CRAL-TRIO domain-containing protein

Overview
NameCRAL-TRIO domain-containing protein
Smed IDSMED30034563
Length (bp)3310
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CRAL-TRIO domain-containing protein (SMED30034563) t-SNE clustered cells

Violin plots show distribution of expression levels for CRAL-TRIO domain-containing protein (SMED30034563) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CRAL-TRIO domain-containing protein (SMED30034563) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CRAL-TRIO domain-containing protein (SMED30034563) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034563

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30034563SMESG000046620.1 Contig2120newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034563SMESG000046620.1 Contig2120uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034563SMESG000077668.1 Contig2120newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034563SMESG000077668.1 Contig2120uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30034563SMESG000046620.1 dd_Smed_v4_3509_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034563SMESG000046620.1 dd_Smed_v4_3509_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034563SMESG000046622.1 dd_Smed_v4_17337_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30034563SMESG000046622.1 dd_Smed_v4_17337_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30034563SMESG000046622.1 dd_Smed_v4_17337_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: PRUNE2 (prune homolog 2 with BCH domain [Source:HGNC Symbol;Acc:HGNC:25209])

HSP 1 Score: 122.094 bits (305), Expect = 2.542e-29
Identity = 60/160 (37.50%), Postives = 94/160 (58.75%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            + + Y+RVIS  G Y D  N      II  + C+LP+  + +Y  +ME +F Y+IS LE M AE Y +V+ +    R + P L W+ + Y+ I+ RLRKN+K   IVHP+ +++  + +   FI+SKF  KI+++  LS+LS  IP + I     ++K D
Sbjct:  163 VIEPYRRVISHGGYYGDGLN-----AIIVFAACFLPDSSRADYHYVMENLFLYVISTLELMVAEDYMIVYLNGATPRRRMPGLGWMKKCYQMIDRRLRKNLKSFIIVHPSWFIRTILAVTRPFISSKFSSKIKYVNSLSELSGLIPMDCIHIPESIIKLD 317          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: BNIPL (BCL2 interacting protein like [Source:HGNC Symbol;Acc:HGNC:16976])

HSP 1 Score: 117.472 bits (293), Expect = 2.013e-28
Identity = 58/160 (36.25%), Postives = 91/160 (56.88%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            + + YK+V+S  G + D  N      +I  ++CYLP     NY  +ME++F YM+  LE + AE Y +V      +R + P LSW+ Q Y+T++ RLRKN++ L +VH T ++KA + L   FI+SKF  KI F+  L +L+  I  + +     V + D
Sbjct:  112 VIEPYKKVLSHGGYHGDGLN-----AVILFASCYLPRSSIPNYTYVMEHLFRYMVGTLELLVAENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWYVKAFLALLRPFISSKFTRKIRFLDSLGELAQLISLDQVHIPEAVRQLD 266          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: BNIPL (BCL2 interacting protein like [Source:HGNC Symbol;Acc:HGNC:16976])

HSP 1 Score: 117.472 bits (293), Expect = 2.013e-28
Identity = 58/160 (36.25%), Postives = 91/160 (56.88%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            + + YK+V+S  G + D  N      +I  ++CYLP     NY  +ME++F YM+  LE + AE Y +V      +R + P LSW+ Q Y+T++ RLRKN++ L +VH T ++KA + L   FI+SKF  KI F+  L +L+  I  + +     V + D
Sbjct:  112 VIEPYKKVLSHGGYHGDGLN-----AVILFASCYLPRSSIPNYTYVMEHLFRYMVGTLELLVAENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWYVKAFLALLRPFISSKFTRKIRFLDSLGELAQLISLDQVHIPEAVRQLD 266          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: BNIPL (BCL2 interacting protein like [Source:HGNC Symbol;Acc:HGNC:16976])

HSP 1 Score: 118.627 bits (296), Expect = 3.766e-28
Identity = 58/160 (36.25%), Postives = 91/160 (56.88%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            + + YK+V+S  G + D  N      +I  ++CYLP     NY  +ME++F YM+  LE + AE Y +V      +R + P LSW+ Q Y+T++ RLRKN++ L +VH T ++KA + L   FI+SKF  KI F+  L +L+  I  + +     V + D
Sbjct:  178 VIEPYKKVLSHGGYHGDGLN-----AVILFASCYLPRSSIPNYTYVMEHLFRYMVGTLELLVAENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWYVKAFLALLRPFISSKFTRKIRFLDSLGELAQLISLDQVHIPEAVRQLD 332          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: BNIPL (BCL2 interacting protein like [Source:HGNC Symbol;Acc:HGNC:16976])

HSP 1 Score: 118.627 bits (296), Expect = 4.905e-28
Identity = 58/160 (36.25%), Postives = 91/160 (56.88%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            + + YK+V+S  G + D  N      +I  ++CYLP     NY  +ME++F YM+  LE + AE Y +V      +R + P LSW+ Q Y+T++ RLRKN++ L +VH T ++KA + L   FI+SKF  KI F+  L +L+  I  + +     V + D
Sbjct:  194 VIEPYKKVLSHGGYHGDGLN-----AVILFASCYLPRSSIPNYTYVMEHLFRYMVGTLELLVAENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWYVKAFLALLRPFISSKFTRKIRFLDSLGELAQLISLDQVHIPEAVRQLD 348          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Celegans
Match: rga-1 (Rho GTPase Activating protein [Source:UniProtKB/TrEMBL;Acc:Q23130])

HSP 1 Score: 72.0182 bits (175), Expect = 1.079e-12
Identity = 46/165 (27.88%), Postives = 85/165 (51.52%), Query Frame = 2
Query: 2705 FQD--NDGIFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVK-APSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADV 3190
            F+D  ND    E  +VI+D         D     I+ +    LP   + ++ R+++Y    ++ I++ +  + Y +V+FH YG R    P + WL Q YK ++ R +KN+K LY+VHPT +++    L+  FI+SKF  K  ++  + +L + +    +   + +
Sbjct:   69 FEDLFNDISAHEIIQVIADG--------DRVGRPIVVVYAYRLPSSKEIDHARLLQY----LVQIIDKIVDQDYTIVYFH-YGLRSHNKPPVRWLFQAYKQLDRRFKKNLKALYVVHPTRFIRIIFSLFKGFISSKFENKFHYVMCIDELENALSVARLNLPSPI 220          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Match: CG11593 (gene:FBgn0035488 transcript:FBtr0114509)

HSP 1 Score: 114.39 bits (285), Expect = 4.150e-26
Identity = 49/160 (30.63%), Postives = 91/160 (56.88%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            + + YKRV+S  G Y      N    I+    C+LP++ + +Y  +M+ +F Y++  LE +  + Y +++ H   NR   P   WL + Y+ ++ RLRK++KH+Y+VHPT W+K+ V++   F+++KF+ K+ ++  L +L  ++  E       V + D
Sbjct:  325 VIEPYKRVLSHGG-YLKSGGQNA---IVIFCACHLPDRSRADYSYVMDNLFLYVVKTLEQLVTDDYVLIYLHGGSNRRNVPPFPWLKRCYQLLDRRLRKSLKHMYLVHPTFWIKSLVWMARPFVSTKFWRKLVYVKSLEELGMHVVVEKAAIPEKVKQYD 480          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Match: CG11593 (gene:FBgn0035488 transcript:FBtr0332982)

HSP 1 Score: 114.39 bits (285), Expect = 4.150e-26
Identity = 49/160 (30.63%), Postives = 91/160 (56.88%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            + + YKRV+S  G Y      N    I+    C+LP++ + +Y  +M+ +F Y++  LE +  + Y +++ H   NR   P   WL + Y+ ++ RLRK++KH+Y+VHPT W+K+ V++   F+++KF+ K+ ++  L +L  ++  E       V + D
Sbjct:  325 VIEPYKRVLSHGG-YLKSGGQNA---IVIFCACHLPDRSRADYSYVMDNLFLYVVKTLEQLVTDDYVLIYLHGGSNRRNVPPFPWLKRCYQLLDRRLRKSLKHMYLVHPTFWIKSLVWMARPFVSTKFWRKLVYVKSLEELGMHVVVEKAAIPEKVKQYD 480          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Match: pn (gene:FBgn0003116 transcript:FBtr0070389)

HSP 1 Score: 90.1225 bits (222), Expect = 1.294e-18
Identity = 70/267 (26.22%), Postives = 131/267 (49.06%), Query Frame = 2
Query:  131 FKAFLSEAR----QNLLNSNKPKW------------LVIGNESSDLDSVICSLVYSY-YKQSITKDKYYLIPIVSIPKKNIELKKDVIYWLNFFNINYSTDLIYLEEVFLLDNLSFYHDLIITLVDHHKPIKSVFTEFIKEVIDHREI-----SFEYLTNQLEIKNIQMVGSCSTLIASYILKTEILSQRNDLLKMLYGVILLDTDCLNPKNNRTTKVDIDTCNQIENIITMTEEERLKIYSALRNAKSDISELSFIQKMQRDVKFI 865
            F  FL++AR    ++L  ++   W            LV+GNES DLDS + ++  ++ Y Q   +  Y  +PI++IP+++  LK +V +      I     L++ +++          D+ + LVDHH    S     + E++DHR +     SF+ L    ++     VGSC+TL+A   L  E   +   + ++L+  I+LDT    P   R    D     ++E+ +   + +R  ++  L  A++DIS+L+  + +++D+K +
Sbjct:    3 FLRFLAQARGTLGRHLAEASPVAWAAAPDVSGRKLHLVMGNESCDLDSAVSAVTLAFVYAQRHREHDY--VPILNIPRRDYPLKTEVGHLFVKCGIAEPV-LLFRDDI----PREVVQDVNVILVDHHV---SPLAPNVTEILDHRPLEDSSPSFKQLPTLCQLDIDASVGSCATLVAQRYL-AEDQPRSTSVAQLLHATIVLDTINFAPAAKRYGPKDEAMVQKLESELNRKDAQRSSLFDELVAARADISKLTLTEVLRKDMKVL 258          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Match: Gdap2 (gene:FBgn0042135 transcript:FBtr0088937)

HSP 1 Score: 63.1586 bits (152), Expect = 1.070e-10
Identity = 36/152 (23.68%), Postives = 64/152 (42.11%), Query Frame = 2
Query: 2747 ISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            +S  G  +    D     +I     + P +        +E    Y+I +L+ +    Y + +FH   +    PSL WL + Y  +  + +KN+K  YIVHPT W K   + +  F+      K+  +  +  L   I  + +E  A + + D
Sbjct:   55 VSGIGCLYQSGVDRLGRPVIVFCGKWFPAQNID-----LEKALLYLIKLLDPIVKGDYVISYFHTLTSTNNYPSLHWLREVYSVLPYKYKKNLKAFYIVHPTFWTKMMTWWFTTFMAPAIKAKVHSLPGVEHLYSAITKDQLEIPAYITEYD 201          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Match: Gdap2 (gene:FBgn0042135 transcript:FBtr0088936)

