), Postives = 137/303 (45.21%), Query Frame = 3
Query:  267 GCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLS-LDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKE----VSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELR---CTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHGN--NSGRLSCEAINALETNVKWRHKLFASENYYRFQ 1145
            GCP+ C+   C S  + C    +L  +PL IP     + +   N     L   AL+        LR L L   ++  +E  AF     L  L L++NRL+ L SG F GL+ L  L L  N+   LL+ +F  L      L+  +L+  S E++++        L  L LS NQL  I ++       L+++ L ENP+ C C L WL   +K      ++ L S  R   C  P  L+ Q+L+ +S S+LIC PP V    + L  N     R++C+A    +  V WR      E   R Q
Sbjct:   22 GCPAACR---CYSATVECGA-LRLRVVPLGIPPGTQTLFLQDNNI--ARLEPGALAPLA----ALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRSGAFVGLAQLRVLYLAGNQLARLLDFTFLHLP----RLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQPLASLQVLRLTENPWRCDCALHWLGAWIK---EGGQRLLTSRDRKIMCAEPPRLALQSLLDVSHSSLICIPPSVHVQPLELTANLGEDLRVACQASGYPQPLVTWRKVPQPREGRPRAQ 307          
BLAST of Slit-2 vs. UniProt/SwissProt
Match: sp|P24014|SLIT_DROME (Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 6.382e-13
Identity = 75/250 (30.00%), Postives = 110/250 (44.00%), Query Frame = 3
Query:  264 AGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVS----GHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            A CP  C      +G  V      LT++P  I   +  + + G N    T+ Y            LR+LQLT   I  IE  +F  L++L+ L L+NNRLK +    F   S   LRLD + N+I   G  R +   + SL+S  L N     + E +      L  L L++N L+ +         RL  + L +NPF C C L WL++ L++        L    RC +P +L GQ +  L +    C
Sbjct:   71 ARCPRVCS----CTGLNVDCSHRGLTSVPRKISADVERLELQGNNL---TVIYETDFQ---RLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPEN-FVTSSASLLRLDISNNVITTVG--RRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATR-----LAPYTRCQSPSQLKGQNVADLHDQEFKC 302          

HSP 2 Score: 60.4622 bits (145), Expect = 3.999e-8
Identity = 76/252 (30.16%), Postives = 108/252 (42.86%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDN-NENLILLEGSFRGLVVSSL------SLKSCYLKNLSYEIIKEVSG-HLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            CP  C+   C  G + C E   LT++P+ +P     + +  QNFI T L   + S +      LR + L+  NI  I  +A S L  L +L L  N++K L SG+FKGL    L L N NE   + + +FR L   SL      +++S  L N +++ +K +   HL K                             NPF C C LRWL   L      K     S  RC +PK +  + + SL E    C
Sbjct:  319 CPHPCR---CADGIVDCRE-KSLTSVPVTLPDDTTELRLE-QNFI-TELPPKSFSSF----RRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQS--LANGTFDAMKSIKTVHLAK-----------------------------NPFICDCNLRWLADYLH-----KNPIETSGARCESPKRMHRRRIESLREEKFKC 524          
BLAST of Slit-2 vs. UniProt/SwissProt
Match: sp|Q9R1B9|SLIT2_MOUSE (Slit homolog 2 protein OS=Mus musculus OX=10090 GN=Slit2 PE=2 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 5.357e-11
Identity = 72/258 (27.91%), Postives = 117/258 (45.35%), Query Frame = 3
Query:  252 VEPRAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFIN-TTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLI--LLEGSFRGLV-VSSLSLK----SCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            V P+A CP+ C      SG  V      L ++P NIP+    + ++G N    T + +  L H       LR+LQL    I  IE  AF  L  L+ L L+ N L++    +F G +  Y RLD +EN I  +   +FRG V + +L L     SC +++ ++  +++    L  L L++N ++ +         +L    L  N  +C C L WL+  L+ R       L ++  C  P  L G  +  + +   +C
Sbjct:   23 VAPQA-CPAQCS----CSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKIDFAGLRH-------LRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQLFPELLFLGTAKLY-RLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISC-IEDGAFRALRD----LEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV---GLYTQ--CMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 56.9954 bits (136), Expect = 4.915e-7
Identity = 70/267 (26.22%), Postives = 106/267 (39.70%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLE-GSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSC 1067
            CP+ C      S  +V      LT +P N+P+ I  I +  QN I   +   A S Y      LR L L+   I  + P+AF  L +L SL L  N++  L   +F+GL    L L N   +  L   +F+ L                         +L  L L  N+L  + K        ++ + L +NPF C C L+WL   L         A     RCT+P+ L+ + +  +      C   G ++    L G+    L+C
Sbjct:  273 CPAACT----CSNNIVDCRGKGLTEIPTNLPETITEIRLE-QNSIRV-IPPGAFSPYK----KLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDL------------------------HNLNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGA-----RCTSPRRLANKRIGQIKSKKFRCS--GTEDYRSKLSGDCFADLAC 498          
BLAST of Slit-2 vs. UniProt/SwissProt
Match: sp|O94813|SLIT2_HUMAN (Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=SLIT2 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.066e-10
Identity = 72/258 (27.91%), Postives = 116/258 (44.96%), Query Frame = 3
Query:  252 VEPRAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFIN-TTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLI--LLEGSFRGLV-VSSLSLK----SCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            V P+A CP+ C      SG  V      L ++P NIP+    + ++G N    T   +  L H       LR+LQL    I  IE  AF  L  L+ L L+ N L++    +F G +  Y RLD +EN I  +   +FRG V + +L L     SC +++ ++  +++    L  L L++N ++ +         +L    L  N  +C C L WL+  L+ R       L ++  C  P  L G  +  + +   +C
Sbjct:   23 VAPQA-CPAQCS----CSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDFAGLRH-------LRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLY-RLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISC-IEDGAFRALRD----LEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV---GLYTQ--CMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 57.3806 bits (137), Expect = 3.291e-7
Identity = 71/273 (26.01%), Postives = 107/273 (39.19%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLE-GSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKP------PGVKEIDIFLHGNNSGRLSC 1067
            CP+ C      S  +V      LT +P N+P+ I  I +  QN I   +   A S Y      LR + L+   I  + P+AF  L +L SL L  N++  L   +F+GL    L L N   +  L   +F+ L                         +L  L L  N+L  I K        ++ + L +NPF C C L+WL   L         A     RCT+P+ L+ + +  +      C        PG ++    L G+    L+C
Sbjct:  273 CPAACT----CSNNIVDCRGKGLTEIPTNLPETITEIRLE-QNTIKV-IPPGAFSPYK----KLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDL------------------------HNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGA-----RCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRSKLSGDCFADLAC 506          
BLAST of Slit-2 vs. UniProt/SwissProt
Match: sp|Q9WVC1|SLIT2_RAT (Slit homolog 2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Slit2 PE=1 SV=3)

HSP 1 Score: 68.1662 bits (165), Expect = 1.282e-10
Identity = 73/258 (28.29%), Postives = 114/258 (44.19%), Query Frame = 3
Query:  252 VEPRAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFIN-TTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLI--LLEGSFRGLV-VSSLSLK----SCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            V P A CP+ C      SG  V      L  +P NIP+    + ++G N    T   +  L H       LRILQL    I  IE  AF  L  L+ L L+ N L++    +F G +  Y RLD +EN I  +   +FRG V + +L L     SC +++ ++  +++    L  L L++N ++ +         +L    L  N  +C C L WL+  L+ R       L ++  C  P  L G  +  + +   +C
Sbjct:   23 VAPHA-CPAQCS----CSGSTVDCHGLALRIVPRNIPRNTERLDLNGNNITRITKTDFAGLRH-------LRILQLMENKISTIERGAFHDLKELERLRLNRNNLQLFPELLFLGTAKLY-RLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISC-IEDGAFRALRD----LEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRV---GLYTQ--CMGPSHLRGHNVAEVQKREFVC 257          

HSP 2 Score: 55.4546 bits (132), Expect = 1.204e-6
Identity = 70/267 (26.22%), Postives = 105/267 (39.33%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLE-GSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSC 1067
            CP  C      S  +V      LT +P N+P+ I  I +  QN I   +   A S Y      LR L L+   I  + P+AF  L +L SL L  N++  L   +F+GL    L L N   +  L   +F+ L                         +L  L L  N+L  + K        ++ + L +NPF C C L+WL   L         A     RCT+P+ L+ + +  +      C   G ++    L G+    L+C
Sbjct:  277 CPIACT----CSNNIVDCRGKGLTEIPTNLPETITEIRLE-QNSIRV-IPPGAFSPYK----KLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDL------------------------HNLNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGA-----RCTSPRRLANKRIGQIKSKKFRCS--GTEDYRSKLSGDCFADLAC 502          

