Hepatocyte nuclear factor 3-alpha

Overview
NameHepatocyte nuclear factor 3-alpha
Smed IDSMED30034582
Length (bp)730
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hepatocyte nuclear factor 3-alpha (SMED30034582) t-SNE clustered cells

Violin plots show distribution of expression levels for Hepatocyte nuclear factor 3-alpha (SMED30034582) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hepatocyte nuclear factor 3-alpha (SMED30034582) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hepatocyte nuclear factor 3-alpha (SMED30034582) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034582

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30034582SMESG000028135.1 dd_Smed_v4_30453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034582SMESG000028135.1 dd_Smed_v4_30453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034582SMESG000028135.1 dd_Smed_v4_30453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Human
Match: FOXA3 (forkhead box A3 [Source:HGNC Symbol;Acc:HGNC:5023])

HSP 1 Score: 113.235 bits (282), Expect = 4.781e-29
Identity = 48/85 (56.47%), Postives = 64/85 (75.29%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ +P +  TL+ IY WI   F Y++ + QRWQNSIRH+LSFNDCF+K+AR   + GKG YWA+HP + + 
Sbjct:  116 AKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNM 200          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Human
Match: FOXA1 (forkhead box A1 [Source:HGNC Symbol;Acc:HGNC:5021])

HSP 1 Score: 114.39 bits (285), Expect = 1.010e-28
Identity = 47/85 (55.29%), Postives = 65/85 (76.47%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ +P++  TL+ IY WI   F Y++ + QRWQNSIRH+LSFNDCF+K+AR   + GKG YW +HP++ + 
Sbjct:  169 AKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNM 253          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Human
Match: FOXA2 (forkhead box A2 [Source:HGNC Symbol;Acc:HGNC:5022])

HSP 1 Score: 111.309 bits (277), Expect = 9.382e-28
Identity = 46/85 (54.12%), Postives = 64/85 (75.29%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ SPN+  TL+ IY WI   F +++ + QRWQNSIRH+LSFNDCF+K+ R   + GKG +W +HP++ + 
Sbjct:  164 AKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNM 248          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Human
Match: FOXA2 (forkhead box A2 [Source:HGNC Symbol;Acc:HGNC:5022])

HSP 1 Score: 111.309 bits (277), Expect = 1.025e-27
Identity = 46/85 (54.12%), Postives = 64/85 (75.29%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ SPN+  TL+ IY WI   F +++ + QRWQNSIRH+LSFNDCF+K+ R   + GKG +W +HP++ + 
Sbjct:  158 AKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNM 242          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Human
Match: FOXB1 (forkhead box B1 [Source:HGNC Symbol;Acc:HGNC:3799])

HSP 1 Score: 107.457 bits (267), Expect = 4.629e-27
Identity = 47/84 (55.95%), Postives = 61/84 (72.62%), Query Frame = 1
Query:  286 KPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
            KPPYSYI+L +MAI+SSP +   L+ IY +I   F Y++ +TQRWQNS+RH LSFNDCFIK+ R   + GKG +WA+HP   D 
Sbjct:   13 KPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDM 96          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 105.531 bits (262), Expect = 2.737e-26
Identity = 45/78 (57.69%), Postives = 62/78 (79.49%), Query Frame = 1
Query:  286 KPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIH 519
            KPPYSYI+LI+MAI+ S +++ TL+ IY+WI   F Y++ + QRWQNSIRH+LSFNDCF+K+AR   + GKG +W +H
Sbjct:  141 KPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLH 218          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 105.916 bits (263), Expect = 2.788e-26
Identity = 45/78 (57.69%), Postives = 62/78 (79.49%), Query Frame = 1
Query:  286 KPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIH 519
            KPPYSYI+LI+MAI+ S +++ TL+ IY+WI   F Y++ + QRWQNSIRH+LSFNDCF+K+AR   + GKG +W +H
Sbjct:  172 KPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLH 249          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 106.301 bits (264), Expect = 3.189e-26
Identity = 45/78 (57.69%), Postives = 62/78 (79.49%), Query Frame = 1
Query:  286 KPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIH 519
            KPPYSYI+LI+MAI+ S +++ TL+ IY+WI   F Y++ + QRWQNSIRH+LSFNDCF+K+AR   + GKG +W +H
Sbjct:  236 KPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLH 313          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Celegans
Match: lin-31 (pep chromosome:WBcel235:II:3982549:3986944:1 gene:WBGene00003017.1 transcript:K10G6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-31)

HSP 1 Score: 99.3673 bits (246), Expect = 4.729e-25
Identity = 45/81 (55.56%), Postives = 56/81 (69.14%), Query Frame = 1
Query:  286 KPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEA 528
            KPPYSYI L  MAI+ S ++   L  IY +I   F +++ +TQRWQNS+RH LSFNDCFIK+ R     GKG YWA+HP A
Sbjct:   13 KPPYSYIWLTYMAIQDSDDKMLPLTEIYKYIMDRFPFYRKNTQRWQNSLRHNLSFNDCFIKIPRRADRPGKGSYWAVHPNA 93          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Celegans
Match: unc-130 (pep chromosome:WBcel235:II:11281986:11283953:1 gene:WBGene00006853.1 transcript:C47G2.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-130)

HSP 1 Score: 99.3673 bits (246), Expect = 2.596e-24
Identity = 46/85 (54.12%), Postives = 58/85 (68.24%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI LI+M+I +SP +K TL+ I ++I   F Y+K     WQNSIRH LS NDCF+K+AR  G  GKG YWA+ P  +D 
Sbjct:  126 AKPPYSYIALIAMSILNSPEKKLTLSEICEFIINKFEYYKEKFPAWQNSIRHNLSLNDCFVKVARGPGNPGKGNYWALDPNCEDM 210          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Fly
Match: fd96Ca (gene:FBgn0004897 transcript:FBtr0339246)

HSP 1 Score: 108.997 bits (271), Expect = 1.229e-27
Identity = 49/84 (58.33%), Postives = 61/84 (72.62%), Query Frame = 1
Query:  286 KPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
            KPPYSYI+L +MAI SSP +   L+ IY +I   F Y++ +TQRWQNS+RH LSFNDCFIK+ R     GKG YWA+HP+A D 
Sbjct:   13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDM 96          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Fly
Match: fd96Ca (gene:FBgn0004897 transcript:FBtr0084770)

HSP 1 Score: 108.997 bits (271), Expect = 1.229e-27
Identity = 49/84 (58.33%), Postives = 61/84 (72.62%), Query Frame = 1
Query:  286 KPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
            KPPYSYI+L +MAI SSP +   L+ IY +I   F Y++ +TQRWQNS+RH LSFNDCFIK+ R     GKG YWA+HP+A D 
Sbjct:   13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDM 96          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Fly
Match: fd96Cb (gene:FBgn0004898 transcript:FBtr0084771)