HSP 1 Score: 63.5438 bits (153), Expect = 1.342e-10
Identity = 36/152 (23.68%), Postives = 64/152 (42.11%), Query Frame = 2
Query: 2747 ISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            +S  G  +    D     +I     + P +        +E    Y+I +L+ +    Y + +FH   +    PSL WL + Y  +  + +KN+K  YIVHPT W K   + +  F+      K+  +  +  L   I  + +E  A + + D
Sbjct:   82 VSGIGCLYQSGVDRLGRPVIVFCGKWFPAQNID-----LEKALLYLIKLLDPIVKGDYVISYFHTLTSTNNYPSLHWLREVYSVLPYKYKKNLKAFYIVHPTFWTKMMTWWFTTFMAPAIKAKVHSLPGVEHLYSAITKDQLEIPAYITEYD 228          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Match: bnipl (BCL2 interacting protein like [Source:ZFIN;Acc:ZDB-GENE-060503-81])

HSP 1 Score: 118.242 bits (295), Expect = 4.364e-28
Identity = 56/158 (35.44%), Postives = 95/158 (60.13%), Query Frame = 2
Query: 2705 FQDNDGIFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEF 3178
            +Q N  + + Y +V+S  G Y D S     T II  ++CYLPE   ++Y+ +M+ +F Y+I  L+ M +E Y +V+      R K P + WL Q Y +I+ RLRK++K L++VHP  +++A + +   FI+ KF  K+ FI  L +L++++P E ++ 
Sbjct:  196 YQVNMSVLEPYLQVLSHGGYYGDGS-----TAIIMFTSCYLPENTTEHYEYVMDNLFRYIIGTLDLMVSENYILVYLCGMAPRNKMPGIKWLRQCYMSIDRRLRKDLKGLFVVHPAWYVRALITVIKPFISEKFSRKMRFIHSLQELAEFVPVEQLQI 348          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Match: bnip2 (BCL2 interacting protein 2 [Source:ZFIN;Acc:ZDB-GENE-040109-6])

HSP 1 Score: 119.013 bits (297), Expect = 7.663e-28
Identity = 60/149 (40.27%), Postives = 91/149 (61.07%), Query Frame = 2
Query: 2735 YKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFA 3181
            YK+VIS  G Y D  N      II  + C++PE  + NY+ IM+ +F Y+I  LE + AE Y +V+ +   +R K PS+ WL + Y+ I+ RLRKN+K L IVHP+ +++  + L   FI+SKF  KI+F+  L+ L++ +P E    A
Sbjct:  268 YKKVISHGGYYGDGLN-----AIIVFAVCFMPESNQPNYRYIMDNLFKYVIGTLELLVAENYMIVYLNGATSRRKMPSVGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLALTKPFISSKFSQKIKFVFSLTDLAELVPMEKCSVA 411          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Match: bnip2 (BCL2 interacting protein 2 [Source:ZFIN;Acc:ZDB-GENE-040109-6])

HSP 1 Score: 117.087 bits (292), Expect = 9.459e-28
Identity = 59/146 (40.41%), Postives = 91/146 (62.33%), Query Frame = 2
Query: 2735 YKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENI 3172
            YK+VIS  G Y D  N      II  + C++PE  + NY+ IM+ +F Y+I  LE + AE Y +V+ +   +R K PS+ WL + Y+ I+ RLRKN+K L IVHP+ +++  + L   FI+SKF  KI+F+  L+ L++ +P E +
Sbjct:  186 YKKVISHGGYYGDGLN-----AIIVFAVCFMPESNQPNYRYIMDNLFKYVIGTLELLVAENYMIVYLNGATSRRKMPSVGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLALTKPFISSKFSQKIKFVFSLTDLAELVPMEYV 326          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Match: atcayb (ATCAY kinesin light chain interacting caytaxin b [Source:ZFIN;Acc:ZDB-GENE-070912-220])

HSP 1 Score: 115.546 bits (288), Expect = 1.555e-27
Identity = 57/160 (35.62%), Postives = 91/160 (56.88%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            +   Y RV++  G Y +  N      II  + CYLP+ G  +Y  IME +F Y+IS LE + AE Y +++ +    R + P +SWL + Y+ I  RLRKN+K L I HPT +++  + +   F+N KF  KI ++  L +L+  +P E+++    VL+ D
Sbjct:  146 VIRPYLRVVTHGGYYGEGLN-----AIIVFAACYLPDSGCADYNYIMENLFLYVISSLEALVAEDYMIIYLNGATPRRRMPGISWLKRCYQMIERRLRKNLKCLIIAHPTWFIRTVLAISRPFVNVKFMDKIRYVQSLQELAQIVPMEHVQIPECVLQFD 300          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Match: atcayb (ATCAY kinesin light chain interacting caytaxin b [Source:ZFIN;Acc:ZDB-GENE-070912-220])

HSP 1 Score: 115.161 bits (287), Expect = 2.485e-27
Identity = 57/160 (35.62%), Postives = 91/160 (56.88%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            +   Y RV++  G Y +  N      II  + CYLP+ G  +Y  IME +F Y+IS LE + AE Y +++ +    R + P +SWL + Y+ I  RLRKN+K L I HPT +++  + +   F+N KF  KI ++  L +L+  +P E+++    VL+ D
Sbjct:  156 VIRPYLRVVTHGGYYGEGLN-----AIIVFAACYLPDSGCADYNYIMENLFLYVISSLEALVAEDYMIIYLNGATPRRRMPGISWLKRCYQMIERRLRKNLKCLIIAHPTWFIRTVLAISRPFVNVKFMDKIRYVQSLQELAQIVPMEHVQIPECVLQFD 310          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: hook3 (hook microtubule-tethering protein 3 [Source:Xenbase;Acc:XB-GENE-6067268])

HSP 1 Score: 118.242 bits (295), Expect = 6.294e-28
Identity = 62/166 (37.35%), Postives = 97/166 (58.43%), Query Frame = 2
Query: 2735 YKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD*IECMSLYFL 3232
            YK+VIS  G Y D  N      II  + C++P+ G+ NY+ +M+ +F Y+I  LE + AE Y +V+ +    R K PSL WL + Y+ I+ RLRKN+K L IVHP+ +++  + +   FI+SKF  KI+++  L +L++ IP E +            EC+  Y+L
Sbjct:  181 YKKVISHGGYYGDGLN-----AIIVFAVCFMPDSGQPNYRYLMDNLFKYVIGTLEMLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAITKPFISSKFSQKIKYVFSLVELAELIPMEYVSIP---------ECIKEYYL 332          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: hook3 (hook microtubule-tethering protein 3 [Source:Xenbase;Acc:XB-GENE-6067268])

HSP 1 Score: 117.857 bits (294), Expect = 7.510e-28
Identity = 59/156 (37.82%), Postives = 94/156 (60.26%), Query Frame = 2
Query: 2735 YKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            YK+VIS  G Y D  N      II  + C++P+ G+ NY+ +M+ +F Y+I  LE + AE Y +V+ +    R K PSL WL + Y+ I+ RLRKN+K L IVHP+ +++  + +   FI+SKF  KI+++  L +L++ IP E +     + + D
Sbjct:  196 YKKVISHGGYYGDGLN-----AIIVFAVCFMPDSGQPNYRYLMDNLFKYVIGTLEMLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAITKPFISSKFSQKIKYVFSLVELAELIPMEYVSIPECIKEVD 346          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: hook3 (hook microtubule-tethering protein 3 [Source:Xenbase;Acc:XB-GENE-6067268])

HSP 1 Score: 117.472 bits (293), Expect = 1.352e-27
Identity = 60/160 (37.50%), Postives = 96/160 (60.00%), Query Frame = 2
Query: 2735 YKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD*IEC 3214
            YK+VIS  G Y D  N      II  + C++P+ G+ NY+ +M+ +F Y+I  LE + AE Y +V+ +    R K PSL WL + Y+ I+ RLRKN+K L IVHP+ +++  + +   FI+SKF  KI+++  L +L++ IP E +     + + D  +C
Sbjct:  196 YKKVISHGGYYGDGLN-----AIIVFAVCFMPDSGQPNYRYLMDNLFKYVIGTLEMLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAITKPFISSKFSQKIKYVFSLVELAELIPMEYVSIPECIKEYDEGKC 350          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: sdhaf4 (succinate dehydrogenase complex assembly factor 4 [Source:Xenbase;Acc:XB-GENE-1007482])

HSP 1 Score: 105.531 bits (262), Expect = 9.353e-24
Identity = 55/154 (35.71%), Postives = 86/154 (55.84%), Query Frame = 2
Query: 2735 YKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLK 3196
            Y +V++  G Y +  N      II  + C LP+    +Y  IME +F Y+IS LE + AE Y +V+ +    R + P + WL + Y+ I+ RLRKN+K L IVHP+ +++  + +   FI+ KF  K++++  L  L   IP ENI     VL+
Sbjct:  178 YMKVVTHGGYYGEGLN-----AIIVFAACCLPDSNCPDYHYIMENLFLYVISSLELLVAEDYMIVYLNGATPRRRMPGIGWLKKCYQMIDRRLRKNLKSLIIVHPSWFIRTVLAISRPFISVKFINKVQYVHSLEDLEQIIPMENIHIPDCVLQ 326          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: sdhaf4 (succinate dehydrogenase complex assembly factor 4 [Source:Xenbase;Acc:XB-GENE-1007482])

HSP 1 Score: 104.76 bits (260), Expect = 2.368e-23
Identity = 55/153 (35.95%), Postives = 85/153 (55.56%), Query Frame = 2
Query: 2735 YKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVL 3193
            Y +V++  G Y +  N      II  + C LP+    +Y  IME +F Y+IS LE + AE Y +V+ +    R + P + WL + Y+ I+ RLRKN+K L IVHP+ +++  + +   FI+ KF  K++++  L  L   IP ENI     VL
Sbjct:  178 YMKVVTHGGYYGEGLN-----AIIVFAACCLPDSNCPDYHYIMENLFLYVISSLELLVAEDYMIVYLNGATPRRRMPGIGWLKKCYQMIDRRLRKNLKSLIIVHPSWFIRTVLAISRPFISVKFINKVQYVHSLEDLEQIIPMENIHIPDCVL 325          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Prune2 (prune homolog 2 [Source:MGI Symbol;Acc:MGI:1925004])

HSP 1 Score: 125.176 bits (313), Expect = 1.022e-30
Identity = 62/160 (38.75%), Postives = 95/160 (59.38%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            + + Y+RVIS  G Y D  N      II  + C+LP+  + +Y  +ME +F Y+IS LE M AE Y +V+ +    R K P L W+ + Y+ I+ RLRKN+K   IVHP+ +++  + +   FI+SKF  KI+++T LS+LS  IP + I     ++K D
Sbjct:  133 VIEPYRRVISHGGYYGDGLN-----AIIVFAACFLPDSSRADYHYVMENLFLYVISTLELMVAEDYMIVYLNGATPRRKMPGLGWMKKCYQMIDRRLRKNLKSFIIVHPSWFIRTILAVTRPFISSKFSSKIKYVTSLSELSGLIPMDCIHIPESIIKLD 287          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Prune2 (prune homolog 2 [Source:MGI Symbol;Acc:MGI:1925004])