HSP 3 Score: 53.5286 bits (127), Expect = 4.487e-6
Identity = 58/228 (25.44%), Postives = 92/228 (40.35%), Query Frame = 3
Query:  267 GCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNP 947
             CP  C+ +    G  V     KL  +P +IP+    + ++   F  T L    +    P+   LR + L+   I +IE  AF     +  + L++NRL+ +   +FKGL SL  L L +N    +   SF GL                        G +  L L  NQ++ +          L  ++L  NPF C C L WL + L+     +++ +    RC  P
Sbjct:  501 ACPEKCRCE----GTTVDCSNQKLNKIPDHIPQYTAELRLNNNEF--TVLEATGIFKKLPQ---LRKINLSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFTGL------------------------GSVRLLSLYDNQITTVAPGAFGTLHSLSTLNLLANPFNCNCHLAWLGEWLR-----RKRIVTGNPRCQKP 690          
BLAST of Slit-2 vs. TrEMBL
Match: I1ZIL5 (Slit-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 9.754e-64
Identity = 164/474 (34.60%), Postives = 261/474 (55.06%), Query Frame = 3
Query:  264 AGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKA-LMSELRCTN-----PKELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSCEAINALETNVKWRHKLFASENYYRFQDYSPALGRSLISIESRNNVDHYSCYVQNSKGKVNIDVNIMWPTNN-------ISSFIYNSNEVRYIYPETFXXXXXXXXXXXPIEKFFMRKQFSLFELLISMVATLIVXXXXXXXXXXX---XXXXXXXPNLFQKSQPMTDSAVTSEVQMHNMSQFPSSQELKANQLLDFKTQQ 1637
            + CP  C Q  C    L+C  P  L  +P+N P+ I  + +S QNF+   L+Y  LS YG E+I L+ L ++  ++ +IE EAFSHLI L+ LDLS+NRL  ++   FK LSL  L LD+N NL L + SFRGLVV SLS+K C+LK L++E IK++SG+LT L L+ N+L  +   F+LLF  L+ ++L+ N F C+CQL+WL  +L+ R   ++ +   S LR TN     PK L G ++ +LS  +  C+ P ++ IDI +    +  +SC + +   + VKWR++   S  +YR+ D +  + ++ I +  ++  D YSC + N  G   +D+ I WPT N       I+S     N+       T     L   +   +   ++ KQ++  E+++++  T I+T +   L + +     ++    N+ +      +  V SE Q +++ Q     E    +LLDFKTQQ
Sbjct:   33 SECPELCNQGACKLTMLLCETPG-LLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNLFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGVNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPINSPPNTVNQFNLRNNITKSSVILKEFDKLHVNYLWI-KQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKNILKG----YEVGVYSESQTYDVPQMSPYHESNTGRLLDFKTQQ 500          
BLAST of Slit-2 vs. TrEMBL
Match: A0A5P8I4L0 (PXDN-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.298e-48
Identity = 125/399 (31.33%), Postives = 208/399 (52.13%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHA----KEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSC--EAINALETNVKWRHKLFASENYYRFQDYSPALGRSLISIESRNNVDHYSCYVQNSKGKVNIDVNIMWPTNNISSFIYNSNEVRYIYPETFXXXXXXXXXXXPIEKFFMRKQFSLFELLISMVATLIV 1448
            CPS C +  C +G L C +   L  +P  + +  + I +S Q F +  L+Y+  S+YGP    +  + L F  + +I    FSHL  L+ LDLS+N L  +    FK L L +LRLD+N+ +     SFRGL V+ LSL  C L  L +E+  E+S  L KL L++N+L+ IDK+F +LFE L  + + ENPF CTC LRWL   L +R+ A      K + ++ +C  P  + G+ +  L   +  C  P +K ID+F+   +S +L+C  E       +V W      +E+   +     ++ ++ +S+  ++ +D Y C ++N+   V + ++I WP   +++   + N +  + P        N N+   +   F  KQF+L E++  +V T  +
Sbjct:   26 CPSVCHEMACQTGVLACTD-GGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERLKKLILTNNKLNVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIW-----MTEHKNTYVPEIQSIEKASLSVLRKSRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLG-VSPNDMIPYLPNANSTLHVRSVFYEKQFTLLEMIGGVVGTFTI 417          
BLAST of Slit-2 vs. TrEMBL
Match: A0A2H1CUL7 (Leucine Rich repeat-containing domain protein OS=Fasciola hepatica OX=6192 GN=D915_01256 PE=4 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 3.481e-32
Identity = 105/356 (29.49%), Postives = 181/356 (50.84%), Query Frame = 3
Query:  297 CLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGH--LTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQ-HAKEKAL---------------MSELRCTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSCEAINALET--NVKWRHKLFASEN----YYRFQDYSPALGRSLISIESRNNVDHYSCYVQNSKGKVNI-DVNIMWPTNNISS 1289
            C++G L C E   LT LP  + K I  + + G  F  + L+ +  + Y  +   L+ + L    IE I+P +F  + +LK LDLS N++  + +G F GL LDYLRLD N  L L  G+F    + SLS+  C +++++YE +  +  H  LT L+LS N+L  ++ + E +F  L+ + L +NPF+C C+L WL + L+ RQ   K +AL               +    C  P  L+G+ L +L+  +  C  P +K +++F+        + + +N++     V  R ++  S      +YR   +SP +   L   E  N +DH S  + +     ++ ++ ++ P+ +ISS
Sbjct:    5 CMAGSLSCQE-GGLTGLPDELAKDIQSMILIGHRFEGSALARHNFTSYPHQTKVLQRITLRNCGIERIQPGSFEPIQSLKQLDLSQNQINFIEAGTFAGLRLDYLRLDENHRLHLAPGAFNDASIVSLSMNQCGIESITYEDLAPLLRHHVLTTLHLSGNRLVTLENRMEPVFLELQSLSLDQNPFYCDCRLSWLAEVLQRRQIRRKSRALKQDSIMGPDAPLDSDLPRPTCRAPDRLAGRPLETLTTEDFFCGLPQLKNLEVFIEEYKEAGENQKLVNSVSQPLAVTLRCQVSGSPEMKLAWYRRSIFSPTVTSQL---EFYNELDHLSKLLSSRAVSSDVAEIRLIQPSPSISS 356          
BLAST of Slit-2 vs. TrEMBL
Match: A0A4E0RLI5 (Immunoglobulin superfamily member 10 OS=Fasciola hepatica OX=6192 GN=D915_000869 PE=4 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 2.003e-31
Identity = 105/356 (29.49%), Postives = 181/356 (50.84%), Query Frame = 3
Query:  297 CLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGH--LTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQ-HAKEKAL---------------MSELRCTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSCEAINALET--NVKWRHKLFASEN----YYRFQDYSPALGRSLISIESRNNVDHYSCYVQNSKGKVNI-DVNIMWPTNNISS 1289
            C++G L C E   LT LP  + K I  + + G  F  + L+ +  + Y  +   L+ + L    IE I+P +F  + +LK LDLS N++  + +G F GL LDYLRLD N  L L  G+F    + SLS+  C +++++YE +  +  H  LT L+LS N+L  ++ + E +F  L+ + L +NPF+C C+L WL + L+ RQ   K +AL               +    C  P  L+G+ L +L+  +  C  P +K +++F+        + + +N++     V  R ++  S      +YR   +SP +   L   E  N +DH S  + +     ++ ++ ++ P+ +ISS
Sbjct:   44 CMAGSLSCQE-GGLTGLPDELAKDIQSMILIGHRFEGSALARHNFTSYPHQTKVLQRITLRNCGIERIQPGSFEPIQSLKQLDLSQNQINFIEAGTFAGLRLDYLRLDENHRLHLAPGAFNDASIVSLSMNQCGIESITYEDLAPLLRHHVLTTLHLSGNRLVTLENRMEPVFLELQSLSLDQNPFYCDCRLSWLAEVLQRRQIRRKSRALKQDSIMGPDAPLDSDLPRPTCRAPDRLAGRPLETLTTEDFFCGLPQLKNLEVFIEEYKEAGENQKLVNSVSQPLAVTLRCQVSGSPEMKLAWYRRSIFSPTVTSQL---EFYNELDHLSKLLSSRAVSSDVAEIRLIQPSPSISS 395          
BLAST of Slit-2 vs. TrEMBL
Match: A0A0X3PLP8 (Ig-like domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR119428 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 2.588e-31
Identity = 119/444 (26.80%), Postives = 208/444 (46.85%), Query Frame = 3
Query:  297 CLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEV--SGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELR---------------------CTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHG-----NNSG--------RLSCEAINALETNVKWRHKLFAS---------ENYYRFQDYSPALGRSLISIESRNNV----DHYSCYVQNSKGKVNIDVNIMW-----------PTNNISSFIYNSNEVRYIYPETFXXXXXXXXXXXPIEKFFMRKQFSLFELLISMVATLIV 1448
            CL G + C EP +L  +P ++P  I  + + GQ F +  L    LS Y   ++ +  L +    ++ IEP+ F  L  L  LD+S N L  +H   F GL L+ LRLD+N  L L  G+F  L VSSLS+++C L++L+++ ++ +  +G L+ L L+ N L+ ++ + E LF  L+ + L +NPF C C+L WL+K L+ R+H  E+  M  +                      C +P  L  + L+ L++ +  C PP ++ +++ L G     N++G        RL C A  + E  V W  +   S         E+    Q  SP +   ++   + +      D  +C+  ++ G ++ DV + W            +   +  I  +  V     E+      +      ++ FF RKQF++ EL+ +++ T + 
Sbjct:   40 CLYGSVSCQEPGRLQMVPNDLPPGIRKVILIGQRFKSRYLQRQNLSSYSTSRVKIVELTIMDCGLQGIEPQTFQGLTNLTKLDVSKNALSRIHRRTFAGLRLELLRLDDNLGLSLSPGAFENLSVSSLSIQNCNLRSLTFKDLEPLIRTGTLSTLRLTGNSLTTLETRLEPLFLSLKALSLSQNPFRCDCELVWLSKMLQ-RKHQDEEQDMPPVPSGFENSLVNDDFTVSTEIYPVCASPPRLYERKLLGLTDEDFFCAPPQLRALELDLKGQQHAINSAGDSAGGAVARLKCIAQGSPELRVGWYRRTQRSDSKQGANFLESLLATQVVSPGVAEIVLHQPTSDGGSLEDDQLTCFGTDTYGNISADVTLSWRNLRESVNAGGASVGTAVAIAENGNVEEPDDESRLRALESER----MDDFFFRKQFTILELIGAVIGTFMA 478          
BLAST of Slit-2 vs. Ensembl Cavefish
Match: mxra5a (matrix-remodeling-associated protein 5 [Source:NCBI gene;Acc:103036656])