HSP 1 Score: 103.219 bits (256), Expect = 3.135e-26
Identity = 45/84 (53.57%), Postives = 61/84 (72.62%), Query Frame = 1
Query:  286 KPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
            KPPYSYI+L +MAI  SP +   L+ IY +I   F +++ +TQ+WQNS+RH LSFNDCFIK+ R + ++GKG YW +HP A D 
Sbjct:   13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRNVTKAGKGSYWTLHPMAFDM 96          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Fly
Match: croc (gene:FBgn0014143 transcript:FBtr0078395)

HSP 1 Score: 105.531 bits (262), Expect = 7.298e-26
Identity = 46/86 (53.49%), Postives = 65/86 (75.58%), Query Frame = 1
Query:  271 NDKPVKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEA 528
            N + VKPPYSYI LI+MAI+++ ++K TLNGIY +I + F Y++ + Q WQNSIRH LS N+CF+K+AR   + GKG YW + P++
Sbjct:   65 NKEIVKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDS 150          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Fly
Match: fkh (gene:FBgn0000659 transcript:FBtr0300259)

HSP 1 Score: 105.145 bits (261), Expect = 1.215e-25
Identity = 43/85 (50.59%), Postives = 64/85 (75.29%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+++P +  TL+ IY +I   F +++ + QRWQNSIRH+LSFNDCF+K+ R   + GKG +W +HP++ + 
Sbjct:  209 AKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNM 293          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Zebrafish
Match: foxa (forkhead box A sequence [Source:ZFIN;Acc:ZDB-GENE-990415-76])

HSP 1 Score: 120.168 bits (300), Expect = 6.382e-32
Identity = 50/85 (58.82%), Postives = 66/85 (77.65%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI MAI+ SP ++ TLN IYDWIR+ F Y++ + QRWQNSIRH+LSFNDCF+++ R     GKG YWA+HP++ + 
Sbjct:   75 AKPPYSYISLICMAIQQSPAKRLTLNEIYDWIRQLFPYYRQNQQRWQNSIRHSLSFNDCFVRVPRSPDSPGKGSYWALHPDSGNM 159          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Zebrafish
Match: foxa (forkhead box A sequence [Source:ZFIN;Acc:ZDB-GENE-990415-76])

HSP 1 Score: 120.168 bits (300), Expect = 6.507e-32
Identity = 50/85 (58.82%), Postives = 66/85 (77.65%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI MAI+ SP ++ TLN IYDWIR+ F Y++ + QRWQNSIRH+LSFNDCF+++ R     GKG YWA+HP++ + 
Sbjct:   80 AKPPYSYISLICMAIQQSPAKRLTLNEIYDWIRQLFPYYRQNQQRWQNSIRHSLSFNDCFVRVPRSPDSPGKGSYWALHPDSGNM 164          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Zebrafish
Match: foxa (forkhead box A sequence [Source:ZFIN;Acc:ZDB-GENE-990415-76])

HSP 1 Score: 119.783 bits (299), Expect = 8.204e-32
Identity = 50/85 (58.82%), Postives = 66/85 (77.65%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI MAI+ SP ++ TLN IYDWIR+ F Y++ + QRWQNSIRH+LSFNDCF+++ R     GKG YWA+HP++ + 
Sbjct:   75 AKPPYSYISLICMAIQQSPAKRLTLNEIYDWIRQLFPYYRQNQQRWQNSIRHSLSFNDCFVRVPRSPDSPGKGSYWALHPDSGNM 159          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Zebrafish
Match: foxa (forkhead box A sequence [Source:ZFIN;Acc:ZDB-GENE-990415-76])

HSP 1 Score: 120.168 bits (300), Expect = 1.096e-31
Identity = 50/85 (58.82%), Postives = 66/85 (77.65%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI MAI+ SP ++ TLN IYDWIR+ F Y++ + QRWQNSIRH+LSFNDCF+++ R     GKG YWA+HP++ + 
Sbjct:  100 AKPPYSYISLICMAIQQSPAKRLTLNEIYDWIRQLFPYYRQNQQRWQNSIRHSLSFNDCFVRVPRSPDSPGKGSYWALHPDSGNM 184          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Zebrafish
Match: foxa3 (forkhead box A3 [Source:ZFIN;Acc:ZDB-GENE-980526-423])

HSP 1 Score: 114.775 bits (286), Expect = 3.390e-29
Identity = 49/85 (57.65%), Postives = 64/85 (75.29%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ S ++  TLN IY WI   F Y++ + QRWQNSIRH+LSFNDCF+K+AR   + GKG YWA+HP + + 
Sbjct:  142 AKPPYSYISLITMAIQQSQSKMLTLNEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPNSGNM 226          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Xenopus
Match: ventx1.2 (VENT homeobox 1, gene 2 [Source:Xenbase;Acc:XB-GENE-920868])

HSP 1 Score: 116.316 bits (290), Expect = 7.526e-30
Identity = 49/85 (57.65%), Postives = 64/85 (75.29%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ +PN+  TLN IY WI   F Y++ + QRWQNSIRH+LSFNDCF+K+ R   + GKG YW +HPE+ + 
Sbjct:  118 AKPPYSYISLITMAIQQAPNKMMTLNEIYQWIIDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVPRSPEKPGKGSYWTLHPESGNM 202          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Xenopus
Match: xk (X-linked Kx blood group [Source:Xenbase;Acc:XB-GENE-1005584])

HSP 1 Score: 114.775 bits (286), Expect = 4.365e-29
Identity = 47/85 (55.29%), Postives = 65/85 (76.47%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ +P++  TL+ IY WI   F Y++ + QRWQNSIRH+LSFNDCF+K+AR   + GKG YW +HP++ + 
Sbjct:  157 AKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNM 241          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Xenopus
Match: foxa2 (forkhead box A2 [Source:NCBI gene;Acc:395063])

HSP 1 Score: 112.079 bits (279), Expect = 3.644e-28
Identity = 46/85 (54.12%), Postives = 64/85 (75.29%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ SPN+  TL+ IY WI   F +++ + QRWQNSIRH+LSFNDCF+K+ R   + GKG +W +HP++ + 
Sbjct:  148 AKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNM 232          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Xenopus
Match: FOXL1 (forkhead box L1 [Source:HGNC Symbol;Acc:HGNC:3817])

HSP 1 Score: 108.612 bits (270), Expect = 4.231e-27
Identity = 48/88 (54.55%), Postives = 60/88 (68.18%), Query Frame = 1
Query:  274 DKPVKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
            + P KPPYSYI LI+MAI+ SP+ + TLNGIY +I   F ++  + Q WQNSIRH LS NDCFIK+ R  G  GKG YW + P+  D 
Sbjct:   47 EPPQKPPYSYIALIAMAIKDSPDHRVTLNGIYQFIMDRFPFYHDNKQGWQNSIRHNLSLNDCFIKVPREKGRPGKGSYWTLDPKCLDM 134          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Xenopus
Match: ENSXETT00000015530.1 (forkhead box E1 [Source:NCBI gene;Acc:100038190])