HSP 1 Score: 122.479 bits (306), Expect = 4.149e-30
Identity = 61/160 (38.12%), Postives = 94/160 (58.75%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            + + Y+RVIS  G Y D  N      II  + C+LP+  + +Y  +ME +F Y+IS LE M AE Y +V+ +    R K P L W+ + Y+ I+ RLRKN+K   IVHP+ +++  + +   FI+SKF  KI+++T LS+LS  IP + I     ++  D
Sbjct:  133 VIEPYRRVISHGGYYGDGLN-----AIIVFAACFLPDSSRADYHYVMENLFLYVISTLELMVAEDYMIVYLNGATPRRKMPGLGWMKKCYQMIDRRLRKNLKSFIIVHPSWFIRTILAVTRPFISSKFSSKIKYVTSLSELSGLIPMDCIHIPESIINID 287          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Bnipl (BCL2/adenovirus E1B 19kD interacting protein like [Source:MGI Symbol;Acc:MGI:2384749])

HSP 1 Score: 119.398 bits (298), Expect = 1.157e-28
Identity = 61/160 (38.12%), Postives = 91/160 (56.88%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            I + YK+V+S  G + D  N      +I  ++CYLP     NY  IME++F YM+  LE + AE Y +V      +R + P LSW+ Q Y+T++ RLRKN++ L +VH T ++KA + L   FI+SKF  KI F+  L +L+  I  E +     V + D
Sbjct:  165 IIEPYKKVLSHGGYHGDGLN-----AVILFASCYLPRSSIPNYTYIMEHLFRYMVGTLELLVAENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWYVKAFLALVRPFISSKFTRKIRFLDSLGELAQLISLEQVHIPEVVRQLD 319          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Bnipl (BCL2/adenovirus E1B 19kD interacting protein like [Source:MGI Symbol;Acc:MGI:2384749])

HSP 1 Score: 119.783 bits (299), Expect = 1.368e-28
Identity = 61/160 (38.12%), Postives = 91/160 (56.88%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            I + YK+V+S  G + D  N      +I  ++CYLP     NY  IME++F YM+  LE + AE Y +V      +R + P LSW+ Q Y+T++ RLRKN++ L +VH T ++KA + L   FI+SKF  KI F+  L +L+  I  E +     V + D
Sbjct:  193 IIEPYKKVLSHGGYHGDGLN-----AVILFASCYLPRSSIPNYTYIMEHLFRYMVGTLELLVAENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWYVKAFLALVRPFISSKFTRKIRFLDSLGELAQLISLEQVHIPEVVRQLD 347          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Bnip2 (BCL2/adenovirus E1B interacting protein 2 [Source:MGI Symbol;Acc:MGI:109327])

HSP 1 Score: 118.627 bits (296), Expect = 1.588e-28
Identity = 57/156 (36.54%), Postives = 94/156 (60.26%), Query Frame = 2
Query: 2735 YKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            YK+VIS  G Y D  N      I+  + C++PE G+ NY+ +M+ +F Y+I  LE + AE Y +++ +    R K PSL WL + Y+ I+ RLRKN+K L IVHP+ +++  + +   FI+SKF  KI ++  L++L++ +P E +     + + D
Sbjct:  150 YKKVISHGGYYGDGLN-----AIVVFAVCFMPESGQPNYRYLMDNLFKYVIGTLELLVAENYMIIYLNGATTRRKMPSLGWLRRCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVD 300          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0IHU9|PRUN2_XENTR (Protein prune homolog 2 OS=Xenopus tropicalis OX=8364 GN=Prune2 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 2.910e-29
Identity = 61/160 (38.12%), Postives = 96/160 (60.00%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            + + YK+VIS  G Y +  N      II  + C+LP+  + +Y  +ME +F Y+IS LE M AE Y VV+ +    R K P L W+ + Y+ I+ RLRKN+K   IVHP+ +++  + L   FI+SKF  KI++++ L++LS+ IP E +     ++K D
Sbjct:  127 VIEPYKKVISHGGYYGEGVN-----AIIVFAACFLPDSSRPDYNYVMENLFLYVISTLELMVAEDYMVVYLNGATPRRKMPGLGWMKKCYQMIDRRLRKNLKSFIIVHPSWFIRTILALTRPFISSKFSSKIKYVSTLAELSELIPMEYVHIPETIVKLD 281          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5BJR4|PRUN2_RAT (Protein prune homolog 2 OS=Rattus norvegicus OX=10116 GN=Prune2 PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 5.065e-29
Identity = 61/160 (38.12%), Postives = 95/160 (59.38%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            + + Y+RVIS  G Y D  N      II  + C+LP+  + +Y  +ME +F Y+IS LE M AE Y +V+ +    R K P L W+ + Y+ I+ RLRKN+K   IVHP+ +++  + +   FI+SKF  KI++++ LS+LS  IP + I     ++K D
Sbjct:  133 VIEPYRRVISHGGYYGDGLN-----AIIVFAACFLPDSSRADYHYVMENLFLYVISTLELMVAEDYMIVYLNGATPRRKMPGLGWMKKCYQMIDRRLRKNLKSFIIVHPSWFIRTILAVTRPFISSKFSSKIKYVSSLSELSGLIPMDCIHIPESIIKYD 287          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5R4Q8|PRUN2_PONAB (Protein prune homolog 2 OS=Pongo abelii OX=9601 GN=PRUNE2 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.451e-28
Identity = 60/160 (37.50%), Postives = 93/160 (58.13%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            + + Y+RVIS  G Y D  N      II  + C+LP+  + +Y  +ME +F Y+IS LE M AE Y +V+ +    R + P L W+ + Y+ I+ RLRKN+K   IVHP+ +++  +     FI+SKF  KI+++  LS+LS  IP + I     ++K D
Sbjct:  133 VIEPYRRVISHGGYYGDGLN-----AIIVFAACFLPDSSRADYHYVMENLFLYVISTLELMVAEDYMIVYLNGATPRRRMPGLGWMKKCYQMIDRRLRKNLKSFIIVHPSWFIRTILAATRPFISSKFSSKIKYVNSLSELSGLIPMDCIHIPESIIKLD 287          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99JU7|BNIPL_MOUSE (Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein OS=Mus musculus OX=10090 GN=Bnipl PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 8.092e-28
Identity = 61/160 (38.12%), Postives = 91/160 (56.88%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            I + YK+V+S  G + D  N      +I  ++CYLP     NY  IME++F YM+  LE + AE Y +V      +R + P LSW+ Q Y+T++ RLRKN++ L +VH T ++KA + L   FI+SKF  KI F+  L +L+  I  E +     V + D
Sbjct:  165 IIEPYKKVLSHGGYHGDGLN-----AVILFASCYLPRSSIPNYTYIMEHLFRYMVGTLELLVAENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWYVKAFLALVRPFISSKFTRKIRFLDSLGELAQLISLEQVHIPEVVRQLD 319          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|O54940|BNIP2_MOUSE (BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 OS=Mus musculus OX=10090 GN=Bnip2 PE=1 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 2.196e-27
Identity = 56/146 (38.36%), Postives = 91/146 (62.33%), Query Frame = 2
Query: 2735 YKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENI 3172
            YK+VIS  G Y D  N      I+  + C++PE G+ NY+ +M+ +F Y+I  LE + AE Y +++ +    R K PSL WL + Y+ I+ RLRKN+K L IVHP+ +++  + +   FI+SKF  KI ++  L++L++ +P E +
Sbjct:  150 YKKVISHGGYYGDGLN-----AIVVFAVCFMPESGQPNYRYLMDNLFKYVIGTLELLVAENYMIIYLNGATTRRKMPSLGWLRRCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYV 290          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: A0A3Q1FEQ1 (CRAL-TRIO domain-containing protein OS=Acanthochromis polyacanthus OX=80966 PE=4 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.766e-32
Identity = 66/154 (42.86%), Postives = 100/154 (64.94%), Query Frame = 2
Query: 2714 NDGIFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIE 3175
            N  + + + RV+S  G Y D  ND     II  S+CYLPE   +NYQ +M+ +F +++  LE M AE Y +V+    G + K P +SWL ++Y TI+ RLRKN+K  Y+VHPT ++KA + +   FI+SKF  K++F+  L +LSD+IPTE+++
Sbjct:  166 NMSVLEPFLRVLSHGGYYGDGMND-----IIVFSSCYLPENSLENYQYVMDNLFRFVVGTLELMVAENYVIVYLCAGGQKDKLPGISWLKEWYTTIDRRLRKNLKGFYVVHPTWYIKALITIIKPFISSKFSRKLQFVNSLQELSDFIPTEHVQ 314          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: A0A3P8SXH8 (CRAL-TRIO domain-containing protein OS=Amphiprion percula OX=161767 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 4.996e-32
Identity = 66/155 (42.58%), Postives = 100/155 (64.52%), Query Frame = 2
Query: 2714 NDGIFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEF 3178
            N  + + + RV+S  G Y D  ND     II  S+CYLPE   +NYQ +M+ +F +++  LE M AE Y +V+    G + K P +SWL ++Y TI+ RLRKN+K  Y+VHPT ++KA + +   FI+SKF  K++F+  L +LSD+IPTE+++ 
Sbjct:  295 NMSVLEPFLRVLSHGGYYGDGMND-----IIVFSSCYLPENSLENYQYVMDNLFRFVVGTLELMVAENYVIVYLCAGGQKDKLPGISWLKEWYTTIDRRLRKNLKGFYVVHPTWYIKALITIIKPFISSKFSRKLQFVNSLQELSDFIPTEHVQI 444          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: A0A4W5R369 (CRAL-TRIO domain-containing protein OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 5.173e-32
Identity = 66/155 (42.58%), Postives = 97/155 (62.58%), Query Frame = 2
Query: 2714 NDGIFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEF 3178
            N  + + Y RV+S  G Y + SND     II  S+CYLPE   +NYQ +M+ +F Y++  L+ M AE Y +V+      R K P++ WL + Y T++ RLRKN+K LYIVHPT ++KA + +   FI+SKF  K++FI  L +LS +IP E ++ 
Sbjct:  101 NMSVLEPYLRVLSHGGYYGEGSND-----IIVFSSCYLPENTMENYQHVMDNLFRYVVGTLDLMVAENYVIVYLCAMAQRDKLPTIGWLRECYTTVDRRLRKNLKGLYIVHPTWYIKALITIIKPFISSKFSRKLQFIDSLRELSQHIPIERVQI 250          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: V4ADX5 (CRAL-TRIO domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_74903 PE=4 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 8.519e-32
Identity = 62/150 (41.33%), Postives = 97/150 (64.67%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENI 3172
            + + YK+VIS  G Y +  N      +I  S CYLP+K +K+YQ +ME++F Y++  LE + AE Y +V+FH    + ++PS SWL + Y+ I+ RL+KN+K L++VHPT+WL+  V +   FI+SKF  K++F+  L  L   IP +N+
Sbjct:   34 VIEPYKKVISHGGYYGEGLN-----ALIVFSGCYLPDKRRKDYQYVMEHLFVYVVHTLEELVAEDYMIVYFHGATPKKQSPSFSWLKKCYQMIDRRLKKNLKSLFLVHPTLWLRTVVLMTKPFISSKFSSKLKFVKTLQDLGQIIPMQNL 178          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: A0A1S3PYB7 (BCL2/adenovirus E1B 19 kDa protein-interacting protein 2-like OS=Salmo salar OX=8030 GN=LOC106588343 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.363e-31
Identity = 66/155 (42.58%), Postives = 97/155 (62.58%), Query Frame = 2
Query: 2714 NDGIFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEF 3178
            N  + D + RV+S  G Y + SND     II  S+CYLPE   +NYQ +M+ +F Y++  L+ M AE Y +V+      R K P + WL + Y T++ RLRKN+K LYIVHPT ++KA + +   FI+SKF  K++FI  L +LS +IP E+++ 
Sbjct:  177 NMSVLDPFLRVLSHGGYYGEGSND-----IIVFSSCYLPENNMENYQHVMDNLFRYVVGTLDLMVAENYVIVYLCAMAQRDKLPGIGWLRECYTTVDRRLRKNLKGLYIVHPTWYIKALITIIKPFISSKFSRKLQFIDSLRELSQHIPIEHVQI 326          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: bnip2 (BCL2 interacting protein 2 [Source:NCBI gene;Acc:103043806])