HSP 1 Score: 71.2478 bits (173), Expect = 2.402e-12
Identity = 75/264 (28.41%), Postives = 119/264 (45.08%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFIN--TTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLV-VSSLSLKSCYLKNLSYEIIKEVS--GH-----LTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEID 1028
            CP  C    C   K V      L  +P  +PK +  +++ G N +N  T  S+  +         L +L +   +I NI   AF  LI+L+ + +S N+LKI+    F+GL +L  L LD+N    +   +F+GL  +  L L+   L+ L       +S  GH     L  LYLS N L+ + +K       LE + L ENP+ C C+++W             K+    L+C   + L+G  L  +  S    K   ++E+D
Sbjct:   21 CPRPCA---CPQPKEVHCTFRSLLTVPAGVPKQVERMNL-GFNTMNRITDSSFAGMR-------KLELLMMHGNDIHNIPNGAFRDLISLQMMKVSYNKLKIISRNTFQGLWNLARLHLDHNRLEFIHPDAFQGLTSLRLLQLEGNRLQQLHPATFATLSVLGHFPVSTLKHLYLSENGLTSLSQKMLAGMPHLENLFLHENPWVCDCRMKWFRDW--------SKSAPGVLKCKKDRALAGGQLCPMCSSPKHLKKKDLQELD 265          
BLAST of Slit-2 vs. Ensembl Cavefish
Match: mxra5a (matrix-remodeling-associated protein 5 [Source:NCBI gene;Acc:103036656])

HSP 1 Score: 71.2478 bits (173), Expect = 2.408e-12
Identity = 75/264 (28.41%), Postives = 119/264 (45.08%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFIN--TTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLV-VSSLSLKSCYLKNLSYEIIKEVS--GH-----LTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEID 1028
            CP  C    C   K V      L  +P  +PK +  +++ G N +N  T  S+  +         L +L +   +I NI   AF  LI+L+ + +S N+LKI+    F+GL +L  L LD+N    +   +F+GL  +  L L+   L+ L       +S  GH     L  LYLS N L+ + +K       LE + L ENP+ C C+++W             K+    L+C   + L+G  L  +  S    K   ++E+D
Sbjct:   29 CPRPCA---CPQPKEVHCTFRSLLTVPAGVPKQVERMNL-GFNTMNRITDSSFAGMR-------KLELLMMHGNDIHNIPNGAFRDLISLQMMKVSYNKLKIISRNTFQGLWNLARLHLDHNRLEFIHPDAFQGLTSLRLLQLEGNRLQQLHPATFATLSVLGHFPVSTLKHLYLSENGLTSLSQKMLAGMPHLENLFLHENPWVCDCRMKWFRDW--------SKSAPGVLKCKKDRALAGGQLCPMCSSPKHLKKKDLQELD 273          
BLAST of Slit-2 vs. Ensembl Cavefish
Match: mxra5a (matrix-remodeling-associated protein 5 [Source:NCBI gene;Acc:103036656])

HSP 1 Score: 71.2478 bits (173), Expect = 2.448e-12
Identity = 75/264 (28.41%), Postives = 119/264 (45.08%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFIN--TTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLV-VSSLSLKSCYLKNLSYEIIKEVS--GH-----LTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEID 1028
            CP  C    C   K V      L  +P  +PK +  +++ G N +N  T  S+  +         L +L +   +I NI   AF  LI+L+ + +S N+LKI+    F+GL +L  L LD+N    +   +F+GL  +  L L+   L+ L       +S  GH     L  LYLS N L+ + +K       LE + L ENP+ C C+++W             K+    L+C   + L+G  L  +  S    K   ++E+D
Sbjct:   29 CPRPCA---CPQPKEVHCTFRSLLTVPAGVPKQVERMNL-GFNTMNRITDSSFAGMR-------KLELLMMHGNDIHNIPNGAFRDLISLQMMKVSYNKLKIISRNTFQGLWNLARLHLDHNRLEFIHPDAFQGLTSLRLLQLEGNRLQQLHPATFATLSVLGHFPVSTLKHLYLSENGLTSLSQKMLAGMPHLENLFLHENPWVCDCRMKWFRDW--------SKSAPGVLKCKKDRALAGGQLCPMCSSPKHLKKKDLQELD 273          
BLAST of Slit-2 vs. Ensembl Cavefish
Match: lrig2 (leucine rich repeats and immunoglobulin like domains 2 [Source:NCBI gene;Acc:103036991])

HSP 1 Score: 68.5514 bits (166), Expect = 1.167e-11
Identity = 83/299 (27.76%), Postives = 134/299 (44.82%), Query Frame = 3
Query:  459 LRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLS-LDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYL-KNLSYEIIK---EVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC----KP--PGVKEIDIFLHGNNSGRLSCEAI--NALETNVKWRHK---LFASE--NYYRFQDYSPALGRSLISIESRNNVD--HYSCYVQNSKGKVNIDVNIMWPTNNISSFI 1295
            L  L L+F ++  +E  AF+ L  L++L++  NRL  L  G+F GL+ +  L + NN+  + +E S  G+ V    L +  L KN    I K   E  G L +L LS NQ+  +  +     +   L     +   C CQL WL++ L      +  A +    C +P  L+G+++ ++     +C    KP   G     + L G N   L+C A   +    +  WR     L+ ++  NY R+Q+    L  S++ + + N  D  HY C V N  G  N         N + SF+
Sbjct:  272 LEELDLSFNHLSRLEDWAFTGLGLLQTLNVGENRLTHLGEGVFSGLANVHTLDIRNNDISLAIEDSV-GMFVGMKKLNTLILQKNKIRTITKRAFEGLGELEQLDLSKNQIMSVHPEAFSHLKLKSLDLNTSS-LLCDCQLTWLSRWLTNSHFQQSCAAV----CAHPAPLAGRSIFNVRPEEFVCNDFPKPQISGNPRTVVALRGTNV-TLNCSAFSSSDSTMSASWRKDREVLYEAQVHNYARYQEQR-LLYTSVLHLLNVNFTDEGHYQCVVSNHFGS-NYSTEAKLTVNELPSFL 561          
BLAST of Slit-2 vs. Ensembl Cavefish
Match: slit3 (slit guidance ligand 3 [Source:NCBI gene;Acc:103037708])

HSP 1 Score: 67.781 bits (164), Expect = 2.200e-11
Identity = 67/255 (26.27%), Postives = 110/255 (43.14%), Query Frame = 3
Query:  267 GCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFIN-TTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLV-VSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKE 1022
            GCP+ C      SG  V  +     ++P  IP+    + +   N    T + ++ L        NLR+L L    I  IE  AF  L  L+ L L+ NRL++L   +F+    L  L L  N+   +   SFRG+  V +L L S ++  +     + +   L  L L++N ++ I         +L  + L  N   C C L WL+  L+ R     K L    +C +P  + G ++  + + + +C  P   E
Sbjct:   32 GCPAKCS----CSGSHVECQQQGFRSVPRGIPRNAERLDVDRNNITRITKVDFSGLK-------NLRVLHLENNQISVIERGAFQDLKQLERLRLNRNRLQVLPELLFQSTPKLGRLDLSENQIQAIPRKSFRGITNVKNLQLDSNHISCIEDGAFRALR-DLEILTLNNNNITLIPLSSFNHMPKLRTLRLHSNNLHCDCHLSWLSDWLRQR-----KGLAHFTQCMSPAHMRGLSVPDVQKRDFVCTGPAQSE 269          

HSP 2 Score: 55.8398 bits (133), Expect = 1.152e-7
Identity = 64/252 (25.40%), Postives = 101/252 (40.08%), Query Frame = 3
Query:  258 PRAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPP 1010
            PR  CP  C      S  +V    + L +LP  IPK    + + G    +     ++L         L ++ L+  +I ++ P  FS++  L +L LS N+++ +    F GL SL  L L  N+   + EG+F                            HLT L  SH  L                     NP +C C+LRWL++ +KA    KE  +    RCT P +++ + L++   +   CK P
Sbjct:  724 PR--CPDPCT----CSDTVVRCSNHGLRSLPKGIPKDTTELYLEGNMLTSVPKELSSLKQ-------LSLVDLSNNSISSLTPFIFSNMTQLSTLILSYNQIRCVPVHAFDGLRSLRLLTLHGNDLSTIPEGAFN---------------------------HLTSL--SHLALGA-------------------NPLYCDCELRWLSQWVKA--GFKEPGIA---RCTGPPDMADRLLLTTPLNRFQCKGP 909          