HSP 1 Score: 107.842 bits (268), Expect = 7.971e-27
Identity = 46/84 (54.76%), Postives = 63/84 (75.00%), Query Frame = 1
Query:  286 KPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
            KPPYSYI LI+MAI +S ++K TL GIY +I + F +++ ++++WQNSIRH L+ NDCFIK+ R  G  GKG YWA+ P A+D 
Sbjct:   66 KPPYSYIALIAMAIANSTDRKLTLGGIYKFITERFPFYRDNSKKWQNSIRHNLTLNDCFIKIPREPGRPGKGNYWALDPNAEDM 149          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Mouse
Match: Foxa3 (forkhead box A3 [Source:MGI Symbol;Acc:MGI:1347477])

HSP 1 Score: 113.62 bits (283), Expect = 2.447e-29
Identity = 48/85 (56.47%), Postives = 64/85 (75.29%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ +P +  TL+ IY WI   F Y++ + QRWQNSIRH+LSFNDCF+K+AR   + GKG YWA+HP + + 
Sbjct:  118 AKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNM 202          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Mouse
Match: Foxa1 (forkhead box A1 [Source:MGI Symbol;Acc:MGI:1347472])

HSP 1 Score: 114.005 bits (284), Expect = 9.422e-29
Identity = 47/85 (55.29%), Postives = 65/85 (76.47%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ +P++  TL+ IY WI   F Y++ + QRWQNSIRH+LSFNDCF+K+AR   + GKG YW +HP++ + 
Sbjct:  169 AKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNM 253          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Mouse
Match: Foxa2 (forkhead box A2 [Source:MGI Symbol;Acc:MGI:1347476])

HSP 1 Score: 111.694 bits (278), Expect = 5.859e-28
Identity = 46/85 (54.12%), Postives = 64/85 (75.29%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ SPN+  TL+ IY WI   F +++ + QRWQNSIRH+LSFNDCF+K+ R   + GKG +W +HP++ + 
Sbjct:  158 AKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNM 242          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Mouse
Match: Foxa2 (forkhead box A2 [Source:MGI Symbol;Acc:MGI:1347476])

HSP 1 Score: 111.694 bits (278), Expect = 5.927e-28
Identity = 46/85 (54.12%), Postives = 64/85 (75.29%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ SPN+  TL+ IY WI   F +++ + QRWQNSIRH+LSFNDCF+K+ R   + GKG +W +HP++ + 
Sbjct:  164 AKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNM 248          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Mouse
Match: Foxb1 (forkhead box B1 [Source:MGI Symbol;Acc:MGI:1927549])

HSP 1 Score: 107.457 bits (267), Expect = 3.244e-27
Identity = 47/84 (55.95%), Postives = 61/84 (72.62%), Query Frame = 1
Query:  286 KPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
            KPPYSYI+L +MAI+SSP +   L+ IY +I   F Y++ +TQRWQNS+RH LSFNDCFIK+ R   + GKG +WA+HP   D 
Sbjct:   13 KPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDM 96          
BLAST of Hepatocyte nuclear factor 3-alpha vs. UniProt/SwissProt
Match: sp|P33206|FXA4B_XENLA (Forkhead box protein A4-B OS=Xenopus laevis OX=8355 GN=foxa4-b PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 2.161e-29
Identity = 50/85 (58.82%), Postives = 64/85 (75.29%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ +PN+  TLN IY WI   F Y++ + QRWQNSIRH+LSFNDCFIK+ R   + GKG YW +HPE+ + 
Sbjct:  118 AKPPYSYISLITMAIQQAPNKMMTLNEIYQWIVDLFPYYRQNQQRWQNSIRHSLSFNDCFIKVPRSPEKPGKGSYWTLHPESGNM 202          
BLAST of Hepatocyte nuclear factor 3-alpha vs. UniProt/SwissProt
Match: sp|Q6P839|FOXA4_XENTR (Forkhead box protein A4 OS=Xenopus tropicalis OX=8364 GN=foxa4 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 3.987e-29
Identity = 49/85 (57.65%), Postives = 64/85 (75.29%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ +PN+  TLN IY WI   F Y++ + QRWQNSIRH+LSFNDCF+K+ R   + GKG YW +HPE+ + 
Sbjct:  118 AKPPYSYISLITMAIQQAPNKMMTLNEIYQWIIDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVPRSPEKPGKGSYWTLHPESGNM 202          
BLAST of Hepatocyte nuclear factor 3-alpha vs. UniProt/SwissProt
Match: sp|P33205|FXA4A_XENLA (Forkhead box protein A4-A OS=Xenopus laevis OX=8355 GN=foxa4-a PE=1 SV=3)