HSP 1 Score: 119.013 bits (297), Expect = 8.785e-29
Identity = 60/146 (41.10%), Postives = 91/146 (62.33%), Query Frame = 2
Query: 2735 YKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENI 3172
            YKRVIS  G Y D  N      II  + C++PE  + NY+ IM+ +F Y+I  LE + AE Y +V+ +   +R K PS+ WL + Y+ I+ RLRKN+K L IVHP+ +++  + L   FI+SKF  KI F+  L++L++ +P E +
Sbjct:  148 YKRVISHGGYYGDGLN-----AIIVFAVCFMPESNQPNYRYIMDNLFKYVIGTLELLVAENYMIVYLNGATSRRKMPSVGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLTLTKPFISSKFTQKIRFVYSLTELAELVPMEYV 288          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: bnip2 (BCL2 interacting protein 2 [Source:NCBI gene;Acc:103043806])

HSP 1 Score: 121.324 bits (303), Expect = 1.802e-28
Identity = 60/147 (40.82%), Postives = 91/147 (61.90%), Query Frame = 2
Query: 2726 FDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTE 3166
             + YKRVIS  G Y D  N      II  + C++PE  + NY+ IM+ +F Y+I  LE + AE Y +V+ +   +R K PS+ WL + Y+ I+ RLRKN+K L IVHP+ +++  + L   FI+SKF  KI F+  L++L++ +P E
Sbjct:  289 IEPYKRVISHGGYYGDGLN-----AIIVFAVCFMPESNQPNYRYIMDNLFKYVIGTLELLVAENYMIVYLNGATSRRKMPSVGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLTLTKPFISSKFTQKIRFVYSLTELAELVPME 430          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: bnip2 (BCL2 interacting protein 2 [Source:NCBI gene;Acc:103043806])

HSP 1 Score: 120.939 bits (302), Expect = 2.571e-28
Identity = 60/144 (41.67%), Postives = 90/144 (62.50%), Query Frame = 2
Query: 2735 YKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTE 3166
            YKRVIS  G Y D  N      II  + C++PE  + NY+ IM+ +F Y+I  LE + AE Y +V+ +   +R K PS+ WL + Y+ I+ RLRKN+K L IVHP+ +++  + L   FI+SKF  KI F+  L++L++ +P E
Sbjct:  292 YKRVISHGGYYGDGLN-----AIIVFAVCFMPESNQPNYRYIMDNLFKYVIGTLELLVAENYMIVYLNGATSRRKMPSVGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLTLTKPFISSKFTQKIRFVYSLTELAELVPME 430          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: bnip2 (BCL2 interacting protein 2 [Source:NCBI gene;Acc:103043806])

HSP 1 Score: 120.553 bits (301), Expect = 2.932e-28
Identity = 60/144 (41.67%), Postives = 90/144 (62.50%), Query Frame = 2
Query: 2735 YKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTE 3166
            YKRVIS  G Y D  N      II  + C++PE  + NY+ IM+ +F Y+I  LE + AE Y +V+ +   +R K PS+ WL + Y+ I+ RLRKN+K L IVHP+ +++  + L   FI+SKF  KI F+  L++L++ +P E
Sbjct:  292 YKRVISHGGYYGDGLN-----AIIVFAVCFMPESNQPNYRYIMDNLFKYVIGTLELLVAENYMIVYLNGATSRRKMPSVGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLTLTKPFISSKFTQKIRFVYSLTELAELVPME 430          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: prune2 (prune homolog 2 with BCH domain [Source:NCBI gene;Acc:103043122])

HSP 1 Score: 113.235 bits (282), Expect = 9.759e-27
Identity = 56/159 (35.22%), Postives = 91/159 (57.23%), Query Frame = 2
Query: 2726 FDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
             + Y++VIS  G Y +  N      II  + C+LP+  +++Y  IME +F Y+IS LE M AE Y +V+ +      + P L WL + Y+ I+ RLRKN+K   IVHP+ +++  + +   FI+SKF  KI ++  L++L   IP + +     ++K D
Sbjct:  137 IEPYQKVISHGGYYGNGVN-----AIIVFAACFLPDSDREDYHEIMENLFLYVISTLELMVAEDYMIVYLNGATPHRRMPGLGWLKKCYQMIDRRLRKNLKSFIIVHPSWFIRTVLAITRPFISSKFSSKIRYVNSLAELEGLIPMDYVHIPESIIKLD 290          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002340.1 (pep scaffold:Pmarinus_7.0:GL481985:13400:22843:-1 gene:ENSPMAG00000002118.1 transcript:ENSPMAT00000002340.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 1.667e-10
Identity = 39/142 (27.46%), Postives = 73/142 (51.41%), Query Frame = 2
Query: 2777 SNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
              DN   K+I  S C +P   + N+ +++EY+  Y +   + +E++ Y +++FH        PS  WL   Y+  + + +KN+K LY+VHPT +++        FI+ KF  K+ +   LS+L   +    +    +V++ D
Sbjct:   30 GEDNLGRKVIIFSCCRMPPTHQLNHHKLLEYL-RYTLD--QYVESD-YTLIYFHYGLTSENKPSFQWLLNAYREFDRKYKKNLKALYVVHPTNFIRVLWSFLKPFISYKFGRKVMYFNYLSELHQQMKDPMLIIPPEVVRFD 167          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Sea Lamprey
Match: prune (prune exopolyphosphatase [Source:ZFIN;Acc:ZDB-GENE-100609-1])

HSP 1 Score: 57.7658 bits (138), Expect = 4.053e-9
Identity = 54/241 (22.41%), Postives = 108/241 (44.81%), Query Frame = 2
Query:  194 VIGNESSDLDSVICSLVYSYY--KQSITKDKYYLIPIVSIPKKNIELKKDVIYWLNFFNINYSTDLIYLEEVFLLDNLSFYHDLIITLVDHHKPIKSVFTEFIKEVIDHREISFEYLTNQLEIKNIQMVGSCSTLIASYILKTEILSQRNDLLKMLYGVILLDTDCLNPK--NNRTTKVDIDTCNQIENIITMTEEERLKIYSALRNAKSDISELSFIQKMQRDVKFIDVTWKSSNVKIAI 904
            V+GNE+ DLDS +C+L Y+++  K          IP+++I ++++ L+ DV   L    ++ +  L + +E   L  L     L +TLVDH+  +  + TE    V++   +  +  +   +      V  C TL             R  ++     +  +  DC++ +    R T  D +  +++     +        +  L  AK D+S L+  Q +++D+K +    KS ++ +A+
Sbjct:   50 VLGNEACDLDSTVCALAYAHFLAKTRPAGTHVVHIPVLNISREDLPLRPDVCRLLGSLGLSPAA-LTFRDEAS-LHTLHVRQKLTLTLVDHNL-LPHMDTELEPAVVERIVVPLQDPSINFQESRASAVVCCVTL-------------RFAVVLCAAALAAIVVDCVDMRVEAGRVTTRDREVLDELRRRFPLLPPSH-DTFITLHAAKFDVSGLTVEQTLRKDMKVL----KSGDISVAV 269          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Yeast
Match: PPX1 (Exopolyphosphatase; hydrolyzes inorganic polyphosphate (poly P) into Pi residues; located in the cytosol, plasma membrane, and mitochondrial matrix [Source:SGD;Acc:S000001244])

HSP 1 Score: 82.4185 bits (202), Expect = 6.229e-17
Identity = 91/390 (23.33%), Postives = 186/390 (47.69%), Query Frame = 2
Query:  131 FKAFLSEARQNLLNSNKPKWLVIGNESSDLDSVICSLVYSYYKQSITKDKY--------YLIPIVSIPKKNIELKKDVIYWLNFFNINYSTDLIYLEEV-FLLDNLSFYHDLIITLVDHHKPIKSV--FTEFIKEVIDHREISFEYLTNQLEIKNIQMVGSCSTLIASYILKTEILSQRN---DLLKMLYGVILLDTDCLNPKNNRTTKVDIDTC-----NQIENIITMTEEERLKIYSALRNAKSDISELSFIQKMQRDVKFIDVTWKS-SNVKIAIPTVIGND---VEDFLSMDDIACQLHQTLIDLEINVLIILTCGRDSI-KRRGYIIFAEESDLRNRISQFXXXXXXXXXXXXXXXXSCDVVAFVEDGLLTTRKLFIPLLEKCFS 1228
            F A L     + + SN    + +GNES+D+DS+  ++ YSY +    +  Y        +++PI+ IP++++ L++DV+Y L    I    +L ++E++  L  N+S   +L   LVD++   K++  + + +  +IDH     ++L  +  I  +++ GSCS+L+ +Y  + ++   R    ++  +L G IL+DT  +  K   + K+ I+ C       +  +     E+  + Y  +++ K+DI   S    +++D K  +   K    ++I + +++        +     D   Q  +   +  ++VL++LT  R +    R  +I  + + +R  I +      +LQL      +   V  F +  +  TRK  +P LE+ +S
Sbjct:   11 FLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIK-EEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRI--VKVSGSCSSLVFNYWYE-KLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERV---SDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYS 393          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Nematostella
Match: EDO34040 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQH9])