HSP 3 Score: 53.1434 bits (126), Expect = 8.877e-7
Identity = 68/252 (26.98%), Postives = 105/252 (41.67%), Query Frame = 3
Query:  255 EPRAGCP--SYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLE-GSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            EPR+  P  S C      +  +V      LT +P N+P+ I  I +  QN I + +   A S Y      L+ + L+  +I +I  +AFS L +L SL L  N++  +  G+F GL    L L N   +  L   +F+ L   SL+L                      L L  N+L  I K        ++ + L +NPF C C L+WL   L            S  RC++P+ L+ + +  +      C
Sbjct:  269 EPRSCAPQASVCPASCSCTNNIVDCRRKGLTEIPANLPEGIVEIRLE-QNLIKS-IPPGAFSPYK----KLKRIDLSKNHISDIADDAFSGLRSLTSLVLYGNKIAEIPKGLFDGLVSLQLLLLNANKINCLRVNTFKDL--QSLNL----------------------LSLYDNKLQTISKGLFTPLRAIKTLHLAQNPFMCDCHLKWLADYL-----FDNPIETSGARCSHPRRLANKRISQIKGKKFRC 485          
BLAST of Slit-2 vs. Ensembl Sea Lamprey
Match: lrig3 (leucine-rich repeats and immunoglobulin-like domains 3 [Source:NCBI gene;Acc:564554])

HSP 1 Score: 71.633 bits (174), Expect = 2.097e-13
Identity = 87/323 (26.93%), Postives = 141/323 (43.65%), Query Frame = 3
Query:  393 QNFINTTLSYNALSHYGPEQI----NLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLS-LDYLRLDNNE---NLILLEGSFRGL-VVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC----KPPGV--KEIDIFLHGNNSGRLSCEAINALETNVK--WRHK---LFASENYYRFQDYSPALG--RSLISIESRNNVD-----HYSCYVQNS-----KGKVNIDVNIM 1265
            Q+  +  +S NA++    E      NL  L L+   +  +   AF  L AL+SL L++N +  +  G F+GLS L  L L  N+    +  ++G+F GL  +S LSL    +K+++ +    +   L +L L  N +  I        + L  + L  +   C CQL+WL   L  R  A+  A+     C +P  L G++++S+ + N +C    KP  V   E    + G+N   + C A ++ E+ V   WR     L       R +   PA G      S      VD      Y C + NS      GK  + V+++
Sbjct:  115 QSLRHLHVSRNAITAMDSEAWKFCENLWELDLSHNGLTRLNEAAFVELGALQSLSLAHNAISHIVEGAFRGLSSLRILDLGGNQISWTVEDMQGAFTGLSALSKLSLHGNQIKSIAKKAFVGLE-RLGQLDLMGNAIVSIQANAFNTLKLLHQMKLNTSELLCDCQLKWLPGWLTERGFAQSVAVA----CAHPAWLKGRSVLSVRQENFVCDDYPKPHMVVHPETRAAVRGSNVSFM-CSAASSSESPVTFLWRKDNAPLAVGAEVERLERARPAGGGLGEFTSYLHLRTVDFHHEGRYQCVISNSFGSSYSGKARLTVSVL 431          
BLAST of Slit-2 vs. Ensembl Sea Lamprey
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 65.855 bits (159), Expect = 2.089e-11
Identity = 74/269 (27.51%), Postives = 121/269 (44.98%), Query Frame = 3
Query:  474 LTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVS----GHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGV--KEIDIFLHGNNSGRLSCEAINALETNVKWRH---KLFASENYYR--FQDYSPALGRSLISIESRNNVDHYSCYVQNSKGKV 1244
            L F  I  I P AF  L  L +L L+NN +K +    F+ L SL YL L  NE   +   +F+GLV    SL+  Y+     E+++  +      L +L+L +N+LS I          L  + L  N   C C+L WL + L+A   A     ++   C +P+ L G+++ S++     C+ P +  +  D+ +   N+  L C A    +  + W H   ++  +E+  R   QD     G  +I      +   Y C  +N  G+V
Sbjct:    6 LRFNRIREIPPGAFKKLKNLNTLLLNNNHIKRIPRRAFEDLESLKYLYLYKNEIQSIDRHAFKGLV----SLEQLYIHFNHIEVLEPNTFVDLPKLERLFLHNNRLSRIATGTFTQLSSLRRLRLDSNRLVCDCELVWLAELLRA--FAGSGGTLAAATCEHPRRLQGRSVSSITAQEFHCESPRITSEPHDVDVTPGNTVYLRCRAEGNPKPAIIWLHNSNEIAMAEDERRNLLQD-----GTLMIRDTRHTDQGTYQCMARNVAGEV 263          
BLAST of Slit-2 vs. Ensembl Sea Lamprey
Match: lrfn5a (leucine rich repeat and fibronectin type III domain containing 5a [Source:ZFIN;Acc:ZDB-GENE-080327-17])

HSP 1 Score: 63.929 bits (154), Expect = 6.211e-11
Identity = 98/403 (24.32%), Postives = 163/403 (40.45%), Query Frame = 3
Query:  267 GCPSYCQQQ---PCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRI-LQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLS-LDYLRLDNNENLILLEGSFRGLVVSSLSLKSCY--LKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXEN-----------------------------------PFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEID---IFLHGNNSGRLSCEAINALETNVKW---RHKLFASENYYRFQDYSPALGRSLISIESRNNVDHYSCYVQNSKGKVNIDVNIMWPTNNISSFIYNSNEVRYIYPE 1331
            GCP++C  Q   P LS   VC +   L  +P NI +    + + G NFI +    +    +G   + L + L L+   I  I P AF+ L +L  L    NRL  + +  FKGLS L +L + NN+   +  G+F   ++S   L   Y  L+ + +E I++++  L  L L HN +  I+        +L  +D+  N                                   P  C C+L WL      R+  +E  L +   C +P+ L G+   S+ E   +C+PP +       + L G  +  L C+AI   +  V W     K+ ++       D     G   I + +  +   ++C   N  G+    V +     +I    + SN    ++PE
Sbjct:   19 GCPTHCICQNLSPSLST--VCAKIG-LLFVPHNIDRRTVELRL-GDNFITSVRRQD----FG--NMTLMVDLTLSRNTISQIAPYAFADLSSLTFLHFDYNRLTHIGNKSFKGLSNLRHLIISNNQLSDISVGAFDDFLMSLEDLDLAYNNLEKVPWEAIQKMTS-LHTLSLDHNMIDYIEAGTFSHLHKLARLDMTSNKLQKLPPDPLFTRLQLFANKGIHHTPPLVLNFGGNPLHCNCELLWL------RRLTREDDLET---CASPQALVGKYFWSIPEEEFVCEPPLITRHTHRLLVLEGQRA-TLKCKAIGDPDPWVHWISPDEKVISNTTRTVVHDN----GTLEILVTTTKDDGTFTCIASNPAGESTTFVEL-----SIIHLPHLSNITHNVHPE 391          
BLAST of Slit-2 vs. Ensembl Sea Lamprey
Match: LINGO2 (leucine rich repeat and Ig domain containing 2 [Source:HGNC Symbol;Acc:HGNC:21207])

HSP 1 Score: 56.6102 bits (135), Expect = 1.193e-8
Identity = 59/203 (29.06%), Postives = 92/203 (45.32%), Query Frame = 3
Query:  267 GCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQIN----LRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLS---------------LDY----------LRLDNNENLILLEGSFRGL-VVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGI 785
            GCP+ C+    L   +VC    ++ A+P  IP     +           LS N L    P+  +    L  L++    I NIEP AF++L  L+SL L NNRLK++  G+F  L+               LDY          L + +NE + +   +F+GL  +  L+L+ C L +L  E +  + G L+ L L H  ++ I
Sbjct:   36 GCPARCECT-ALQKSVVC-HRRRMVAIPEGIPTETKSLD----------LSKNRLRSLDPDDFSNFLLLEELEVNENVIANIEPGAFNNLPFLRSLSLRNNRLKLIPRGVFSRLTNLTHLDISENKIVILLDYMFQDLRNLKRLEVGDNELVYVSHHAFKGLQSLEQLTLEKCNLTSLPTEALSHL-GSLSTLRLRHLNIASI 225          
BLAST of Slit-2 vs. Ensembl Sea Lamprey
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 55.8398 bits (133), Expect = 1.924e-8
Identity = 69/289 (23.88%), Postives = 119/289 (41.18%), Query Frame = 3
Query:  456 NLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLS-LDYLRLDNNENLILLEGSFRGL-VVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPP--GVKEIDIFLHGNNSGRLSCEAINALETNVKWRHKLFASENYYRFQDYSPALGRSLISIESRNNVDH--YSCYVQNSKG--KVNIDVNIMWPTNNISSFIY 1298
            NLR L L   N+  +     S L+ L+ L+LS NR++IL  G F+GL+ L  L + ++E  ++   +F  L  +  L+L    L +L +++   +   L +++L H                        NP+ C C + WL+  L  R++    A     RC  P +     L  L  S   C PP   V   D+ +    +  L C A ++  ++V W      S  +  ++     L    ++  +    D   Y+C V NS G    +  +N+  P    + + Y
Sbjct:  153 NLRYLNLGMCNLREVP--KLSPLVRLEELELSGNRIEILRPGSFQGLANLRKLWIMHSEVRLVERNAFDELQSLKELNLAHNSLMSLPHDLFSPLQ-KLERVHLHH------------------------NPWTCDCDILWLSWWL--RENVPNNATCCA-RCALPADRKAINLWELDSSRFTCYPPLIEVPPSDVNISEGMAAELRCRAPSS-ASSVTWITPNGTSMTHGSYKIRISVLHDGTLNFTNVTVQDTGIYTCLVANSVGNSTASATLNVTAPDTGTNGYTY 410          
BLAST of Slit-2 vs. Ensembl Nematostella
Match: EDO47109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNB0])