HSP 1 Score: 116.316 bits (290), Expect = 4.197e-29
Identity = 49/85 (57.65%), Postives = 64/85 (75.29%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ +PN+  TLN IY WI   F Y++ + QRWQNSIRH+LSFNDCF+K+ R   + GKG YW +HPE+ + 
Sbjct:  118 AKPPYSYISLITMAIQQAPNKMMTLNEIYQWIIDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVPRSPEKPGKGSYWTLHPESGNM 202          
BLAST of Hepatocyte nuclear factor 3-alpha vs. UniProt/SwissProt
Match: sp|P32315|FXA1B_XENLA (Forkhead box protein A1-B OS=Xenopus laevis OX=8355 GN=foxa1-b PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 1.307e-28
Identity = 55/134 (41.04%), Postives = 84/134 (62.69%), Query Frame = 1
Query:  160 LNSKSFLTQFEISNEYYNSLTNESFPECFSAKSEDLTNDKP--------VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
            +N+     Q  +++  Y+S+ +   P  + A + + T D           KPPYSYI+LI+MAI+ +P++  TL+ IY WI   F Y++ + QRWQNSIRH+LSFNDCFIK++R   + GKG YW +HP++ + 
Sbjct:  107 MNAIQSAQQASMNSLSYSSMNSGMSPMGYGATNINRTRDSKTFRRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFIKVSRSPDKPGKGSYWTLHPDSGNM 240          
BLAST of Hepatocyte nuclear factor 3-alpha vs. UniProt/SwissProt
Match: sp|P32183|FOXA3_RAT (Hepatocyte nuclear factor 3-gamma OS=Rattus norvegicus OX=10116 GN=Foxa3 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.414e-28
Identity = 48/85 (56.47%), Postives = 64/85 (75.29%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ +P +  TL+ IY WI   F Y++ + QRWQNSIRH+LSFNDCF+K+AR   + GKG YWA+HP + + 
Sbjct:  118 AKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNM 202          
BLAST of Hepatocyte nuclear factor 3-alpha vs. TrEMBL
Match: A0A183AQU9 (Fork-head domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS9334 PE=4 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 5.114e-31
Identity = 55/93 (59.14%), Postives = 69/93 (74.19%), Query Frame = 1
Query:  259 EDLTNDKPVKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
            E+   +   KPP+SYITLI  A+ S P++  TLN IY WI   FAY++ +T+RWQNS+RHALSFNDCFIK+ RP GE+GKGCYW +HP A D 
Sbjct:    3 EEGAENTITKPPFSYITLIVSAMSSKPSKHITLNEIYAWIMSTFAYYRKNTRRWQNSVRHALSFNDCFIKIPRPSGEAGKGCYWTVHPRAVDM 95          
BLAST of Hepatocyte nuclear factor 3-alpha vs. TrEMBL
Match: A0A5J4NSY9 (Fork-head domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0014532 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.047e-30
Identity = 69/169 (40.83%), Postives = 103/169 (60.95%), Query Frame = 1
Query:   55 FSILTNILRSYVSIFEFSRHK*IEFLYVKDMMNYSLNSKSF--LTQFEISNEYYNSLTNESFPECFSAKSEDLTN------DKPVKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
            + + T++++S +++  FS     E  Y+ D ++    +  F  +T   IS   +  +++ S  +  SA+S+          D   KPP+SYITLI  A+ S P+++ TL+ IY WI   FAY++ +T+RWQNSIRHALSFNDCFIK+ RP GE+GKG YW +HP A D 
Sbjct:  125 YPLYTSLVKSGLAVKNFSD----ERPYLSDTLSLRTENPEFQPVTTTSISVLQHGKVSDSSSAQQRSAESDHALRTSSYGFDSSNKPPFSYITLIVSAMSSKPSKQITLSEIYAWIMSTFAYYRKNTRRWQNSIRHALSFNDCFIKVPRPTGEAGKGSYWTVHPRAVDM 289          
BLAST of Hepatocyte nuclear factor 3-alpha vs. TrEMBL
Match: A0A4E0S0M9 (Hepatocyte nuclear factor 3-alpha OS=Fasciola hepatica OX=6192 GN=D915_003499 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.668e-30
Identity = 54/88 (61.36%), Postives = 68/88 (77.27%), Query Frame = 1
Query:  274 DKPVKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
            D+  KPP+SYITLI  A+ S P++  TLN IY WI   FAY++ +T+RWQNS+RHALSFNDCF+K+ RP GE+GKGCYW +HP A D 
Sbjct:  319 DETTKPPFSYITLIVSAMSSKPSKHITLNEIYAWIMSTFAYYRKNTRRWQNSVRHALSFNDCFVKIPRPSGEAGKGCYWTVHPRAVDM 406          
BLAST of Hepatocyte nuclear factor 3-alpha vs. TrEMBL
Match: A0A504YXH7 (Hepatocyte nuclear factor 3-beta OS=Fasciola gigantica OX=46835 GN=FGIG_00384 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.884e-30
Identity = 54/89 (60.67%), Postives = 69/89 (77.53%), Query Frame = 1
Query:  271 NDKPVKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
            +D+  KPP+SYITLI  A+ S P++  TLN IY WI   FAY++ +T+RWQNS+RHALSFNDCF+K+ RP GE+GKGCYW +HP A D 
Sbjct:  309 DDETTKPPFSYITLIVSAMSSKPSKHITLNEIYAWIMSTFAYYRKNTRRWQNSVRHALSFNDCFVKIPRPSGEAGKGCYWTVHPRAVDM 397          
BLAST of Hepatocyte nuclear factor 3-alpha vs. TrEMBL
Match: A0A4S2LLQ7 (Fork-head domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007886 PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 3.108e-29
Identity = 64/129 (49.61%), Postives = 85/129 (65.89%), Query Frame = 1
Query:  151 NYSLNSKSFLTQFEISNEYYNSLTNESFPECFSAKSEDLTNDKPVKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
            N SL + + L+ F+   + +   T+   P    A   DL+ D   KPP+SYITLI  A+ S P+++ TL+ IY WI   FAY++ +T+RWQNSIRHALSFNDCFIK+ RP GE+GKG YW +HP A D 
Sbjct:  284 NSSLFTTANLSAFDGQTQSFVEQTHRGEPSNVHAV--DLS-DVSTKPPFSYITLIVSAMSSKPSKQITLSEIYAWIMSTFAYYRKNTRRWQNSIRHALSFNDCFIKVPRPSGEAGKGSYWTVHPRAIDM 409          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Cavefish
Match: foxa (hepatocyte nuclear factor 3-gamma-like [Source:NCBI gene;Acc:103028902])

HSP 1 Score: 117.857 bits (294), Expect = 1.609e-30
Identity = 50/84 (59.52%), Postives = 65/84 (77.38%), Query Frame = 1
Query:  286 KPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
            KPPYSYI+LI MAI+ SP +K TLN IYDWIR+ F Y++ + QRWQNSIRH+LSFNDCFI++ R     GKG +W +HP++ + 
Sbjct:  102 KPPYSYISLIYMAIQQSPTKKLTLNEIYDWIRQLFPYYRQNQQRWQNSIRHSLSFNDCFIRVPRSPESPGKGSFWTLHPDSGNM 185          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Cavefish
Match: foxa1 (forkhead box A1 [Source:ZFIN;Acc:ZDB-GENE-990415-78])

HSP 1 Score: 114.39 bits (285), Expect = 2.123e-29
Identity = 47/85 (55.29%), Postives = 65/85 (76.47%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ SP++  TL+ IY WI   F Y++ + QRWQNSIRH+LSFNDCF+K++R   + GKG YW +HP++ + 
Sbjct:  138 AKPPYSYISLITMAIQQSPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPDKPGKGSYWTLHPDSGNM 222          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Cavefish
Match: foxa3 (hepatocyte nuclear factor 3-gamma [Source:NCBI gene;Acc:103043939])

HSP 1 Score: 114.39 bits (285), Expect = 3.704e-29
Identity = 49/85 (57.65%), Postives = 64/85 (75.29%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ S ++  TLN IY WI   F Y++ + QRWQNSIRH+LSFNDCF+K+AR   + GKG YWA+HP + + 
Sbjct:  141 AKPPYSYISLITMAIQQSGSKMLTLNEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPNSGNM 225          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Cavefish
Match: ENSAMXT00000003861.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000133.1:1175856:1177001:-1 gene:ENSAMXG00000003780.2 transcript:ENSAMXT00000003861.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.301 bits (264), Expect = 4.640e-28
Identity = 46/84 (54.76%), Postives = 61/84 (72.62%), Query Frame = 1
Query:  286 KPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
            KPPYSYI+L +MAI+S P +   L+ IY +I + F Y++ +TQRWQNS+RH LSFNDCFIK+ R   + GKG +WA+HP   D 
Sbjct:   13 KPPYSYISLTAMAIQSCPEKMLPLSDIYKFIMERFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPRCGDM 96          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Cavefish
Match: foxl1 (forkhead box L1 [Source:ZFIN;Acc:ZDB-GENE-040426-1181])