HSP 1 Score: 108.612 bits (270), Expect = 4.631e-27
Identity = 57/160 (35.62%), Postives = 96/160 (60.00%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEA--EFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLK 3196
            + + Y +VI+  G      +  +   I+ I+ CYLP K +KNY  +ME VF Y+IS LE +    EFY +V+F+    +   P+L+W+ +FY+ +   L+KN+ +++IVHP +WLK  V     F+++ F+ K++F+  LS LS+ IP E I    +V++
Sbjct:   24 LLEPYMKVITHGG-----FHCPERAVIVVIAACYLPSKAEKNYDFLMEQVFFYLISTLELLATTEEFY-IVYFNGGTTQSNMPALTWMKRFYQHVEGGLKKNMINMFIVHPNLWLKTVVRFAKAFVSTNFWCKLQFVKSLSDLSELIPIEYIYIPDEVIR 177          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Nematostella
Match: EDO38448 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCR9])

HSP 1 Score: 110.538 bits (275), Expect = 5.236e-27
Identity = 72/243 (29.63%), Postives = 134/243 (55.14%), Query Frame = 2
Query:  191 LVIGNESSDLDSVICSLVYSYYKQSITKDKYYLIPIVSIPKKNIELKKDVIYWLNFFNINYSTDLIYLEEVFLLDNLSFYHDLIITLVDHH--KPIKSVFTEFIKEVIDHREISFEYLTNQLEIKNIQMVGSCSTLIASYILKTEILSQRNDLLKMLYGVILLDTDCLNPKNNRTTKVDIDTCNQIENIITMTEEERLKIYSALRNAKSDISELSFIQKMQRDVKFIDVTWKSSNVKIAIPTV 913
            +V+GNE+ DLDS +CS+VY+++  ++  ++   +P+++IP+ +  L+ ++ Y    F IN   DL++ +E F +  L    +L +TLVDH+     +      + EVIDH +   + L   ++ K I+ VGSCSTLIA  IL  +     N +  +L   ILLD+  L+P+  R T  D      +++ +    EE   +Y ++  AK D+S L+  + +++D K + + +  +  ++ I ++
Sbjct:    4 VVLGNEACDLDSAVCSVVYAFFLHNMDGNEKIFLPVLNIPRADFPLRTEITYTFARFGINLK-DLVFTDE-FDMTALKTKGELAVTLVDHNLLARHQQGLISVLVEVIDHHK---DELAPHVK-KTIEPVGSCSTLIAEKILSNKPDLLDNQVTGLLLSAILLDSVNLDPRAGRMTPKDQHIVQALQDKVKFNLEE---LYHSVNEAKFDVSGLTSAEILRKDYKAVPL-YPGNPARVGISSI 236          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Nematostella
Match: GDAP2 (Protein GDAP2 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7T167])

HSP 1 Score: 73.9442 bits (180), Expect = 1.698e-13
Identity = 34/108 (31.48%), Postives = 60/108 (55.56%), Query Frame = 2
Query: 2879 YMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            Y IS+L+ +    Y VV+FH +      P +S+L + Y  ++ + R+N+K  YIVHPT+W +   + +  F  S    K+ F++ +  L D+I  + ++  A VL+ D
Sbjct:  375 YFISVLDRIVNRDYVVVYFHTHSTEENQPPMSFLKELYHIVDNKYRRNLKAFYIVHPTVWARIVTWFFTTFTASSVKEKVHFLSGVQYLYDWINPDQLDIPAYVLEYD 482          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000001586.2 (bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein [Source:NCBI gene;Acc:101170195])

HSP 1 Score: 131.724 bits (330), Expect = 3.449e-32
Identity = 62/160 (38.75%), Postives = 98/160 (61.25%), Query Frame = 2
Query: 2723 IFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            + + + RV+S  G + D  +D     I+  S+CYLPE   +NYQ +M+ +F +++  LE M AE Y +V+    G + K P + WL  +Y TI+ RLRKN+K  Y+VHPT ++KA + +   FI+SKF  K++F+  L +LS  IPTE+++    V + D
Sbjct:  277 VLEPFLRVLSHGGYHGDGMDD-----IVVFSSCYLPENHLENYQYVMDNLFRFVVGTLELMVAENYVIVYLCSGGQKDKLPGIGWLRDWYTTIDRRLRKNLKGFYVVHPTWYIKALITIIKPFISSKFSRKLQFVDSLQELSQLIPTEHVQIPESVRQYD 431          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Match: bnipl (bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein [Source:NCBI gene;Acc:101162655])

HSP 1 Score: 120.553 bits (301), Expect = 1.559e-29
Identity = 62/158 (39.24%), Postives = 93/158 (58.86%), Query Frame = 2
Query: 2705 FQDNDGIFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEF 3178
            F  N  + + Y +V+S  G Y D  N      II  ++CYLPE   ++Y  +ME +F Y++  L+ M +E Y +V+      R K P++ WLHQ Y +I+ RL+K++K L +VHP  ++KA + L   FI+ KF  KI FI  L KLS +IPTE ++ 
Sbjct:  134 FHVNMSVLEPYLQVLSHGGYYGDGMN-----AIILFTSCYLPENTVEDYGYVMENLFRYIVGTLDLMVSENYMLVYLCSLAPRNKLPTIKWLHQCYTSIDRRLKKDLKGLLVVHPAWYIKALLTLVKPFISDKFSKKITFIHSLQKLSQFIPTERLQI 286          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Match: bnip2 (BCL2 interacting protein 2 [Source:NCBI gene;Acc:101167204])

HSP 1 Score: 115.546 bits (288), Expect = 7.744e-28
Identity = 57/149 (38.26%), Postives = 92/149 (61.74%), Query Frame = 2
Query: 2726 FDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENI 3172
             + YKRVIS  G Y D  N      II  + C++PE  + NY+ IM+ +F Y+I  LE + AE Y +V+ +   +R K P++ WL + Y+ I+ RLRKN+K L IVHP+ +++  + +   FI+SKF  KI+++  L+ L++ +P E +
Sbjct:  130 IEPYKRVISHGGYYGDGLN-----AIIVFAVCFMPESNQPNYRSIMDNLFKYVIGTLELLVAENYMIVYLNGATSRKKMPTVGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAITKPFISSKFTQKIKYVYSLTDLAELVPMEYV 273          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Match: bnip2 (BCL2 interacting protein 2 [Source:NCBI gene;Acc:101167204])

HSP 1 Score: 118.242 bits (295), Expect = 1.675e-27
Identity = 57/147 (38.78%), Postives = 91/147 (61.90%), Query Frame = 2
Query: 2726 FDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTE 3166
             + YKRVIS  G Y D  N      II  + C++PE  + NY+ IM+ +F Y+I  LE + AE Y +V+ +   +R K P++ WL + Y+ I+ RLRKN+K L IVHP+ +++  + +   FI+SKF  KI+++  L+ L++ +P E
Sbjct:  283 IEPYKRVISHGGYYGDGLN-----AIIVFAVCFMPESNQPNYRSIMDNLFKYVIGTLELLVAENYMIVYLNGATSRKKMPTVGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAITKPFISSKFTQKIKYVYSLTDLAELVPME 424          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Match: bnip2 (BCL2 interacting protein 2 [Source:NCBI gene;Acc:101167204])

HSP 1 Score: 117.472 bits (293), Expect = 1.983e-27
Identity = 57/147 (38.78%), Postives = 91/147 (61.90%), Query Frame = 2
Query: 2726 FDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTE 3166
             + YKRVIS  G Y D  N      II  + C++PE  + NY+ IM+ +F Y+I  LE + AE Y +V+ +   +R K P++ WL + Y+ I+ RLRKN+K L IVHP+ +++  + +   FI+SKF  KI+++  L+ L++ +P E
Sbjct:  283 IEPYKRVISHGGYYGDGLN-----AIIVFAVCFMPESNQPNYRSIMDNLFKYVIGTLELLVAENYMIVYLNGATSRKKMPTVGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAITKPFISSKFTQKIKYVYSLTDLAELVPME 424          
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Match: SMESG000046620.1 (SMESG000046620.1)

HSP 1 Score: 1508.81 bits (3905), Expect = 0.000e+0
Identity = 794/796 (99.75%), Postives = 796/796 (100.00%), Query Frame = 2
Query:  116 MDKTYFKAFLSEARQNLLNSNKPKWLVIGNESSDLDSVICSLVYSYYKQSITKDKYYLIPIVSIPKKNIELKKDVIYWLNFFNINYSTDLIYLEEVFLLDNLSFYHDLIITLVDHHKPIKSVFTEFIKEVIDHREISFEYLTNQLEIKNIQMVGSCSTLIASYILKTEILSQRNDLLKMLYGVILLDTDCLNPKNNRTTKVDIDTCNQIENIITMTEEERLKIYSALRNAKSDISELSFIQKMQRDVKFIDVTWKSSNVKIAIPTVIGNDVEDFLSMDDIACQLHQTLIDLEINVLIILTCGRDSIKRRGYIIFAEESDLRNRISQFXXXXXXXXXXXXXXXXSCDVVAFVEDGLLTTRKLFIPLLEKCFSQESDGQCHFQSNNCNIYLYLDEIDSICEEIEQEGGPYTLSTPKRSCSGSPDSRNSDMNLPSLNNRRTLALIDQKRQKHXXXXXXXXXXXXXXXKNFGDDESPLAYTPXXXXXXXXXXXKDIISSTQIINPISVNEHTFNLKSTENKENSLKIAESDNLFIIKKGTFNNKGNQFSKLQKPDKWNKDLDSLSTEVDKKRQKLETSHFDSIVKAIATDISKSENMIKTENIYKKVLSNWSDSYSEEEKCQFIRDIETDDKLNMAKLLTTGIIRDCISEFDVMSIMSNIERNNSAITNDIDDNKPSKINYFNENEDETSEDSLPDSTIPDLEINYNSCPVDTIINKDCQGISNIGNQSGFNVENSSFNLYRRISKNQLDFTEDEKKLFANAGNWYPEEDVIYSDSEEPYQRPDSESAIKVPKKIIYPNK 2503
            MDKTYFKAFLSEARQNLLNSNKPKWLVIGNESSDLDSVICSLVYSYYKQSITKDKYYLIPIVSIPKKNIELKKDVIYWLNFFNINYSTDLIYLEEVFLLDNLSFYHDLIITLVDHHKPIKSVFTEFIKEVIDHREISFEYLTNQLEIKNIQMVGSCSTLIASYILKTEILSQRNDLLKMLYGVILLDTDCLNPKNNRTT+VDIDTCNQIENIITMTEEERLKIYSALRNAKSDISELSFIQKMQRDVKFIDVTWKSSNVKIAIPTVIGNDV+DFLSMDDIACQLHQTLIDLEINVLIILTCGRDSIKRRGYIIFAEESDLRNRISQFLIKETQLQLTQIQIEISCDVVAFVEDGLLTTRKLFIPLLEKCFSQESDGQCHFQSNNCNIYLYLDEIDSICEEIEQEGGPYTLSTPKRSCSGSPDSRNSDMNLPSLNNRRTLALIDQKRQKHIAEIEVIEDENEDNIKNFGDDESPLAYTPENSDEEENDSEKDIISSTQIINPISVNEHTFNLKSTENKENSLKIAESDNLFIIKKGTFNNKGNQFSKLQKPDKWNKDLDSLSTEVDKKRQKLETSHFDSIVKAIATDISKSENMIKTENIYKKVLSNWSDSYSEEEKCQFIRDIETDDKLNMAKLLTTGIIRDCISEFDVMSIMSNIERNNSAITNDIDDNKPSKINYFNENEDETSEDSLPDSTIPDLEINYNSCPVDTIINKDCQGISNIGNQSGFNVENSSFNLYRRISKNQLDFTEDEKKLFANAGNWYPEEDVIYSDSEEPYQRPDSESAIKVPKKIIYPNK
Sbjct:    1 MDKTYFKAFLSEARQNLLNSNKPKWLVIGNESSDLDSVICSLVYSYYKQSITKDKYYLIPIVSIPKKNIELKKDVIYWLNFFNINYSTDLIYLEEVFLLDNLSFYHDLIITLVDHHKPIKSVFTEFIKEVIDHREISFEYLTNQLEIKNIQMVGSCSTLIASYILKTEILSQRNDLLKMLYGVILLDTDCLNPKNNRTTQVDIDTCNQIENIITMTEEERLKIYSALRNAKSDISELSFIQKMQRDVKFIDVTWKSSNVKIAIPTVIGNDVQDFLSMDDIACQLHQTLIDLEINVLIILTCGRDSIKRRGYIIFAEESDLRNRISQFLIKETQLQLTQIQIEISCDVVAFVEDGLLTTRKLFIPLLEKCFSQESDGQCHFQSNNCNIYLYLDEIDSICEEIEQEGGPYTLSTPKRSCSGSPDSRNSDMNLPSLNNRRTLALIDQKRQKHIAEIEVIEDENEDNIKNFGDDESPLAYTPENSDEEENDSEKDIISSTQIINPISVNEHTFNLKSTENKENSLKIAESDNLFIIKKGTFNNKGNQFSKLQKPDKWNKDLDSLSTEVDKKRQKLETSHFDSIVKAIATDISKSENMIKTENIYKKVLSNWSDSYSEEEKCQFIRDIETDDKLNMAKLLTTGIIRDCISEFDVMSIMSNIERNNSAITNDIDDNKPSKINYFNENEDETSEDSLPDSTIPDLEINYNSCPVDTIINKDCQGISNIGNQSGFNVENSSFNLYRRISKNQLDFTEDEKKLFANAGNWYPEEDVIYSDSEEPYQRPDSESAIKVPKKIIYPNK 796          
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Match: SMESG000046620.1 (SMESG000046620.1)