HSP 1 Score: 63.5438 bits (153), Expect = 1.428e-10
Identity = 59/206 (28.64%), Postives = 92/206 (44.66%), Query Frame = 3
Query:  399 FINTTLSYNALSHYGPEQINLRILQLTFTNIE---NI-EPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLEGSFR-GLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
             I   +S+N LS +  E   LR L  T T +    NI    A      +  LDL +N L++     F GLSL  LRLD N+   + E   + G  +  L +   YL  ++ + + ++   + +L L+ N +S I        ++L  I L  NP  C C+L WL   L +RQ     +      C +P  + GQT + L   + +C
Sbjct:  170 LICLDISFNRLSEFKTE--TLRGLSSTLTELRLRSNILRRVAIKRRFNITLLDLGDNLLEVFEVDAFDGLSLRKLRLDGNKLDEIPEAFAKVGHFLQELDMSGNYLHEITSDQLLDLHA-IERLDLNENNISKIRIGALRGMKKLRQISLSGNPLSCDCRLVWLKHVLDSRQDQLHLSSPQSTTCASPASVKGQTFLGLDARSFLC 372          

HSP 2 Score: 51.9878 bits (123), Expect = 5.744e-7
Identity = 45/156 (28.85%), Postives = 78/156 (50.00%), Query Frame = 3
Query:  336 LTALPLNIPKIIYHISISGQNFINT----TLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFR-GLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGI 785
            L  +P ++P+ +      G  F+NT     L   A ++Y    ++LR+L L+   +  I    F  L  LK+L L++NRL+++++  F+GL  L YL L +N    + +G+FR    +  L +    L     E ++ +S  LT+L L  N L  +
Sbjct:   63 LQTIPTSLPRNL------GSLFLNTNHIRALQAKAFANY----LSLRVLDLSNNELSVIANGTFKSLGKLKTLTLNSNRLEVVYAETFRGLRDLRYLSLRHNSIRTIGDGAFRFSAFLICLDISFNRLSEFKTETLRGLSSTLTELRLRSNILRRV 208          
BLAST of Slit-2 vs. Ensembl Nematostella
Match: EDO48179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK32])

HSP 1 Score: 61.2326 bits (147), Expect = 8.685e-10
Identity = 60/235 (25.53%), Postives = 108/235 (45.96%), Query Frame = 3
Query:  459 LRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLE---GSFRGLV-VSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICK-----------PPGVKEIDIFLHGNNSG---RLSCEAINALETNVKWR 1106
            LR L L    + +I+   F HL+ALK L+L+NNR+  +  G F  L SL+ L L NN+    +E   G FRGL  ++SL L    +  ++      +  ++  L LS N ++ I +      ++L+ + L  +   C C+++W    L++R   +        RC +P+ L  +++ +++    +C            PP  K     + G+N     R+     N+    ++WR
Sbjct:  348 LRKLNLERNRLSHIQDTTFKHLLALKVLNLANNRIYHISQGSFSDLRSLEGLDLSNNDISWTVEEMNGPFRGLTNLASLRLDGNRITAIAATAFLGLE-NIKYLNLSANIITSIQENSFQGMDKLQKLWLNTSQLMCDCKIKWFGSWLRSRPSTRHTV---RARCLHPQTLYMKSVFNITPDAFVCDTSNPIPQISVHPPSQKA----MRGDNVTLRCRVQVVQRNSSSVRLQWR 574          
BLAST of Slit-2 vs. Ensembl Nematostella
Match: EDO35407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLJ8])

HSP 1 Score: 48.521 bits (114), Expect = 2.868e-6
Identity = 66/235 (28.09%), Postives = 95/235 (40.43%), Query Frame = 3
Query:  459 LRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENL--ILLEGSFRGLV------VSSLSLKSC------------------------------------YLK--NLSYEIIKEVSG-------HLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            L+ L L    I  +    F  L++L+ LDL  N LK L  G+FK L SL  L L +N N+   + EG+F GL       VS+  +K                                      +LK  +LS  +I  VS         L KL L +N +  I +      + L  + L+ NPF C CQL      L+  Q+         + C  P +L+G+ L+ LS S+L C
Sbjct:   44 LKQLNLGENKIRTVSASMFKGLVSLEKLDLRFNDLKALPRGVFKPLKSLRELFLHDNRNMGSRIEEGAFNGLDNLRKLHVSATGMKKITQGTFGSLMSLEFLDVLHINNNSLTTVPLHALRKVKFLKELDLSANLISYVSSTAFANNSKLQKLLLHNNTIRLIHEDAFSQLKGLRALFLRGNPFQCDCQLNGFHAWLRNNQYLVN--FNGHMYCMTPDKLTGRDLLELSSSDLKC 276          
BLAST of Slit-2 vs. Ensembl Medaka
Match: ENSORLT00000000072.2 (pep primary_assembly:ASM223467v1:1:1576629:1604541:-1 gene:ENSORLG00000000055.2 transcript:ENSORLT00000000072.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 4.903e-12
Identity = 71/248 (28.63%), Postives = 106/248 (42.74%), Query Frame = 3
Query:  267 GCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLS-YNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIF-KGLSLDYLRLDNNENLILLEGSFRGLV-VSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLIC 1001
            GCP+ C      +G  V      + ++P NIP+    + ++G N    T S  + L H       LR+L L    I NIE  AF  L  L+ L L+ NRL  L   +F K  +L  L L  N    +   +FRG   + +L L   ++  +     + +   L  L L++N +S I         +L    L  N   C C L WL+  L+ R      AL    +C++P  L G  L  L +S+  C
Sbjct:   44 GCPAPCT----CAGNTVDCHGRGIQSVPKNIPRGTERLDLNGNNLTVITKSDLSGLRH-------LRVLHLMENQISNIERGAFDELKELERLRLNRNRLSQLPELLFQKNEALSRLDLSENRIQAVPRRAFRGAADLKNLQLDKNHISCVEEGAFRALR-SLEVLTLNNNNISSIPVSSFNHMPKLRTFRLHSNSLRCDCHLAWLSPWLRQR-----PALGLYTQCSSPAALRGLNLAELRKSDFAC 274          
BLAST of Slit-2 vs. Ensembl Medaka
Match: si:cabz01090165.1 (leucine-rich repeat and fibronectin type III domain-containing protein 1-like protein [Source:NCBI gene;Acc:101172994])

HSP 1 Score: 67.781 bits (164), Expect = 1.933e-11
Identity = 80/325 (24.62%), Postives = 133/325 (40.92%), Query Frame = 3
Query:  249 CVEPRAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLV--------------------------VSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIX-----------XXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKE--IDIFLHGNNSGRLSCEAINALETNVKW 1103
            CV P   CP  C  Q  L    V      L  +P NI +    + +   NFI TTL +   ++      +L  L L+   I  I P  F+ L  L +L +  NRL +L    F+GL +L +L L NN+   + EG+F+  +                          V++LSL    ++++   I   +   L +L ++ N+L  I             K +       ++    NP  C C+L WL      R+  +E  L +   C +PK+L+G+   ++ E   +C+PP +      +F+       L C++I   E +  W
Sbjct:   20 CV-PSMLCPKRCTCQNLLPSYTVLCAKTGLLFVPPNIDRQTAELRLM-DNFI-TTLRHRDFANMS----SLIHLTLSRNTISQIRPYTFADLQELHALHMDANRLTVLDDSHFQGLVNLRHLILANNQLHSISEGAFQDFLETLEDLDLSYNNLVDIPWDTIALLVSVNTLSLDHNLIESVPEGIFSNLH-KLARLDMTSNKLKKIPPDPLFLRIPVYAKMKGSPLTALVLSFGGNPLHCNCELVWL------RRVTREDDLET---CASPKDLAGKYFWTIREEEFVCEPPMITRHTSKMFVMEGQEVSLRCKSIGDPEPSTHW 327          
BLAST of Slit-2 vs. Ensembl Medaka
Match: slitrk5a (SLIT and NTRK like family member 5 [Source:NCBI gene;Acc:101159898])