HSP 1 Score: 106.301 bits (264), Expect = 6.243e-28
Identity = 46/88 (52.27%), Postives = 62/88 (70.45%), Query Frame = 1
Query:  274 DKPVKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
            + P KPPYSYI LI+MAI+S+P ++ TL+GIY +I  +F ++  + Q WQNSIRH LS NDCF+K+ R  G  GKG YW + P+  D 
Sbjct:   65 EPPQKPPYSYIALIAMAIKSAPEERATLSGIYQFIMDNFPFYHDNKQGWQNSIRHNLSLNDCFVKVPREKGRPGKGSYWTLDPKCLDM 152          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Sea Lamprey
Match: foxa2 (forkhead box A2 [Source:NCBI gene;Acc:30126])

HSP 1 Score: 110.923 bits (276), Expect = 1.566e-28
Identity = 46/85 (54.12%), Postives = 64/85 (75.29%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ S ++  TLN IY WI   F +++ + QRWQNSIRH+LSFNDCF+K+ R   + GKG +WA+HP++ + 
Sbjct:  160 AKPPYSYISLITMAIQQSTHKMMTLNEIYSWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRSPDKPGKGSFWALHPDSGNM 244          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Sea Lamprey
Match: FOXC2 (forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801])

HSP 1 Score: 104.76 bits (260), Expect = 1.725e-28
Identity = 45/82 (54.88%), Postives = 63/82 (76.83%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEA 528
            VKPPYSYI LI+MAI+S+P++K TLNGIY +I   F +++ + Q WQNSIRH LS N+CF+K+ R   + GKG YW++ P++
Sbjct:   76 VKPPYSYIALITMAIQSAPDKKVTLNGIYQFIMDKFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWSLDPDS 157          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005206.1 (pep scaffold:Pmarinus_7.0:GL479371:8768:18483:1 gene:ENSPMAG00000004735.1 transcript:ENSPMAT00000005206.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.457 bits (267), Expect = 3.028e-28
Identity = 46/85 (54.12%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ S  +  TLN IY WI   F +++ + QRWQNSIRH+LSFNDCF+K+ R   + GKG +WA+HP++ + 
Sbjct:  154 AKPPYSYISLITMAIQQSSGKMLTLNEIYSWITDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRSPDKPGKGSFWALHPDSGNM 238          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Sea Lamprey
Match: foxb2 (forkhead box B2 [Source:ZFIN;Acc:ZDB-GENE-081104-320])

HSP 1 Score: 103.99 bits (258), Expect = 1.511e-26
Identity = 46/84 (54.76%), Postives = 61/84 (72.62%), Query Frame = 1
Query:  286 KPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
            KPPYSYI+L +MAI+SS  +   L+ IY +I + F Y++ +TQRWQNS+RH LSFNDCFIK+ R   + GKG +WA+HP   D 
Sbjct:   13 KPPYSYISLTAMAIQSSAEKMLPLSEIYKFIMERFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPACGDM 96          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Sea Lamprey
Match: foxf2a (forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-5])

HSP 1 Score: 97.8265 bits (242), Expect = 1.792e-26
Identity = 42/85 (49.41%), Postives = 61/85 (71.76%), Query Frame = 1
Query:  277 KPVKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAK 531
            +P KPP+SYI LI MAI+SSP ++ TL+ IY +++  F +F+   Q W+NS+RH LS N+CF+KL + +G  GKG YW I P ++
Sbjct:    2 RPEKPPFSYIALIVMAIQSSPAKRVTLSEIYQFLQGRFPFFRGAYQGWKNSVRHNLSLNECFVKLPKGLGRPGKGHYWTIDPASE 86          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Yeast
Match: HCM1 (Forkhead transcription factor; drives S-phase activation of genes involved in chromosome segregation, spindle dynamics, budding; also activates genes involved in respiration, use of alternative energy sources (like proline), NAD synthesis, oxidative stress resistance; key factor in early adaptation to nutrient deficiency and diauxic shift; suppressor of calmodulin mutants with specific SPB assembly defects; ortholog of C. elegans lifespan regulator PHA-4 [Source:SGD;Acc:S000000661])

HSP 1 Score: 86.2705 bits (212), Expect = 6.296e-20
Identity = 43/82 (52.44%), Postives = 50/82 (60.98%), Query Frame = 1
Query:  286 KPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAK 531
            KPPYSY TLI +AI  S   K TL+ IY WI  HF Y+K     WQNSIRH LS ND FIK  +     GKG +W + P A+
Sbjct:  109 KPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAFIKTEKSC--DGKGHFWEVRPGAE 188          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Yeast
Match: FKH1 (Forkhead family transcription factor; rate-limiting replication origin activator; evolutionarily conserved lifespan regulator; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; regulates transcription elongation, chromatin silencing at mating loci, expression of G2/M phase genes; facilitates clustering, activation of early-firing replication origins; binds HML recombination enhancer, regulates donor preference during mating-type switching [Source:SGD;Acc:S000001393])

HSP 1 Score: 82.8037 bits (203), Expect = 9.593e-19
Identity = 40/110 (36.36%), Postives = 63/110 (57.27%), Query Frame = 1
Query:  211 NSLTNESFPECFSAKSEDLTNDKPVKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEA-KDF 537
            N++TN + P   +     L  ++ +KPP SY ++I+ AI S+P    +L  IY +I  ++A+++     WQNS+RH LS N  F K+ +  G+ GKG  W I  E  +DF
Sbjct:  278 NAVTNGNVPHIENPSDLSLDENRYIKPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKISDEVRRDF 387          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Yeast
Match: FKH2 (Forkhead family transcription factor; rate-limiting activator of replication origins; evolutionarily conserved regulator of lifespan; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; positively regulates transcriptional elongation; facilitates clustering, activation of early-firing replication origins; negative role in chromatin silencing at HML and HMR; major role in expression of G2/M phase genes; relocalizes to cytosol under hypoxia [Source:SGD;Acc:S000005012])

HSP 1 Score: 81.2629 bits (199), Expect = 3.535e-18
Identity = 43/98 (43.88%), Postives = 59/98 (60.20%), Query Frame = 1
Query:  229 SFPECFSAKSEDLTND--KPVKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAI 516
            ++P+     S DL++D  + VKPP+SY T+I+ AI SSP    +L  IY +I  ++AY++     WQNSIRH LS N  F K+ R   E GKG  W I
Sbjct:  320 AYPQALDFTS-DLSHDENRNVKPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRI 416          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Yeast
Match: FHL1 (Regulator of ribosomal protein (RP) transcription; has forkhead associated domain that binds phosphorylated proteins; recruits coactivator Ifh1p or corepressor Crf1p to RP gene promoters; also has forkhead DNA-binding domain though in vitro DNA binding assays give inconsistent results; computational analyses suggest it binds DNA directly at highly active RP genes and indirectly through Rap1p motifs at others; suppresses RNA pol III and splicing factor prp4 mutants [Source:SGD;Acc:S000006308])