HSP 1 Score: 1503.8 bits (3892), Expect = 0.000e+0
Identity = 794/797 (99.62%), Postives = 796/797 (99.87%), Query Frame = 2
Query:  116 MDKTYFKAFLSEARQNLLNSNKPKWLVIGNESSDLDSVICSLVYSYYKQSITKDKYYLIPIVSIPKKNIELKKDVIYWLNFFNINYSTDLIYLEEVFLLDNLSFYHDLIITLVDHHKPIKSVFTEFIKEVIDHREISFEYLTNQLEIKNIQMVGSCSTLIASYILKTEILSQRNDLLKMLYGVILLDTDCLNPKNNRTTKVDIDTCNQIENIITMTEEERLKIYSALRNAKSDISELSFIQKMQRDVKFIDVTWKSSNVKIAIPTVIGNDVEDFLSMDDIACQLHQTLIDLEINVLIILTCGRDSIKRRGYIIFAEESDLRNRISQFXXXXXXXXXXXXXXXXSCDVVAFVEDGLLTTRKLFIPLLEKCFSQESDGQCHFQSNNCNIYLYLDEIDSICEEIEQEGGPYTLSTPKRSCSGSPDSRNSDMNLPSLNNRRTLALIDQKRQKHXXXXXXXXXXXXXXXKNFGDDESPLAYTPXXXXXXXXXXXKDIISSTQIINPISVNEHTFNLKSTENKENSLKIAESDNLFIIKKGTFNNKGNQFSKLQKPDKWNKDLDSLSTEVDKKRQKLETSHFDSIVKAIATDISKSENMIKTENIYKKVLSNWSDSYSEEEKCQFIRDIETDDKLNMAKLLTTGIIRDCISEFDVMSIMSNIERNNSAITNDIDDNKPSKINYFNENEDETSEDSLPDSTIPDLEINYNSCPVDTIINKDCQGISNIGNQSGFNVENSSFNLYRRISKNQLDFTEDEKKLFANAGNWYPEEDVIYSDSE-EPYQRPDSESAIKVPKKIIYPNK 2503
            MDKTYFKAFLSEARQNLLNSNKPKWLVIGNESSDLDSVICSLVYSYYKQSITKDKYYLIPIVSIPKKNIELKKDVIYWLNFFNINYSTDLIYLEEVFLLDNLSFYHDLIITLVDHHKPIKSVFTEFIKEVIDHREISFEYLTNQLEIKNIQMVGSCSTLIASYILKTEILSQRNDLLKMLYGVILLDTDCLNPKNNRTT+VDIDTCNQIENIITMTEEERLKIYSALRNAKSDISELSFIQKMQRDVKFIDVTWKSSNVKIAIPTVIGNDV+DFLSMDDIACQLHQTLIDLEINVLIILTCGRDSIKRRGYIIFAEESDLRNRISQFLIKETQLQLTQIQIEISCDVVAFVEDGLLTTRKLFIPLLEKCFSQESDGQCHFQSNNCNIYLYLDEIDSICEEIEQEGGPYTLSTPKRSCSGSPDSRNSDMNLPSLNNRRTLALIDQKRQKHIAEIEVIEDENEDNIKNFGDDESPLAYTPENSDEEENDSEKDIISSTQIINPISVNEHTFNLKSTENKENSLKIAESDNLFIIKKGTFNNKGNQFSKLQKPDKWNKDLDSLSTEVDKKRQKLETSHFDSIVKAIATDISKSENMIKTENIYKKVLSNWSDSYSEEEKCQFIRDIETDDKLNMAKLLTTGIIRDCISEFDVMSIMSNIERNNSAITNDIDDNKPSKINYFNENEDETSEDSLPDSTIPDLEINYNSCPVDTIINKDCQGISNIGNQSGFNVENSSFNLYRRISKNQLDFTEDEKKLFANAGNWYPEEDVIYSDSE EPYQRPDSESAIKVPKKIIYPNK
Sbjct:    1 MDKTYFKAFLSEARQNLLNSNKPKWLVIGNESSDLDSVICSLVYSYYKQSITKDKYYLIPIVSIPKKNIELKKDVIYWLNFFNINYSTDLIYLEEVFLLDNLSFYHDLIITLVDHHKPIKSVFTEFIKEVIDHREISFEYLTNQLEIKNIQMVGSCSTLIASYILKTEILSQRNDLLKMLYGVILLDTDCLNPKNNRTTQVDIDTCNQIENIITMTEEERLKIYSALRNAKSDISELSFIQKMQRDVKFIDVTWKSSNVKIAIPTVIGNDVQDFLSMDDIACQLHQTLIDLEINVLIILTCGRDSIKRRGYIIFAEESDLRNRISQFLIKETQLQLTQIQIEISCDVVAFVEDGLLTTRKLFIPLLEKCFSQESDGQCHFQSNNCNIYLYLDEIDSICEEIEQEGGPYTLSTPKRSCSGSPDSRNSDMNLPSLNNRRTLALIDQKRQKHIAEIEVIEDENEDNIKNFGDDESPLAYTPENSDEEENDSEKDIISSTQIINPISVNEHTFNLKSTENKENSLKIAESDNLFIIKKGTFNNKGNQFSKLQKPDKWNKDLDSLSTEVDKKRQKLETSHFDSIVKAIATDISKSENMIKTENIYKKVLSNWSDSYSEEEKCQFIRDIETDDKLNMAKLLTTGIIRDCISEFDVMSIMSNIERNNSAITNDIDDNKPSKINYFNENEDETSEDSLPDSTIPDLEINYNSCPVDTIINKDCQGISNIGNQSGFNVENSSFNLYRRISKNQLDFTEDEKKLFANAGNWYPEEDVIYSDSEQEPYQRPDSESAIKVPKKIIYPNK 797          
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Match: SMESG000046620.1 (SMESG000046620.1)

HSP 1 Score: 1463.74 bits (3788), Expect = 0.000e+0
Identity = 778/797 (97.62%), Postives = 781/797 (97.99%), Query Frame = 2
Query:  116 MDKTYFKAFLSEARQNLLNSNKPKWLVIGNESSDLDSVICSLVYSYYKQSITKDKYYLIPIVSIPKKNIELKKDVIYWLNFFNINYSTDLIYLEEVFLLDNLSFYHDLIITLVDHHKPIKSVFTEFIKEVIDHREISFEYLTNQLEIKNIQMVGSCSTLIASYILKTEILSQRNDLLKMLYGVILLDTDCLNPKNNRTTKVDIDTCNQIENIITMTEEERLKIYSALRNAKSDISELSFIQKMQRDVKFIDVTWKSSNVKIAIPTVIGNDVEDFLSMDDIACQLHQTLIDLEINVLIILTCGRDSIKRRGYIIFAEESDLRNRISQFXXXXXXXXXXXXXXXXSCDVVAFVEDGLLTTRKLFIPLLEKCFSQESDGQCHFQSNNCNIYLYLDEIDSICEEIEQEGGPYTLSTPKRSCSGSPDSRNSDMNLPSLNNRRTLALIDQKRQKHXXXXXXXXXXXXXXXKNFGDDESPLAYTPXXXXXXXXXXXKDIISSTQIINPISVNEHTFNLKSTENKENSLKIAESDNLFIIKKGTFNNKGNQFSKLQKPDKWNKDLDSLSTEVDKKRQKLETSHFDSIVKAIATDISKSENMIKTENIYKKVLSNWSDSYSEEEKCQFIRDIETDDKLNMAKLLTTGIIRDCISEFDVMSIMSNIERNNSAITNDIDDNKPSKINYFNENEDETSEDSLPDSTIPDLEINYNSCPVDTIINKDCQGISNIGNQSGFNVENSSFNLYRRISKNQLDFTEDEKKLFANAGNWYPEEDVIYSDSE-EPYQRPDSESAIKVPKKIIYPNK 2503
            MDKTYFKAFLSEARQNLLNSNKPKWLVIGNESSDLDSVICSLVYSYYKQSITKDKYYLIPIVSIPKKNIELKKDVIYWLNFFNINYSTDLIYLEEVFLLDNLSFYHDLIITLVDHHKPIKSVFTEFIKEVIDHREISFEYLTNQLEIKNIQMVGSCSTLIASYILKTEILSQRNDLLKMLYGVILLDTDCLNPKNNRTT+VDIDTCNQIENIITMTEEERLKIYSALRNAKSDISELSFIQKMQRDVKFIDVTWKSSNVKIAIPTVIGNDV+DFLSMDDIACQLHQTLIDLEINVLIILTCGRDSIKRRGYIIFAEESDLRNRISQFLIKETQLQLTQIQIEISCDVVAFVEDGLLTTRKLFIPLLEKCFSQESDGQCHFQSNNCNIYLYLDEIDSICEEIEQEGGPYTLSTPKRSCSGSPDSRNSDMNLPSLNNRRTLALIDQKRQKHIAEIEVIEDENEDNIKNFGDDESPLAYTPENSDEEENDSEKDIISSTQIINPISVNEHTFNLKSTENKENSLKIAESDNLFIIKKGTFNNKGNQFSKLQKPDKWNKDLDSLSTEVDKKRQKLETSHFDSIVKAIATDISKSENMIKTENIYKKVLSNWSDSYSEEEKCQFIRDIETDDKLNMAKLLTTGIIRDCISEFDVMSIMSNIERNNSAITNDIDDNKP               +SLPDSTIPDLEINYNSCPVDTIINKDCQGISNIGNQSGFNVENSSFNLYRRISKNQLDFTEDEKKLFANAGNWYPEEDVIYSDSE EPYQRPDSESAIKVPKKIIYPNK
Sbjct:    1 MDKTYFKAFLSEARQNLLNSNKPKWLVIGNESSDLDSVICSLVYSYYKQSITKDKYYLIPIVSIPKKNIELKKDVIYWLNFFNINYSTDLIYLEEVFLLDNLSFYHDLIITLVDHHKPIKSVFTEFIKEVIDHREISFEYLTNQLEIKNIQMVGSCSTLIASYILKTEILSQRNDLLKMLYGVILLDTDCLNPKNNRTTQVDIDTCNQIENIITMTEEERLKIYSALRNAKSDISELSFIQKMQRDVKFIDVTWKSSNVKIAIPTVIGNDVQDFLSMDDIACQLHQTLIDLEINVLIILTCGRDSIKRRGYIIFAEESDLRNRISQFLIKETQLQLTQIQIEISCDVVAFVEDGLLTTRKLFIPLLEKCFSQESDGQCHFQSNNCNIYLYLDEIDSICEEIEQEGGPYTLSTPKRSCSGSPDSRNSDMNLPSLNNRRTLALIDQKRQKHIAEIEVIEDENEDNIKNFGDDESPLAYTPENSDEEENDSEKDIISSTQIINPISVNEHTFNLKSTENKENSLKIAESDNLFIIKKGTFNNKGNQFSKLQKPDKWNKDLDSLSTEVDKKRQKLETSHFDSIVKAIATDISKSENMIKTENIYKKVLSNWSDSYSEEEKCQFIRDIETDDKLNMAKLLTTGIIRDCISEFDVMSIMSNIERNNSAITNDIDDNKP---------------NSLPDSTIPDLEINYNSCPVDTIINKDCQGISNIGNQSGFNVENSSFNLYRRISKNQLDFTEDEKKLFANAGNWYPEEDVIYSDSEQEPYQRPDSESAIKVPKKIIYPNK 782          
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Match: SMESG000046622.1 (SMESG000046622.1)