HSP 1 Score: 63.929 bits (154), Expect = 3.007e-10
Identity = 70/230 (30.43%), Postives = 114/230 (49.57%), Query Frame = 3
Query:  333 KLTAL-PLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGL-VVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIX-XXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPP 1010
            +LT + P+  P  +YH+ ++G   +   LS N   +Y      + IL L   +I  IE  AF+ L  LK L L+NN+++IL    F GL SL+YL++D N   I+   +   L  ++ + L    L +L   I + V   LT L L  N+L            +++  + L+ENP+ C+C+L  L   L++  +    AL+ E+ C  P  L G+ L  +S+  L  + P
Sbjct:   53 RLTEISPVRFP--MYHLLLTGN--LLKKLSVNDFINY----TGVTILHLGNNDISEIESGAFNGLQGLKRLHLNNNKIEILRDDTFAGLESLEYLQIDYNYVSIIEPNALSRLHQLTVMILNDNLLSSLPPNIFRNVP--LTHLDLRGNRLKMFPYIGLLEHMDKVVELQLEENPWNCSCELIALKAWLESIAYT---ALVGEVVCETPFRLHGRDLDEVSKQELCPRRP 269          
BLAST of Slit-2 vs. Ensembl Medaka
Match: pxdn (peroxidasin [Source:NCBI gene;Acc:101162089])

HSP 1 Score: 63.929 bits (154), Expect = 3.378e-10
Identity = 73/273 (26.74%), Postives = 129/273 (47.25%), Query Frame = 3
Query:  465 ILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVS-GHLTKL---YLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGV----KEIDIFLHGNNSGRLSCEAINALETNVKWRHKLFASENYYRFQDYSP--ALGRSLISIESRNNVDH--YSCYVQNSKGKV 1244
            IL L F  I++++P +FS L  L +L L+NN+++ +  G F+ L +L YL L  NE   +   +F+GLV    SL+  YL   + E ++  S  HL KL   +L +N+++ +          ++ + L  N   C C++ WL   LK   +A+     +   C +P  L G+++ +L+   L C+ P +    +++D+ L   N+   +C A    +  + W      + N    +D S    L    + I+     D   Y C  +N  G+V
Sbjct:   64 ILDLRFNKIKDLQPASFSRLKNLNTLLLNNNQIRRISRGAFEDLENLKYLYLYKNEIQSIDRQAFKGLV----SLEQLYLHFNNIESLEPESFSHLPKLERLFLHNNRITQLVPGTFSHLSAMKRLRLDSNALNCNCEVLWLADLLKL--YAESGNAQAAATCDHPSRLQGRSVATLTAEELNCELPRITSEPQDVDVTL--GNTVYFTCRAEGNPKPQIIW----LRNNNALNMRDDSRLNLLEDGTLMIQDTRETDQGVYQCMAKNVAGEV 324          

HSP 2 Score: 51.6026 bits (122), Expect = 2.153e-6
Identity = 30/59 (50.85%), Postives = 39/59 (66.10%), Query Frame = 3
Query:  453 INLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLS-LDYLRLDNN 626
            ++L  L L F NIE++EPE+FSHL  L+ L L NNR+  L  G F  LS +  LRLD+N
Sbjct:  132 VSLEQLYLHFNNIESLEPESFSHLPKLERLFLHNNRITQLVPGTFSHLSAMKRLRLDSN 190          
BLAST of Slit-2 vs. Ensembl Medaka
Match: lrfn1 (leucine rich repeat and fibronectin type III domain containing 1 [Source:NCBI gene;Acc:101167138])

HSP 1 Score: 63.5438 bits (153), Expect = 4.011e-10
Identity = 82/328 (25.00%), Postives = 128/328 (39.02%), Query Frame = 3
Query:  468 LQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGL-SLDYLRLDNNENLILLEGSFRGLV--VSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHN-----------------------------------QLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKE---IDIFLHGNNSGRLSCEAINALETNVKWRH---KLFASENYYRFQDYSPALGRSLISIESRNNVDHYSCYVQNSKGKVNIDVNI-MWPTNNISSFIYNSNEVR 1316
            L L+   I  I P AF  L +L++L +  NRL I+ S  FKGL +L +L L NN+   +   SF   V  +  L L +  L+ L +E I  +S ++  L L HN                                   Q + +  + +        +    NP  C C+L WL      R+  +E  L +   C +P+ L  +   S+ E   IC+PP + +      ++       L C+A+   +  + W+    KL    N  R   Y       LIS    N    Y+C   N+ G     V I M P   +  F+ N+  +R
Sbjct:   80 LTLSRNTISQIVPHAFVGLRSLRALHMDGNRLNIIKSDHFKGLINLRHLILGNNQIHEVASTSFDEFVSTIEDLDLSNNNLRGLPWEAIARMS-NINTLTLDHNLIDHIEAGTFTLLTKLVRLDMTSNRLQKLPPDSLFQHAQVLSEVKGSSSSTLAVSFGGNPLHCNCELLWL------RRLTREDDLET---CASPEHLMDKYFWSIQEEEFICEPPLITKHVASKSYVMEGQGVTLKCKAVGDPDPFIHWQSPDGKLV--HNNSRTILYDNGTLDILISTLKDNGA--YNCVASNAAGIATAAVEITMIP---LPLFVNNTGHMR 390          
BLAST of Slit-2 vs. Planmine SMEST
Match: SMESG000002157.1 (SMESG000002157.1)

HSP 1 Score: 895.19 bits (2312), Expect = 0.000e+0
Identity = 515/528 (97.54%), Postives = 521/528 (98.67%), Query Frame = 3
Query:  111 YIKINSMRF----FYRCKYNLEGVNFSDIKIYSXXXXXXXXXXXXXXXXHCVEPRAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSCEAINALETNVKWRHKLFASENYYRFQDYSPALGRSLISIESRNNVDHYSCYVQNSKGKVNIDVNIMWPTNNISSFIYNSNEVRYIYPETFXXXXXXXXXXXPIEKFFMRKQFSLFELLISMVATLIVXXXXXXXXXXXXXXXXXXPNLFQKSQPMTDSAVTSEVQMHNMSQFPSSQELKANQLLDFKTQQILPLVMSQSNWSLKI 1682
            Y+   S++F    ++RCKYNLEGVNFSDIKIYSITTNIVLIIIHILHNIHCVEPRAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRL+ILHSGIFKGLSLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIDKKFELLFERLELIDLKENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSCEAINALETNVKWRHKLFASENYYRFQDYSPALGRSLISIESRNNVDHYSCYVQNSKGKVNIDVNIMWPTNNISSFIYNSNEVRYIYPETFDDNQLNLNNDNPIEKFFMRKQFSLFELLISMVATLIVTSLLSTLCFCLFFRHRFLPNLFQKSQPMTDSAVTSEVQMHNMSQFPSSQELKANQLLDFKTQQILPLVMSQSNWSLKI
Sbjct:   28 YLSNPSLKFVFKGYFRCKYNLEGVNFSDIKIYSITTNIVLIIIHILHNIHCVEPRAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLRILHSGIFKGLSLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIDKKFELLFERLELIDLKENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSCEAINALETNVKWRHKLFASENYYRFQDYSPALGRSLISIESRNNVDHYSCYVQNSKGKVNIDVNIMWPTNNISSFIYNSNEVRYIYPETFDDNQLNLNNDNPIEKFFMRKQFSLFELLISMVATLIVTSLLSTLCFCLFFRHRFLPNLFQKSQPMTDSAVTSEVQMHNMSQFPSSQELKANQLLDFKTQQILPLVMSQSNWSLKI 555          
BLAST of Slit-2 vs. Planmine SMEST
Match: SMESG000033458.1 (SMESG000033458.1)

HSP 1 Score: 237.269 bits (604), Expect = 6.956e-71
Identity = 167/477 (35.01%), Postives = 263/477 (55.14%), Query Frame = 3
Query:  264 AGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKA-LMSELRCTN-----PKELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSCEAINALETNVKWRHKLFASENYYRFQDYSPALGRSLISIESRNNVDHYSCYVQNSKGKVNIDVNIMWPTNNISSFIYNSNEVRYIYPET---FXXXXXXXXXXXPIEKF-------FMRKQFSLFELLISMVATLI---VXXXXXXXXXXXXXXXXXXPNLFQKSQPMTDSAVTSEVQMHNMSQFPSSQELKANQLLDFKTQQ 1637
            + CP  C Q  C    L+C  P  L  +P+N P+ I  + +S QNF+   L+Y  LS YG E+I L+ L ++  ++ +IE EAFSHLI L+ LDLS+NRL  ++   FK LSL  L LD+N NL L + SFRGLVV SLS+K C+LK L++E IK++SG+LT L L+ N+L  +   F+LLF  L+ ++L+ NPF C+CQL+WL  +L+ R   ++ +   S LR TN     PK L G ++ +LS  +  C+ P ++ IDI +    +  +SC + +   + VKWR++   S  +YR+ D +  L ++ I +  ++  D YSC + N  G   +D+ I WPT N     Y  + ++   P T   F+       +   +++F          KQ++  E+++++  T I   VT +L  +      ++    N+ +  +      V SE Q +++ Q     E    +LLDFKTQQ
Sbjct:   33 SECPELCNQGACKLTMLLCETPG-LLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGLNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKE---YVESPIKSP-PNTVNQFNLRNNITKSSVILKEFDKLHVNYLWIKQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKNILKGYE----VGVYSESQTYDVPQMSPYHESNTGRLLDFKTQQ 500          
BLAST of Slit-2 vs. Planmine SMEST
Match: SMESG000033458.1 (SMESG000033458.1)