HSP 1 Score: 53.1434 bits (126), Expect = 1.355e-8
Identity = 30/82 (36.59%), Postives = 43/82 (52.44%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRS-SPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPE 525
             KP  SY  +++  IR  S  +  +L+ IY  IR+ F Y+K     WQ+S+RH LS N  F    R + + GKG  W +  E
Sbjct:  460 TKPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSF----RKVSKEGKGWLWGLDEE 537          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Nematostella
Match: EDO39529 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9S2])

HSP 1 Score: 106.686 bits (265), Expect = 1.801e-29
Identity = 48/86 (55.81%), Postives = 63/86 (73.26%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPI-GESGKGCYWAIHPEAKDF 537
            VKPP+SYI LI+M+I +SP + +TLN IY++I   F YF+ + Q+WQNSIRH LS NDCF+K+ R I G+ GKG YW +HP   D 
Sbjct:   15 VKPPFSYIALITMSIEASPYRMRTLNEIYEFIMTRFPYFRKNQQKWQNSIRHNLSLNDCFVKVPRSIFGKPGKGNYWTLHPSCGDM 100          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Nematostella
Match: EDO42654 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0W7])

HSP 1 Score: 104.375 bits (259), Expect = 6.582e-29
Identity = 46/79 (58.23%), Postives = 60/79 (75.95%), Query Frame = 1
Query:  286 KPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHP 522
            KPPYSY+ LISMAI+ S  QK TL+GIY +I ++F Y++L+ + WQNSIRH LS N CF+K+ R   + GKGCYWA+ P
Sbjct:    3 KPPYSYVALISMAIKQSKGQKITLSGIYQFIIENFPYYRLNKRGWQNSIRHNLSLNKCFVKIPRERSDPGKGCYWALDP 81          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Nematostella
Match: EDO42492 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1E3])

HSP 1 Score: 109.383 bits (272), Expect = 8.518e-29
Identity = 47/85 (55.29%), Postives = 62/85 (72.94%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ SPN+  TL+ IY +I   F Y++ + QRWQNSIRH+LSFNDCF+K+ R     GKG YW +HP+  + 
Sbjct:   39 AKPPYSYISLITMAIQQSPNKMLTLSEIYQFIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVPRSPDRPGKGSYWTLHPDCGNM 123          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Nematostella
Match: EDO39562 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9S5])

HSP 1 Score: 106.686 bits (265), Expect = 5.851e-28
Identity = 45/81 (55.56%), Postives = 62/81 (76.54%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPE 525
             KPPYSYI+L +MAI+SSP +  +L+ IY +I  HF +++ +TQRWQNS+RH LSFNDCF+K+ R   + GKG  WA+HP+
Sbjct:   12 AKPPYSYISLTAMAIQSSPQKMLSLSEIYQFIMDHFPFYRDNTQRWQNSLRHNLSFNDCFVKIPRRPDQPGKGSLWALHPD 92          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Nematostella
Match: EDO47812 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL76])

HSP 1 Score: 100.908 bits (250), Expect = 2.144e-27
Identity = 45/84 (53.57%), Postives = 58/84 (69.05%), Query Frame = 1
Query:  286 KPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
            KPPYSY+ LI+MAIR SP ++ TLNGIY +I   F Y++ + + WQNSIRH LS N+CFIK+ R  G   KG YW + P  +D 
Sbjct:    1 KPPYSYVALIAMAIRESPEKRLTLNGIYQYIISKFPYYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDM 84          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Medaka
Match: foxa3 (forkhead box A3 [Source:NCBI gene;Acc:100049257])

HSP 1 Score: 113.235 bits (282), Expect = 1.018e-28
Identity = 48/85 (56.47%), Postives = 64/85 (75.29%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ S ++  TLN IY WI   F Y++ + QRWQNSIRH+LSFNDCF+K+AR   + GKG YW +HP++ + 
Sbjct:  149 AKPPYSYISLITMAIQQSGSKMLTLNEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPQSGNM 233          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Medaka
Match: ENSORLT00000024271.2 (forkhead box A1 [Source:NCBI gene;Acc:100301627])

HSP 1 Score: 111.694 bits (278), Expect = 2.250e-28
Identity = 46/85 (54.12%), Postives = 65/85 (76.47%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ +P++  TL+ IY WI   F Y++ + QRWQNSIRH+LSFNDCF+K++R   + GKG YW +HP++ + 
Sbjct:  148 AKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPDKPGKGSYWTLHPDSGNM 232          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Medaka
Match: foxe1 (forkhead box E1 [Source:NCBI gene;Acc:100301610])

HSP 1 Score: 110.923 bits (276), Expect = 2.545e-28
Identity = 48/84 (57.14%), Postives = 64/84 (76.19%), Query Frame = 1
Query:  286 KPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
            KPPYSYI LISMAI +SP++K TL GIY +I + F +++ ++++WQNSIRH L+ NDCFIK+ R  G  GKG YWA+ P A+D 
Sbjct:   42 KPPYSYIALISMAIANSPDRKLTLGGIYKFITERFPFYRDNSKKWQNSIRHNLTLNDCFIKIPREPGRPGKGNYWALDPNAEDM 125          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Medaka
Match: ENSORLT00000045293.1 (forkhead box A [Source:NCBI gene;Acc:100301602])

HSP 1 Score: 110.153 bits (274), Expect = 3.665e-28
Identity = 48/85 (56.47%), Postives = 64/85 (75.29%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ S N+  TLN IY WI   F +++ + QRWQNSIRH+LSFNDCFIK+ R   + GKG +WA+HP++ + 
Sbjct:  115 AKPPYSYISLITMAIQQSDNKMLTLNEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFIKVPRSSDKPGKGSFWALHPDSGNM 199          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Medaka
Match: foxa2 (Me-HNF3b protein [Source:NCBI gene;Acc:100049256])

HSP 1 Score: 108.997 bits (271), Expect = 2.931e-27
Identity = 45/85 (52.94%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI+ SP++  TL  IY WI   F +++ + QRWQNSIRH+LSFNDCF+K+ R   + GKG +W +HP++ + 
Sbjct:  149 AKPPYSYISLITMAIQQSPSKMLTLAEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNM 233          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Planmine SMEST
Match: SMESG000028135.1 (SMESG000028135.1)

HSP 1 Score: 275.789 bits (704), Expect = 5.039e-106
Identity = 131/133 (98.50%), Postives = 132/133 (99.25%), Query Frame = 1
Query:  136 VKDMMNYSLNSKSFLTQFEISNEYYNSLTNESFPECFSAKSEDLTNDKPVKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKD 534
            VKDMMNYSLNSKSFLTQFEISNEY NSLTNESFPECFSAKSEDLTNDKPVKPPYSYITLIS+AIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKD
Sbjct:   18 VKDMMNYSLNSKSFLTQFEISNEYCNSLTNESFPECFSAKSEDLTNDKPVKPPYSYITLISIAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKD 150          