HSP 1 Score: 359.377 bits (921), Expect = 3.691e-117
Identity = 176/195 (90.26%), Postives = 178/195 (91.28%), Query Frame = 2
Query: 2618 MDKNDNFRLDGFGFNVELKSLLDTTEIILFQDNDGIFDEYKRVISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 3202
            MDKNDNFRLDG GFNVELKSLLDTTEIILFQDNDGIFDEYKR                ETKIITISNCYLPEKGKKNYQRIM+YVFNYMISILENM+AEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD
Sbjct:    1 MDKNDNFRLDGLGFNVELKSLLDTTEIILFQDNDGIFDEYKR----------------ETKIITISNCYLPEKGKKNYQRIMQYVFNYMISILENMDAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDYIPTENIEFAADVLKCD 179          
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Match: SMESG000032128.1 (SMESG000032128.1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.086e-14
Identity = 45/136 (33.09%), Postives = 73/136 (53.68%), Query Frame = 2
Query: 2747 ISDAGNYFDKSNDNKETKIITISNCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAPSLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGKIEFITQLSKLSDY 3154
            IS  G      +D    K+I  S C LP   + N+QR++EY+       LE      YA+V+FH   +    PS+ W+ Q YK  +   +KN+K L++VHP+ ++K    L+   I++KF  K+ ++ QL +L D+
Sbjct:   99 ISRLGILQVAGDDKLGRKVIVFSACRLPFIEQINHQRLLEYI----KKTLEQYVTNDYALVYFHYGFSSRNKPSMKWMLQAYKDFDRNFKKNLKALHLVHPSGFIKFMWNLFRPVISAKFGRKVMYVNQLMELDDH 230          
The following BLAST results are available for this feature:
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRUNE22.542e-2937.50prune homolog 2 with BCH domain [Source:HGNC Symbo... [more]
BNIPL2.013e-2836.25BCL2 interacting protein like [Source:HGNC Symbol;... [more]
BNIPL2.013e-2836.25BCL2 interacting protein like [Source:HGNC Symbol;... [more]
BNIPL3.766e-2836.25BCL2 interacting protein like [Source:HGNC Symbol;... [more]
BNIPL4.905e-2836.25BCL2 interacting protein like [Source:HGNC Symbol;... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rga-11.079e-1227.88Rho GTPase Activating protein [Source:UniProtKB/T... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG115934.150e-2630.63gene:FBgn0035488 transcript:FBtr0114509[more]
CG115934.150e-2630.63gene:FBgn0035488 transcript:FBtr0332982[more]
pn1.294e-1826.22gene:FBgn0003116 transcript:FBtr0070389[more]
Gdap21.070e-1023.68gene:FBgn0042135 transcript:FBtr0088937[more]
Gdap21.342e-1023.68gene:FBgn0042135 transcript:FBtr0088936[more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bnipl4.364e-2835.44BCL2 interacting protein like [Source:ZFIN;Acc:ZDB... [more]
bnip27.663e-2840.27BCL2 interacting protein 2 [Source:ZFIN;Acc:ZDB-GE... [more]
bnip29.459e-2840.41BCL2 interacting protein 2 [Source:ZFIN;Acc:ZDB-GE... [more]
atcayb1.555e-2735.63ATCAY kinesin light chain interacting caytaxin b [... [more]
atcayb2.485e-2735.63ATCAY kinesin light chain interacting caytaxin b [... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hook36.294e-2837.35hook microtubule-tethering protein 3 [Source:Xenba... [more]
hook37.510e-2837.82hook microtubule-tethering protein 3 [Source:Xenba... [more]
hook31.352e-2737.50hook microtubule-tethering protein 3 [Source:Xenba... [more]
sdhaf49.353e-2435.71succinate dehydrogenase complex assembly factor 4 ... [more]
sdhaf42.368e-2335.95succinate dehydrogenase complex assembly factor 4 ... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prune21.022e-3038.75prune homolog 2 [Source:MGI Symbol;Acc:MGI:1925004... [more]
Prune24.149e-3038.13prune homolog 2 [Source:MGI Symbol;Acc:MGI:1925004... [more]
Bnipl1.157e-2838.13BCL2/adenovirus E1B 19kD interacting protein like ... [more]
Bnipl1.368e-2838.13BCL2/adenovirus E1B 19kD interacting protein like ... [more]
Bnip21.588e-2836.54BCL2/adenovirus E1B interacting protein 2 [Source:... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0IHU9|PRUN2_XENTR2.910e-2938.13Protein prune homolog 2 OS=Xenopus tropicalis OX=8... [more]
sp|Q5BJR4|PRUN2_RAT5.065e-2938.13Protein prune homolog 2 OS=Rattus norvegicus OX=10... [more]
sp|Q5R4Q8|PRUN2_PONAB1.451e-2837.50Protein prune homolog 2 OS=Pongo abelii OX=9601 GN... [more]
sp|Q99JU7|BNIPL_MOUSE8.092e-2838.13Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-... [more]
sp|O54940|BNIP2_MOUSE2.196e-2738.36BCL2/adenovirus E1B 19 kDa protein-interacting pro... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q1FEQ11.766e-3242.86CRAL-TRIO domain-containing protein OS=Acanthochro... [more]
A0A3P8SXH84.996e-3242.58CRAL-TRIO domain-containing protein OS=Amphiprion ... [more]
A0A4W5R3695.173e-3242.58CRAL-TRIO domain-containing protein OS=Hucho hucho... [more]
V4ADX58.519e-3241.33CRAL-TRIO domain-containing protein (Fragment) OS=... [more]
A0A1S3PYB71.363e-3142.58BCL2/adenovirus E1B 19 kDa protein-interacting pro... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bnip28.785e-2941.10BCL2 interacting protein 2 [Source:NCBI gene;Acc:1... [more]
bnip21.802e-2840.82BCL2 interacting protein 2 [Source:NCBI gene;Acc:1... [more]
bnip22.571e-2841.67BCL2 interacting protein 2 [Source:NCBI gene;Acc:1... [more]
bnip22.932e-2841.67BCL2 interacting protein 2 [Source:NCBI gene;Acc:1... [more]
prune29.759e-2735.22prune homolog 2 with BCH domain [Source:NCBI gene;... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000002340.11.667e-1027.46pep scaffold:Pmarinus_7.0:GL481985:13400:22843:-1 ... [more]
prune4.053e-922.41prune exopolyphosphatase [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PPX16.229e-1723.33Exopolyphosphatase; hydrolyzes inorganic polyphosp... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO340404.631e-2735.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384485.236e-2729.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
GDAP21.698e-1331.48Protein GDAP2 homolog [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000001586.23.449e-3238.75bcl-2/adenovirus E1B 19 kDa-interacting protein 2-... [more]
bnipl1.559e-2939.24bcl-2/adenovirus E1B 19 kDa-interacting protein 2-... [more]
bnip27.744e-2838.26BCL2 interacting protein 2 [Source:NCBI gene;Acc:1... [more]
bnip21.675e-2738.78BCL2 interacting protein 2 [Source:NCBI gene;Acc:1... [more]
bnip21.983e-2738.78BCL2 interacting protein 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046620.10.000e+099.75SMESG000046620.1[more]
SMESG000046620.10.000e+099.62SMESG000046620.1[more]
SMESG000046620.10.000e+097.62SMESG000046620.1[more]
SMESG000046622.13.691e-11790.26SMESG000046622.1[more]
SMESG000032128.13.086e-1433.09SMESG000032128.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034563 ID=SMED30034563|Name=CRAL-TRIO domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3310bp
GCTTACTATATTTTAACTTTTATTGCAAAATTTTAACTACTCTTGTAAAA
TATCTAATGGTTTAGAAGTTCTATTTACTTTGCTTTATTTATGTCATATT
TAAAATTCATGTGTAATGGATAAAACTTATTTCAAAGCTTTTTTATCAGA
AGCTAGACAGAATTTACTGAACTCGAATAAACCTAAATGGCTTGTTATAG
GCAATGAATCGTCTGATTTAGACAGTGTTATTTGCAGCTTAGTCTATAGT
TATTATAAGCAATCAATAACAAAAGATAAATATTATTTAATTCCCATTGT
GTCAATTCCTAAAAAAAATATAGAATTGAAAAAAGATGTTATTTACTGGC
TGAATTTTTTTAACATTAATTATTCAACGGACCTTATTTATTTGGAAGAA
GTATTTTTATTGGATAATCTTTCATTTTATCATGATCTTATAATAACTCT
TGTTGATCATCATAAACCGATAAAAAGCGTTTTCACAGAGTTCATTAAAG
AGGTCATTGATCATCGTGAAATTAGTTTTGAATATTTAACAAATCAGCTG
GAAATTAAAAACATTCAAATGGTTGGCTCGTGTAGCACTTTAATTGCCTC
ATACATTTTGAAAACCGAAATATTATCACAAAGAAATGATTTATTGAAAA
TGCTATATGGCGTAATTCTCTTGGATACTGACTGTTTAAATCCTAAAAAT
AATAGAACTACCAAAGTTGACATAGATACCTGCAATCAAATTGAAAATAT
TATTACAATGACTGAAGAAGAGAGATTGAAAATCTATTCAGCTTTAAGAA
ATGCAAAATCCGATATTTCTGAACTATCTTTTATTCAAAAAATGCAAAGA
GATGTAAAATTTATTGATGTTACTTGGAAAAGCTCAAATGTCAAAATCGC
AATCCCAACTGTAATAGGAAACGATGTAGAAGATTTCTTGTCCATGGATG
ACATTGCATGTCAGTTACATCAAACATTAATAGATTTAGAAATAAACGTA
CTGATCATTTTAACATGTGGTAGAGATTCAATAAAACGACGAGGATATAT
CATCTTTGCGGAAGAATCAGATTTACGAAATAGAATATCACAATTTTTAA
TCAAAGAAACCCAATTGCAATTAACACAAATCCAAATTGAAATATCTTGT
GATGTTGTAGCTTTTGTAGAAGATGGTCTACTTACTACAAGGAAACTATT
TATACCATTATTAGAAAAATGTTTTTCCCAAGAGTCAGATGGCCAATGTC
ATTTCCAATCGAACAATTGCAATATTTATCTGTATCTTGATGAAATTGAT
TCTATTTGTGAAGAAATTGAACAAGAAGGTGGTCCGTACACTTTAAGCAC
TCCAAAGCGTAGCTGTTCTGGTTCTCCAGATTCAAGAAATTCTGATATGA
ATTTGCCAAGTTTAAATAATCGACGTACTTTGGCGTTGATTGATCAAAAG
CGTCAGAAGCACATTGCAGAAATTGAAGTTATAGAAGATGAAAATGAAGA
TAATATCAAAAATTTTGGAGACGATGAATCTCCGTTAGCATACACTCCTG
AAAATAGTGACGAAGAAGAAAATGATTCAGAAAAAGACATTATTTCTTCT
ACTCAAATAATTAACCCGATATCAGTAAATGAACATACATTTAATTTGAA
GTCGACTGAAAACAAAGAAAATTCTTTGAAAATAGCAGAAAGCGATAATT
TGTTTATCATTAAAAAAGGCACGTTTAACAATAAAGGAAACCAATTTTCT
AAACTTCAAAAGCCTGATAAATGGAACAAAGATTTAGATTCTCTTTCAAC
TGAGGTAGACAAAAAGCGACAAAAGCTTGAAACAAGTCATTTTGATTCAA
TTGTCAAAGCAATTGCCACAGATATATCGAAATCAGAAAACATGATTAAA
ACCGAAAATATTTATAAAAAAGTTCTTAGTAATTGGTCGGATTCTTATTC
TGAAGAAGAGAAATGTCAATTCATTAGAGATATTGAAACAGATGATAAAT
TAAATATGGCGAAACTATTGACAACTGGAATTATTCGAGATTGCATTTCA
GAGTTCGATGTGATGTCTATAATGTCTAATATTGAAAGAAACAATAGTGC
TATTACCAATGATATTGACGATAATAAACCAAGTAAAATCAATTATTTCA
ATGAGAATGAAGACGAAACATCTGAAGATTCATTACCAGATTCCACAATT
CCAGATTTAGAAATAAATTACAATAGTTGCCCCGTCGATACAATAATTAA
TAAAGATTGTCAAGGAATTTCCAATATTGGAAATCAATCCGGATTTAATG
TCGAAAACAGTAGTTTCAATTTGTACAGAAGAATTTCTAAAAATCAATTG
GATTTTACTGAAGACGAGAAAAAGTTGTTCGCGAATGCTGGAAATTGGTA
TCCCGAGGAAGATGTCATTTATTCGGATAGTGAGGAACCTTATCAAAGAC
CCGACAGTGAATCAGCGATCAAAGTGCCAAAAAAAATCATTTACCCAAAT
AAAGACATGACCATGAATTTGACAAATTTAGATACAAACACCAGTACAGA
AATTTCTTTAAATGATTTTGATTTTATCCCAAGCCCTGATATAAAACTCA
TCGTTGATAATGATTATATGGACAAAAATGACAACTTTCGATTGGATGGT
TTCGGATTTAATGTTGAATTGAAAAGTTTACTGGATACTACTGAAATAAT
TCTATTTCAAGATAATGATGGGATTTTTGACGAATATAAGAGAGTAATTT
CTGATGCTGGAAATTATTTTGATAAGTCAAATGATAATAAGGAAACAAAA
ATCATCACAATTTCTAATTGTTATTTACCGGAAAAGGGCAAAAAAAACTA
CCAAAGAATAATGGAATATGTTTTTAATTATATGATATCAATTCTGGAGA
ATATGGAAGCAGAATTCTATGCGGTAGTTTTCTTTCATTGTTACGGAAAT
AGAGTCAAAGCTCCATCACTTAGTTGGCTTCATCAATTTTATAAAACAAT
TAATTGCAGATTAAGAAAGAATGTGAAACATTTATACATTGTCCACCCGA
CAATTTGGTTGAAAGCCGCTGTGTTTCTGTATCATATTTTCATTAACTCG
AAATTTTACGGGAAAATTGAATTTATTACACAATTATCTAAACTCTCAGA
TTATATCCCTACGGAGAATATCGAGTTTGCAGCTGATGTATTAAAGTGTG
ACTAAATCGAATGTATGTCTTTATATTTTCTGCTAATTTTTATTGATATA
TATTTTAATTTCATACATAATGCAATGTGAAGCAGAAATTCAATTTGTCT
TTCATCGGCC
back to top