HSP 1 Score: 208.764 bits (530), Expect = 1.665e-60
Identity = 157/477 (32.91%), Postives = 250/477 (52.41%), Query Frame = 3
Query:  264 AGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKA-LMSELRCTNP-----KELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSCEAINALETNVKWRHKLFASENYYRFQDYSPALGRSLISIESRNNVDHYSCYVQNSKGKVNIDVNIMWPTNNISSFIYNSNEVRYIYPET---FXXXXXXXXXXXPIEKF-------FMRKQFSLFELLISMVATLI---VXXXXXXXXXXXXXXXXXXPNLFQKSQPMTDSAVTSEVQMHNMSQFPSSQELKANQLLDFKTQQ 1637
            + CP  C Q  C    L+C  P  L  +P+N P+ I  + +S QNF+   L+Y  LS YG E+I L+ L ++  ++ +IE EAFSHLI L+ LDLSN+                      N NL L + SFRGLVV SLS+K C+LK L++E IK++SG+LT L L+ N+L  +   F+LLF  L+ ++L+ NPF C+CQL+WL  +L+ R   ++ +   S LR TNP     K L G ++ +LS  +  C+ P ++ IDI +    +  +SC + +   + VKWR++   S  +YR+ D +  L ++ I +  ++  D YSC + N  G   +D+ I WPT N     Y  + ++   P T   F+       +   +++F          KQ++  E+++++  T I   VT +L  +      ++    N+ +      +  V SE Q +++ Q     E    +LLDFKTQQ
Sbjct:   33 SECPELCNQGACKLTMLLCETPG-LLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSNS----------------------NRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGLNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKE---YVESPIKSP-PNTVNQFNLRNNITKSSVILKEFDKLHVNYLWIKQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKNILKG----YEVGVYSESQTYDVPQMSPYHESNTGRLLDFKTQQ 478          
BLAST of Slit-2 vs. Planmine SMEST
Match: SMESG000026986.1 (SMESG000026986.1)

HSP 1 Score: 206.068 bits (523), Expect = 1.603e-59
Identity = 148/477 (31.03%), Postives = 247/477 (51.78%), Query Frame = 3
Query:  261 RAGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSCEAINALETNVKWRHKLFASENYYRFQDYSPALGRSLISIESRNNVDHYSCYVQNSKGKVNIDVNIMWPTNNISSFIYNSNEV-----------RYIYPETFXXXXXXXXXXXPIEKFFMRKQFSLFELLISMVATLIVXXXXXXXXXXXXXXXXXXPNLFQKSQPMT---DSAVTSEVQMHNMSQF--PSSQELKANQLLDFKTQQIL 1643
            +A CP  C Q  C  G L C++   L  +P N P     + +  Q F N  L Y  LS YG E+I L++L +    +  IE E+FSHL+ L  +DLS N+L++++   FK L+L  L+L+ N  L L   SF+GLVVSSLSL +C L +L ++ IKE++GHL +  LS N L  ++ +F LLF+RLE I L  N   C C+++WL + LK++  +K  ++ S ++C+ P E+ G+ +  L ES  +C  P +K I + +    S  L C +    +T V W  +   + + ++ +D       + I +   +  D +SC V+N  G V++D+NI WP N   +     + +             I P+T                +   KQF+  E++IS+ +T +VT++  +L +    R   +     K  P        + S+ Q+++  ++  P+    ++ QL+DFKTQ+++
Sbjct:   18 QANCPVLCNQNSCTYGFLFCVDIG-LEMIPENPPPKTTQVIVKNQIFKNPILGYKNLSRYGTEEILLKVLTIQNCGLTEIESESFSHLVHLMEMDLSFNQLQMIYPRTFKALNLKSLKLNGNRLLKLTGNSFQGLVVSSLSLANCGLDSLEFDSIKEIAGHLIRFDLSQNDLKSLNFRFYLLFKRLEEIQLGGNQLKCDCRIKWLNRILKSKNQSKA-SIESLIKCSQPYEIRGKAISQLEESQFLCSKPNLKAISVDI-STRSAILYCSSSPNSDTQVSWHLRNAVNYSLHKLEDLIETPFNASIKVNKNSQSDMFSCIVKNENGNVSVDLNIKWPENTSETLTDKGHPILLFSTPSNNSSTSIIPQT--------------TNYLYIKQFTFLEMIISIGSTFVVTTITFSLIYLCLSRRLNIS--IGKQSPCKIGYQGGIYSDTQIYDSPRYSTPNKTFQQSAQLIDFKTQRLI 475          
BLAST of Slit-2 vs. Planmine SMEST
Match: SMESG000026559.1 (SMESG000026559.1)