HSP 2 Score: 114.775 bits (286), Expect = 5.039e-106
Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 2
Query:  536 FQFGSLLRRYKKFTQSDRNHKIWNYFPYSHQASAIVTKNIAFPYNTNDRFFYYK 697
            FQFGSLLRRYKKFTQSDRNHKIWNYFPYSHQASAIVTKNIAFPYNTNDRFFYYK
Sbjct:  152 FQFGSLLRRYKKFTQSDRNHKIWNYFPYSHQASAIVTKNIAFPYNTNDRFFYYK 205          

HSP 3 Score: 34.6538 bits (78), Expect = 5.039e-106
Identity = 15/16 (93.75%), Postives = 15/16 (93.75%), Query Frame = 2
Query:   86 MFQYLNFQDTNELNSC 133
            MFQYLN QDTNELNSC
Sbjct:    1 MFQYLNVQDTNELNSC 16          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Planmine SMEST
Match: SMESG000004239.1 (SMESG000004239.1)

HSP 1 Score: 110.923 bits (276), Expect = 2.684e-28
Identity = 49/82 (59.76%), Postives = 61/82 (74.39%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEA 528
            VKPPYSYI LI+MAI S P+ + TLNGIY +I + F Y++ + Q WQNSIRH LS N+CFIK++R    SGKG YW +HP A
Sbjct:  145 VKPPYSYIALITMAITSQPDHRITLNGIYQFISERFPYYRENKQGWQNSIRHNLSLNECFIKVSRGDQRSGKGSYWTLHPNA 226          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Planmine SMEST
Match: SMESG000065670.1 (SMESG000065670.1)

HSP 1 Score: 112.079 bits (279), Expect = 2.795e-28
Identity = 47/85 (55.29%), Postives = 65/85 (76.47%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEAKDF 537
             KPPYSYI+LI+MAI++SP    TL+ IY +I  HF Y++ + QRWQNSIRH+LSFNDCF+K++R   + GKG YW +HP++ + 
Sbjct:  107 AKPPYSYISLITMAIQNSPVNMCTLSEIYQFIMDHFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPEKPGKGSYWTLHPQSGNM 191          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Planmine SMEST
Match: SMESG000015673.1 (SMESG000015673.1)

HSP 1 Score: 110.538 bits (275), Expect = 5.957e-28
Identity = 47/82 (57.32%), Postives = 62/82 (75.61%), Query Frame = 1
Query:  283 VKPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEA 528
            VKPPYSYI LI+MA+ + P +K TL+GIY +I + F Y++ + Q WQNSIRH LS N+CFIK+ R   + GKG YWA+HP+A
Sbjct:   72 VKPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQA 153          
BLAST of Hepatocyte nuclear factor 3-alpha vs. Planmine SMEST
Match: SMESG000067799.1 (SMESG000067799.1)