protein sequence of SMED30034563-orf-1

>SMED30034563-orf-1 ID=SMED30034563-orf-1|Name=SMED30034563-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1030bp
MDKTYFKAFLSEARQNLLNSNKPKWLVIGNESSDLDSVICSLVYSYYKQS
ITKDKYYLIPIVSIPKKNIELKKDVIYWLNFFNINYSTDLIYLEEVFLLD
NLSFYHDLIITLVDHHKPIKSVFTEFIKEVIDHREISFEYLTNQLEIKNI
QMVGSCSTLIASYILKTEILSQRNDLLKMLYGVILLDTDCLNPKNNRTTK
VDIDTCNQIENIITMTEEERLKIYSALRNAKSDISELSFIQKMQRDVKFI
DVTWKSSNVKIAIPTVIGNDVEDFLSMDDIACQLHQTLIDLEINVLIILT
CGRDSIKRRGYIIFAEESDLRNRISQFLIKETQLQLTQIQIEISCDVVAF
VEDGLLTTRKLFIPLLEKCFSQESDGQCHFQSNNCNIYLYLDEIDSICEE
IEQEGGPYTLSTPKRSCSGSPDSRNSDMNLPSLNNRRTLALIDQKRQKHI
AEIEVIEDENEDNIKNFGDDESPLAYTPENSDEEENDSEKDIISSTQIIN
PISVNEHTFNLKSTENKENSLKIAESDNLFIIKKGTFNNKGNQFSKLQKP
DKWNKDLDSLSTEVDKKRQKLETSHFDSIVKAIATDISKSENMIKTENIY
KKVLSNWSDSYSEEEKCQFIRDIETDDKLNMAKLLTTGIIRDCISEFDVM
SIMSNIERNNSAITNDIDDNKPSKINYFNENEDETSEDSLPDSTIPDLEI
NYNSCPVDTIINKDCQGISNIGNQSGFNVENSSFNLYRRISKNQLDFTED
EKKLFANAGNWYPEEDVIYSDSEEPYQRPDSESAIKVPKKIIYPNKDMTM
NLTNLDTNTSTEISLNDFDFIPSPDIKLIVDNDYMDKNDNFRLDGFGFNV
ELKSLLDTTEIILFQDNDGIFDEYKRVISDAGNYFDKSNDNKETKIITIS
NCYLPEKGKKNYQRIMEYVFNYMISILENMEAEFYAVVFFHCYGNRVKAP
SLSWLHQFYKTINCRLRKNVKHLYIVHPTIWLKAAVFLYHIFINSKFYGK
IEFITQLSKLSDYIPTENIEFAADVLKCD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036865CRAL-TRIO_dom_sf
IPR038763DHH_sf
IPR004097DHHA2
IPR001667DDH_dom
IPR001251CRAL-TRIO_dom
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005635nuclear envelope
GO:0005814centriole
GO:0005829cytosol
GO:0031616spindle pole centrosome
GO:0043231intracellular membrane-bounded organelle
GO:0048471perinuclear region of cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0016462pyrophosphatase activity
GO:0042802identical protein binding
Vocabulary: biological process
TermDefinition
GO:0001824blastocyst development
GO:0006915apoptotic process
GO:0043410positive regulation of MAPK cascade
GO:0045666positive regulation of neuron differentiation
GO:0051057positive regulation of small GTPase mediated signal transduction
GO:0051146striated muscle cell differentiation
GO:0051149positive regulation of muscle cell differentiation
GO:0051297centrosome organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004097DHHA2 domainPFAMPF02833DHHA2coord: 226..368
e-value: 8.0E-9
score: 35.8
NoneNo IPR availableGENE3DG3DSA:3.90.1640.10coord: 2..232
e-value: 5.3E-44
score: 152.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 409..431
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 461..490
NoneNo IPR availablePANTHERPTHR12112:SF14coord: 872..1020
NoneNo IPR availablePANTHERPTHR12112BNIP - RELATEDcoord: 872..1020
IPR036865CRAL-TRIO lipid binding domain superfamilyGENE3DG3DSA:3.40.525.10coord: 877..1029
e-value: 6.5E-25
score: 89.6
IPR036865CRAL-TRIO lipid binding domain superfamilySUPERFAMILYSSF52087CRAL/TRIO domaincoord: 906..1019
IPR001251CRAL-TRIO lipid binding domainPFAMPF13716CRAL_TRIO_2coord: 895..1020
e-value: 5.1E-25
score: 88.2
IPR001251CRAL-TRIO lipid binding domainCDDcd00170SEC14coord: 896..1020
e-value: 7.17015E-9
score: 53.9282
IPR001667DDH domainPFAMPF01368DHHcoord: 26..169
e-value: 8.8E-7
score: 29.1
IPR038763DHH phosphoesterase superfamilySUPERFAMILYSSF64182DHH phosphoesterasescoord: 24..289