HSP 1 Score: 184.111 bits (466), Expect = 3.071e-51
Identity = 128/404 (31.68%), Postives = 206/404 (50.99%), Query Frame = 3
Query:  270 CPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHSGIFKGLSLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIXXXXXXXXXXXXXXXXXENPFFCTCQLRWLTKSLKARQHA----KEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSC--EAINALETNVKW--RHKLFASENYYRFQDYSPALGRS---LISIESRNNVDHYSCYVQNSKGKVNIDVNIMWPTNNISSFIYNSNEVRYIYPETFXXXXXXXXXXXPIEKFFMRKQFSLFELLISMVATLIV 1448
            CPS C +  C +G L C +   L  +P  + +  + I +S Q F +  L+Y+  S+YGP    +  + L F  + +I    FSHL  L+ LDLS+N L  +    FK L L +LRLD+N+ +     SFRGL V+ LSL  C L  L +E+  E+S  L KL L++N+L+ IDK+F +LFE L  + + ENPF CTC LRWL   L +R+ A      K + ++ +C  P  + G+ +  L   +  C  P +K ID+F+   +S +L+C  E       +V W   H+            Y P +  S    +S+  ++ +D Y C ++N+   V + ++I WP   +++   + N +  + P        N N+   +   F  KQF+L E++  +V T  +
Sbjct:   26 CPSVCHEMACQTGVLACTD-GGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERLKKLILTNNKLNVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHR----------NTYVPEIQSSENASLSVLRKSRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLG-VSPNDMIPYLPNANSTLHVRSVFYEKQFTLLEMIGGIVGTFTI 417          
The following BLAST results are available for this feature:
BLAST of Slit-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRC241.736e-1630.69leucine rich repeat containing 24 [Source:HGNC Sym... [more]
LRRC243.436e-1630.69leucine rich repeat containing 24 [Source:HGNC Sym... [more]
SLIT22.204e-1127.91slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGN... [more]
SLIT22.219e-1127.91slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGN... [more]
SLIT22.459e-1127.91slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Slit-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slt-15.696e-1027.78Slit homolog 1 protein [Source:UniProtKB/Swiss-Pr... [more]
pxn-17.166e-723.31Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of Slit-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sli6.863e-1730.24gene:FBgn0264089 transcript:FBtr0330730[more]
sli7.500e-1730.24gene:FBgn0264089 transcript:FBtr0330729[more]
sli7.500e-1730.24gene:FBgn0264089 transcript:FBtr0330732[more]
sli2.897e-1430.00gene:FBgn0264089 transcript:FBtr0330734[more]
sli5.943e-1430.00gene:FBgn0264089 transcript:FBtr0330733[more]
back to top
BLAST of Slit-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-1j5.43.778e-1129.58si:dkey-1j5.4 [Source:ZFIN;Acc:ZDB-GENE-130603-91][more]
si:cabz01090165.14.528e-1123.26si:cabz01090165.1 [Source:ZFIN;Acc:ZDB-GENE-161017... [more]
si:cabz01090165.14.528e-1123.26si:cabz01090165.1 [Source:ZFIN;Acc:ZDB-GENE-161017... [more]
slit21.631e-1026.72slit homolog 2 (Drosophila) [Source:ZFIN;Acc:ZDB-G... [more]
slit21.806e-1026.72slit homolog 2 (Drosophila) [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Slit-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000007893.15.810e-1224.60leucine rich repeat and fibronectin type III domai... [more]
rrn35.127e-1123.47RRN3 homolog, RNA polymerase I transcription facto... [more]
slit17.639e-1129.13slit guidance ligand 1 [Source:NCBI gene;Acc:10003... [more]
slit11.243e-1029.03slit guidance ligand 1 [Source:NCBI gene;Acc:10003... [more]
slit11.253e-1029.03slit guidance ligand 1 [Source:NCBI gene;Acc:10003... [more]
back to top
BLAST of Slit-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slit23.842e-1227.91slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
Slit26.980e-1227.91slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
Slit27.658e-1227.91slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
Slit28.068e-1227.91slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
Slit28.442e-1227.91slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Slit-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q50LG9|LRC24_HUMAN1.650e-1530.69Leucine-rich repeat-containing protein 24 OS=Homo ... [more]
sp|P24014|SLIT_DROME6.382e-1330.00Protein slit OS=Drosophila melanogaster OX=7227 GN... [more]
sp|Q9R1B9|SLIT2_MOUSE5.357e-1127.91Slit homolog 2 protein OS=Mus musculus OX=10090 GN... [more]
sp|O94813|SLIT2_HUMAN1.066e-1027.91Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=... [more]
sp|Q9WVC1|SLIT2_RAT1.282e-1028.29Slit homolog 2 protein (Fragment) OS=Rattus norveg... [more]
back to top
BLAST of Slit-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIL59.754e-6434.60Slit-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=... [more]
A0A5P8I4L01.298e-4831.33PXDN-like protein OS=Schmidtea mediterranea OX=793... [more]
A0A2H1CUL73.481e-3229.49Leucine Rich repeat-containing domain protein OS=F... [more]
A0A4E0RLI52.003e-3129.49Immunoglobulin superfamily member 10 OS=Fasciola h... [more]
A0A0X3PLP82.588e-3126.80Ig-like domain-containing protein OS=Schistocephal... [more]
back to top
BLAST of Slit-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxra5a2.402e-1228.41matrix-remodeling-associated protein 5 [Source:NCB... [more]
mxra5a2.408e-1228.41matrix-remodeling-associated protein 5 [Source:NCB... [more]
mxra5a2.448e-1228.41matrix-remodeling-associated protein 5 [Source:NCB... [more]
lrig21.167e-1127.76leucine rich repeats and immunoglobulin like domai... [more]
slit32.200e-1126.27slit guidance ligand 3 [Source:NCBI gene;Acc:10303... [more]
back to top
BLAST of Slit-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrig32.097e-1326.93leucine-rich repeats and immunoglobulin-like domai... [more]
pxdn2.089e-1127.51peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
lrfn5a6.211e-1124.32leucine rich repeat and fibronectin type III domai... [more]
LINGO21.193e-829.06leucine rich repeat and Ig domain containing 2 [So... [more]
lrrc4ba1.924e-823.88leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
back to top
BLAST of Slit-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slit-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO471091.428e-1028.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481798.685e-1025.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354072.868e-628.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Slit-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000000072.24.903e-1228.63pep primary_assembly:ASM223467v1:1:1576629:1604541... [more]
si:cabz01090165.11.933e-1124.62leucine-rich repeat and fibronectin type III domai... [more]
slitrk5a3.007e-1030.43SLIT and NTRK like family member 5 [Source:NCBI ge... [more]
pxdn3.378e-1026.74peroxidasin [Source:NCBI gene;Acc:101162089][more]
lrfn14.011e-1025.00leucine rich repeat and fibronectin type III domai... [more]
back to top
BLAST of Slit-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002157.10.000e+097.54SMESG000002157.1[more]
SMESG000033458.16.956e-7135.01SMESG000033458.1[more]
SMESG000033458.11.665e-6032.91SMESG000033458.1[more]
SMESG000026986.11.603e-5931.03SMESG000026986.1[more]
SMESG000026559.13.071e-5131.68SMESG000026559.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034592 ID=SMED30034592|Name=Slit-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1769bp
CCATTCATAAAACACAATAACTTTAGCTTTTCGATTATTGGCAATAGCTT
CACCCTCTATTTTTGATAATTCAATGATCTCAAAGAAATCTAAAGCCATT
TAAATATATATATATAAAAATTAATTCCATGCGATTTTTTTATCGGTGTA
AATACAATCTGGAGGGGGTAAATTTCTCAGATATAAAGATTTATTCTATT
ACCACAAATATCGTACTAATCATTATTCATATTCTTCACAATATCCACTG
CGTAGAACCTCGCGCAGGGTGTCCGTCATATTGCCAACAGCAACCCTGTC
TATCAGGAAAACTCGTATGTATAGAGCCTAATAAACTCACTGCGTTGCCA
TTGAATATCCCAAAAATAATCTACCACATATCTATTTCCGGCCAGAATTT
CATCAACACGACCTTATCCTACAACGCATTGTCGCATTACGGACCGGAGC
AAATTAATTTGCGTATCCTTCAGTTAACGTTTACCAATATCGAAAACATT
GAACCTGAGGCATTCTCACACTTAATAGCCCTAAAATCCCTAGATTTGTC
TAACAATCGTTTGAAAATTCTCCACAGTGGTATATTCAAAGGCCTTAGTC
TGGATTACTTGCGTTTGGATAATAATGAAAATCTGATTCTTTTAGAAGGA
TCGTTTCGAGGTCTCGTAGTGTCAAGTCTTTCATTGAAAAGTTGTTACCT
TAAAAATTTAAGTTATGAAATAATTAAAGAAGTATCTGGGCATTTAACCA
AACTATATCTCTCCCATAACCAGTTATCTGGAATCGACAAAAAGTTTGAG
CTCCTATTCGAAAGACTTGAATTAATCGACTTGAAAGAGAATCCATTCTT
TTGCACCTGTCAATTAAGGTGGCTTACGAAATCTTTGAAAGCACGTCAAC
ACGCTAAAGAGAAAGCTTTGATGTCAGAACTTCGATGCACGAATCCTAAA
GAGCTTAGCGGTCAAACGTTGATCTCTCTAAGTGAATCGAATCTCATATG
CAAACCTCCTGGCGTCAAAGAGATCGACATTTTCTTGCATGGTAACAATT
CTGGTCGACTTTCTTGTGAAGCAATAAATGCTTTGGAAACGAACGTAAAA
TGGAGACACAAACTCTTTGCGTCAGAAAATTATTACCGATTCCAAGATTA
TTCTCCAGCCCTTGGTCGGTCATTAATCTCAATCGAAAGCCGAAACAATG
TCGATCACTACTCGTGTTACGTTCAAAATAGTAAAGGTAAAGTCAACATC
GACGTTAACATAATGTGGCCTACAAATAATATTTCAAGTTTTATTTATAA
CTCTAACGAGGTTCGTTACATCTATCCAGAAACCTTCGACGACAACCAAC
TGAACCTTAACAACGACAACCCCATTGAAAAATTCTTCATGAGGAAACAA
TTCTCCCTTTTTGAACTGTTGATTTCGATGGTCGCAACTTTAATTGTAAC
AAGTTTATTGTCGACTCTTTGTTTCTGTTTGTTTTTCCGACATCGGTTTC
TACCTAACCTTTTCCAGAAATCCCAACCCATGACAGACAGTGCTGTCACG
TCAGAGGTTCAAATGCATAATATGTCTCAGTTTCCTTCGAGTCAGGAATT
AAAAGCTAACCAACTATTGGACTTCAAAACCCAACAGATCTTGCCTCTAG
TGATGAGCCAATCAAATTGGTCATTAAAGATTTAAACAAAATAATCTCAA
TTATTCACACTAATAATTTAGTTTGGAATTTTTTTAAAATTCCATAATTC
AAACAAAATAAAGTTTTTC
back to top

protein sequence of SMED30034592-orf-1

>SMED30034592-orf-1 ID=SMED30034592-orf-1|Name=SMED30034592-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=519bp
MRFFYRCKYNLEGVNFSDIKIYSITTNIVLIIIHILHNIHCVEPRAGCPS
YCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNA
LSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLKILHS
GIFKGLSLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIK
EVSGHLTKLYLSHNQLSGIDKKFELLFERLELIDLKENPFFCTCQLRWLT
KSLKARQHAKEKALMSELRCTNPKELSGQTLISLSESNLICKPPGVKEID
IFLHGNNSGRLSCEAINALETNVKWRHKLFASENYYRFQDYSPALGRSLI
SIESRNNVDHYSCYVQNSKGKVNIDVNIMWPTNNISSFIYNSNEVRYIYP
ETFDDNQLNLNNDNPIEKFFMRKQFSLFELLISMVATLIVTSLLSTLCFC
LFFRHRFLPNLFQKSQPMTDSAVTSEVQMHNMSQFPSSQELKANQLLDFK
TQQILPLVMSQSNWSLKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000103central nervous system
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR015310AHSA1_N
IPR003591Leu-rich_rpt_typical-subtyp
IPR000483Cys-rich_flank_reg_C
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0001671ATPase activator activity
GO:0051087chaperone binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000483Cysteine-rich flanking region, C-terminalSMARTSM00082lrrct1coord: 232..286
e-value: 1.4E-9
score: 47.8
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 103..125
e-value: 95.0
score: 5.3
coord: 126..149
e-value: 4.5E-5
score: 32.9
coord: 198..219
e-value: 59.0
score: 6.9
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 166..287
e-value: 1.6E-18
score: 68.5
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 39..165
e-value: 5.4E-16
score: 60.2
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 104..160
e-value: 3.3E-14
score: 52.4
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 104..125
score: 6.233
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 128..149
score: 6.595
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 199..220
score: 7.966
NoneNo IPR availablePANTHERPTHR45842FAMILY NOT NAMEDcoord: 23..319
NoneNo IPR availablePANTHERPTHR45842:SF11coord: 23..319
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 42..288
NoneNo IPR availableTMHMMTMhelixcoord: 425..447
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 288..373
score: 8.03