HSP 1 Score: 106.301 bits (264), Expect = 2.176e-27
Identity = 46/81 (56.79%), Postives = 63/81 (77.78%), Query Frame = 1
Query:  286 KPPYSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHALSFNDCFIKLARPIGESGKGCYWAIHPEA 528
            KPPYSYI+LI+MAI++SP +  TL+ IY +I   F Y++ + QRWQNSIRH+LSFNDCFIK +R   + GKG +W +HP++
Sbjct:   46 KPPYSYISLITMAIQNSPQKMCTLSEIYQFIMDSFPYYQQNQQRWQNSIRHSLSFNDCFIKASRCTEKPGKGSFWVLHPDS 126          
The following BLAST results are available for this feature:
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXA34.781e-2956.47forkhead box A3 [Source:HGNC Symbol;Acc:HGNC:5023][more]
FOXA11.010e-2855.29forkhead box A1 [Source:HGNC Symbol;Acc:HGNC:5021][more]
FOXA29.382e-2854.12forkhead box A2 [Source:HGNC Symbol;Acc:HGNC:5022][more]
FOXA21.025e-2754.12forkhead box A2 [Source:HGNC Symbol;Acc:HGNC:5022][more]
FOXB14.629e-2755.95forkhead box B1 [Source:HGNC Symbol;Acc:HGNC:3799][more]
back to top
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pha-42.737e-2657.69Defective pharyngeal development protein 4 [Sourc... [more]
pha-42.788e-2657.69Defective pharyngeal development protein 4 [Sourc... [more]
pha-43.189e-2657.69Defective pharyngeal development protein 4 [Sourc... [more]
lin-314.729e-2555.56pep chromosome:WBcel235:II:3982549:3986944:1 gene:... [more]
unc-1302.596e-2454.12pep chromosome:WBcel235:II:11281986:11283953:1 gen... [more]
back to top
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fd96Ca1.229e-2758.33gene:FBgn0004897 transcript:FBtr0339246[more]
fd96Ca1.229e-2758.33gene:FBgn0004897 transcript:FBtr0084770[more]
fd96Cb3.135e-2653.57gene:FBgn0004898 transcript:FBtr0084771[more]
croc7.298e-2653.49gene:FBgn0014143 transcript:FBtr0078395[more]
fkh1.215e-2550.59gene:FBgn0000659 transcript:FBtr0300259[more]
back to top
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxa6.382e-3258.82forkhead box A sequence [Source:ZFIN;Acc:ZDB-GENE-... [more]
foxa6.507e-3258.82forkhead box A sequence [Source:ZFIN;Acc:ZDB-GENE-... [more]
foxa8.204e-3258.82forkhead box A sequence [Source:ZFIN;Acc:ZDB-GENE-... [more]
foxa1.096e-3158.82forkhead box A sequence [Source:ZFIN;Acc:ZDB-GENE-... [more]
foxa33.390e-2957.65forkhead box A3 [Source:ZFIN;Acc:ZDB-GENE-980526-4... [more]
back to top
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ventx1.27.526e-3057.65VENT homeobox 1, gene 2 [Source:Xenbase;Acc:XB-GEN... [more]
xk4.365e-2955.29X-linked Kx blood group [Source:Xenbase;Acc:XB-GEN... [more]
foxa23.644e-2854.12forkhead box A2 [Source:NCBI gene;Acc:395063][more]
FOXL14.231e-2754.55forkhead box L1 [Source:HGNC Symbol;Acc:HGNC:3817][more]
ENSXETT00000015530.17.971e-2754.76forkhead box E1 [Source:NCBI gene;Acc:100038190][more]
back to top
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Foxa32.447e-2956.47forkhead box A3 [Source:MGI Symbol;Acc:MGI:1347477... [more]
Foxa19.422e-2955.29forkhead box A1 [Source:MGI Symbol;Acc:MGI:1347472... [more]
Foxa25.859e-2854.12forkhead box A2 [Source:MGI Symbol;Acc:MGI:1347476... [more]
Foxa25.927e-2854.12forkhead box A2 [Source:MGI Symbol;Acc:MGI:1347476... [more]
Foxb13.244e-2755.95forkhead box B1 [Source:MGI Symbol;Acc:MGI:1927549... [more]
back to top
BLAST of Hepatocyte nuclear factor 3-alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P33206|FXA4B_XENLA2.161e-2958.82Forkhead box protein A4-B OS=Xenopus laevis OX=835... [more]
sp|Q6P839|FOXA4_XENTR3.987e-2957.65Forkhead box protein A4 OS=Xenopus tropicalis OX=8... [more]
sp|P33205|FXA4A_XENLA4.197e-2957.65Forkhead box protein A4-A OS=Xenopus laevis OX=835... [more]
sp|P32315|FXA1B_XENLA1.307e-2841.04Forkhead box protein A1-B OS=Xenopus laevis OX=835... [more]
sp|P32183|FOXA3_RAT1.414e-2856.47Hepatocyte nuclear factor 3-gamma OS=Rattus norveg... [more]
back to top
BLAST of Hepatocyte nuclear factor 3-alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183AQU95.114e-3159.14Fork-head domain-containing protein OS=Echinostoma... [more]
A0A5J4NSY91.047e-3040.83Fork-head domain-containing protein OS=Paragonimus... [more]
A0A4E0S0M91.668e-3061.36Hepatocyte nuclear factor 3-alpha OS=Fasciola hepa... [more]
A0A504YXH71.884e-3060.67Hepatocyte nuclear factor 3-beta OS=Fasciola gigan... [more]
A0A4S2LLQ73.108e-2949.61Fork-head domain-containing protein OS=Opisthorchi... [more]
back to top
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxa1.609e-3059.52hepatocyte nuclear factor 3-gamma-like [Source:NCB... [more]
foxa12.123e-2955.29forkhead box A1 [Source:ZFIN;Acc:ZDB-GENE-990415-7... [more]
foxa33.704e-2957.65hepatocyte nuclear factor 3-gamma [Source:NCBI gen... [more]
ENSAMXT00000003861.24.640e-2854.76pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
foxl16.243e-2852.27forkhead box L1 [Source:ZFIN;Acc:ZDB-GENE-040426-1... [more]
back to top
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxa21.566e-2854.12forkhead box A2 [Source:NCBI gene;Acc:30126][more]
FOXC21.725e-2854.88forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801][more]
ENSPMAT00000005206.13.028e-2854.12pep scaffold:Pmarinus_7.0:GL479371:8768:18483:1 ge... [more]
foxb21.511e-2654.76forkhead box B2 [Source:ZFIN;Acc:ZDB-GENE-081104-3... [more]
foxf2a1.792e-2649.41forkhead box F2a [Source:ZFIN;Acc:ZDB-GENE-110407-... [more]
back to top
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
HCM16.296e-2052.44Forkhead transcription factor; drives S-phase acti... [more]
FKH19.593e-1936.36Forkhead family transcription factor; rate-limitin... [more]
FKH23.535e-1843.88Forkhead family transcription factor; rate-limitin... [more]
FHL11.355e-836.59Regulator of ribosomal protein (RP) transcription;... [more]
back to top
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO395291.801e-2955.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426546.582e-2958.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424928.518e-2955.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395625.851e-2855.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478122.144e-2753.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hepatocyte nuclear factor 3-alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxa31.018e-2856.47forkhead box A3 [Source:NCBI gene;Acc:100049257][more]
ENSORLT00000024271.22.250e-2854.12forkhead box A1 [Source:NCBI gene;Acc:100301627][more]
foxe12.545e-2857.14forkhead box E1 [Source:NCBI gene;Acc:100301610][more]
ENSORLT00000045293.13.665e-2856.47forkhead box A [Source:NCBI gene;Acc:100301602][more]
foxa22.931e-2752.94Me-HNF3b protein [Source:NCBI gene;Acc:100049256][more]
back to top
BLAST of Hepatocyte nuclear factor 3-alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028135.15.039e-10698.50SMESG000028135.1[more]
SMESG000004239.12.684e-2859.76SMESG000004239.1[more]
SMESG000065670.12.795e-2855.29SMESG000065670.1[more]
SMESG000015673.15.957e-2857.32SMESG000015673.1[more]
SMESG000067799.12.176e-2756.79SMESG000067799.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034582 ID=SMED30034582|Name=Hepatocyte nuclear factor 3-alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=730bp
TTTTTCCCGAAAAATTTGGAACTATTATTACAAAATTTTTAATTATTGTT
TGCATTTTCTATATTAACTAATATTTTGCGTTCTTATGTTTCAATATTTG
AATTTTCAAGACACAAATGAATTGAATTCTTGTATGTAAAGGATATGATG
AATTATTCGTTAAATTCGAAATCTTTCTTAACTCAATTTGAAATTTCCAA
TGAATATTATAATTCTTTGACGAATGAGTCTTTTCCAGAGTGTTTCTCAG
CAAAATCGGAAGATCTAACAAATGATAAACCTGTTAAACCTCCTTATAGC
TATATAACTTTAATATCAATGGCAATCCGATCGTCGCCTAATCAAAAACA
AACTTTGAATGGAATTTATGATTGGATTAGGAAACATTTTGCATATTTCA
AATTGGATACTCAAAGATGGCAGAACTCAATTCGTCATGCTCTGTCATTT
AATGATTGCTTCATAAAATTGGCGAGACCAATTGGTGAATCTGGAAAAGG
TTGCTATTGGGCTATTCATCCTGAAGCAAAAGATTTTTCAATTCGGATCA
TTATTACGTAGATATAAAAAGTTCACTCAGTCAGATAGAAATCACAAAAT
TTGGAATTATTTCCCATATTCTCACCAGGCTTCAGCAATCGTCACAAAAA
ATATTGCTTTTCCTTATAATACCAATGATCGATTTTTTTATTATAAATAG
TAATTTTCATTGAAATTATCAGCAGATCGG
back to top

protein sequence of SMED30034582-orf-1

>SMED30034582-orf-1 ID=SMED30034582-orf-1|Name=SMED30034582-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=139bp
MMNYSLNSKSFLTQFEISNEYYNSLTNESFPECFSAKSEDLTNDKPVKPP
YSYITLISMAIRSSPNQKQTLNGIYDWIRKHFAYFKLDTQRWQNSIRHAL
SFNDCFIKLARPIGESGKGCYWAIHPEAKDFSIRIIIT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001766Fork_head_dom
IPR011991WHTH_DNA-bd_dom
IPR018122TF_fork_head_CS_1
IPR030456TF_fork_head_CS_2
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0007275multicellular organism development
GO:0007399nervous system development
GO:0030154cell differentiation
GO:0045892negative regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0003677DNA binding
GO:0008134transcription factor binding
GO:0019904protein domain specific binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus