breast cancer type 2 susceptibility protein homolog

Overview
Namebreast cancer type 2 susceptibility protein homolog
Smed IDSMED30034558
Length (bp)4339
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of breast cancer type 2 susceptibility protein homolog (SMED30034558) t-SNE clustered cells

Violin plots show distribution of expression levels for breast cancer type 2 susceptibility protein homolog (SMED30034558) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of breast cancer type 2 susceptibility protein homolog (SMED30034558) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for breast cancer type 2 susceptibility protein homolog (SMED30034558) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034558

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30034558SMESG000039871.1 SmedASXL_016703SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30034558SMESG000039871.1 SmedASXL_016704SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30034558SMESG000039871.1 dd_Smed_v4_12551_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034558SMESG000039871.1 dd_Smed_v4_12551_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034558SMESG000039871.1 dd_Smed_v4_12551_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30034558SMESG000039871.1 dd_Smed_v4_12551_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30034558SMESG000039871.1 dd_Smed_v4_12551_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30034558SMESG000039871.1 dd_Smed_v4_12551_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30034558SMESG000039871.1 dd_Smed_v4_12551_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Human
Match: BRCA2 (BRCA2 DNA repair associated [Source:HGNC Symbol;Acc:HGNC:1101])

HSP 1 Score: 189.889 bits (481), Expect = 1.446e-47
Identity = 166/592 (28.04%), Postives = 281/592 (47.47%), Query Frame = 2
Query: 1973 LDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFI--------EKIEN-----DSFKVLV---SDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHLGQK---KDKVTDLCNGEDIMNWLNNSMD--------QESALTELSFNQQNM---------LRIYRENLVSDALQEKCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGKLDXXXXXXXXXXXXXXXXXTTRFERNKEIHENLISKIYQSRQLFSITNACQFLS-DTSTAC-EIDCIGIVIAFSKVNTTSNDSWQHVVLSDPDDMDNGIILVKLWGGLKGNFLTSVIEIGNFVKFFNLQYR 3634
            + + D G ++P   G  G  +F  +    P VDPKLIS  W+ NHY+ I+WKL A++  + +  A+  LSP  ++LQLKYRYD EID ++R  ++KI E+DDTA K LVL V+ I        E   N     D+ KV +   +DGWY V A  D  L   + N ++  G K++   A   G  +    P++  P    LK+  NSTR AR + KLG+  + +PFP+ L SL  +GG    ++V+I               R YP+Q+ME                + A ++   Q   L+   + T +++       N  + +L  +   + +V  L +G ++   + N+ D         E  L  L+ ++Q +         L I R+ + S   +E+  +R+V T+ ++ +      + DS    I ++W+P+ DL +LL EG   ++Y +  +  K     S S  A++ L +   T++++   + + ++ +IYQ R+    +   +FL  D   +C E+D IG V++  K    +      V LSD       ++ +K W  L  +    +I+    +   NLQ+R
Sbjct: 2579 IQLADGGWLIPSNDGKAGKEEFYRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPKEFANRCLSPERVLLQLKYRYDTEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSANISETSSNKTSSADTQKVAIIELTDGWYAVKAQLDPPLLAVLKNGRLTVGQKIILHGAELVGSPDACT-PLEA-PESLMLKISANSTRPARWYTKLGFFPDPRPFPLPLSSLFSDGGNVGCVDVIIQ--------------RAYPIQWMEKTSSGLYIFRNEREEEKEAAKYVEAQQKRLE--ALFTKIQEEFEEHEENTTKPYLPSRALTRQQVRALQDGAELYEAVKNAADPAYLEGYFSEEQLRALNNHRQMLNDKKQAQIQLEI-RKAMESAEQKEQGLSRDVTTVWKLRIVSYSKKEKDS---VILSIWRPSSDLYSLLTEGKRYRIYHLATSKSK-----SKSERANIQLAATKKTQYQQ-LPVSDEILFQIYQPREPLHFS---KFLDPDFQPSCSEVDLIGFVVSVVKKTGLA----PFVYLSDE---CYNLLAIKFWIDLNED----IIKPHMLIAASNLQWR 3128          
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Human
Match: BRCA2 (BRCA2 DNA repair associated [Source:HGNC Symbol;Acc:HGNC:1101])

HSP 1 Score: 189.889 bits (481), Expect = 1.446e-47
Identity = 166/592 (28.04%), Postives = 281/592 (47.47%), Query Frame = 2
Query: 1973 LDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFI--------EKIEN-----DSFKVLV---SDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHLGQK---KDKVTDLCNGEDIMNWLNNSMD--------QESALTELSFNQQNM---------LRIYRENLVSDALQEKCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGKLDXXXXXXXXXXXXXXXXXTTRFERNKEIHENLISKIYQSRQLFSITNACQFLS-DTSTAC-EIDCIGIVIAFSKVNTTSNDSWQHVVLSDPDDMDNGIILVKLWGGLKGNFLTSVIEIGNFVKFFNLQYR 3634
            + + D G ++P   G  G  +F  +    P VDPKLIS  W+ NHY+ I+WKL A++  + +  A+  LSP  ++LQLKYRYD EID ++R  ++KI E+DDTA K LVL V+ I        E   N     D+ KV +   +DGWY V A  D  L   + N ++  G K++   A   G  +    P++  P    LK+  NSTR AR + KLG+  + +PFP+ L SL  +GG    ++V+I               R YP+Q+ME                + A ++   Q   L+   + T +++       N  + +L  +   + +V  L +G ++   + N+ D         E  L  L+ ++Q +         L I R+ + S   +E+  +R+V T+ ++ +      + DS    I ++W+P+ DL +LL EG   ++Y +  +  K     S S  A++ L +   T++++   + + ++ +IYQ R+    +   +FL  D   +C E+D IG V++  K    +      V LSD       ++ +K W  L  +    +I+    +   NLQ+R
Sbjct: 2579 IQLADGGWLIPSNDGKAGKEEFYRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPKEFANRCLSPERVLLQLKYRYDTEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSANISETSSNKTSSADTQKVAIIELTDGWYAVKAQLDPPLLAVLKNGRLTVGQKIILHGAELVGSPDACT-PLEA-PESLMLKISANSTRPARWYTKLGFFPDPRPFPLPLSSLFSDGGNVGCVDVIIQ--------------RAYPIQWMEKTSSGLYIFRNEREEEKEAAKYVEAQQKRLE--ALFTKIQEEFEEHEENTTKPYLPSRALTRQQVRALQDGAELYEAVKNAADPAYLEGYFSEEQLRALNNHRQMLNDKKQAQIQLEI-RKAMESAEQKEQGLSRDVTTVWKLRIVSYSKKEKDS---VILSIWRPSSDLYSLLTEGKRYRIYHLATSKSK-----SKSERANIQLAATKKTQYQQ-LPVSDEILFQIYQPREPLHFS---KFLDPDFQPSCSEVDLIGFVVSVVKKTGLA----PFVYLSDE---CYNLLAIKFWIDLNED----IIKPHMLIAASNLQWR 3128          
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Human
Match: BRCA2 (BRCA2 DNA repair associated [Source:HGNC Symbol;Acc:HGNC:1101])

HSP 1 Score: 164.466 bits (415), Expect = 9.841e-43
Identity = 99/271 (36.53%), Postives = 144/271 (53.14%), Query Frame = 2
Query: 1970 SLDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFI--------EKIEN-----DSFKVLV---SDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYME 2734
             + + D G ++P   G  G  +F  +    P VDPKLIS  W+ NHY+ I+WKL A++  + +  A+  LSP  ++LQLKYRYD EID ++R  ++KI E+DDTA K LVL V+ I        E   N     D+ KV +   +DGWY V A  D  L   + N ++  G K++   A   G  +    P++  P    LK+  NSTR AR + KLG+  + +PFP+ L SL  +GG    ++V+I               R YP+Q+ME
Sbjct:  100 GIQLADGGWLIPSNDGKAGKEEFYRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPKEFANRCLSPERVLLQLKYRYDTEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSANISETSSNKTSSADTQKVAIIELTDGWYAVKAQLDPPLLAVLKNGRLTVGQKIILHGAELVGSPDACT-PLEA-PESLMLKISANSTRPARWYTKLGFFPDPRPFPLPLSSLFSDGGNVGCVDVIIQ--------------RAYPIQWME 354          
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Zebrafish
Match: brca2 (BRCA2 DNA repair associated [Source:ZFIN;Acc:ZDB-GENE-060510-3])

HSP 1 Score: 205.297 bits (521), Expect = 1.363e-52
Identity = 151/485 (31.13%), Postives = 227/485 (46.80%), Query Frame = 2
Query: 1919 DFMSCIHVRFYCDQSVVSLDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFI-------EKIEND---------SFKVLVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMETIYHPNQDIPQRVFRNERAEE--------FSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHLGQKKDKVTDLCNGEDIMNWLNNSMDQESAL-TELSFNQQNMLRIY---RENLVSDALQEK--------------CPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGK 3247
            D+ +C H+         +L + D G +VPD  G +G  +F  +    P VDPKLIS  W+ NHY+ I+WK  +++  +   +    L+P  ++LQLK+RYD E+D ++R  LR+I E+DDT  K LVL V  I       EK   D         S  + ++DGWY + ++ D  L   +   ++K G K+V+  A   G  E    P    P    LK+  NSTRRAR   KLGY  + +P  + L SL  +GG  S +N++              V R YP Q+ME    PN      +FRN+RAE+           K  DLL   I     ++M        +R      + ++  L +G++    L  +M+Q++A+ T LS  Q   +  Y   RE      LQE+              CPNR+V  + ++ V    A D+ SN V    +W+P  +L  LL EG   + Y +  + GK
Sbjct: 2111 DYFTCEHL-----MESGALQLADGGWLVPDSKGTVGKEEFFSALCDTPGVDPKLISDVWVFNHYRWIIWKRASMERTFPNLIGGLCLTPEQVLLQLKFRYDVEVDHSQRSALRRIMERDDTPAKTLVLCVCGIVQTCQNPEKTMKDDKSPSAKMESCVIWLTDGWYSIKSLLDPPLSAMLNKGRLKIGDKIVTSGAELVGSQE--ACPPLEAPESLMLKISANSTRRARWDTKLGYYRDPRPIRLLLSSLYASGGLVSCVNLL--------------VLRSYPTQWME--KKPNSVF---IFRNDRAEDREARKHSNSKHKSLDLLISKIQTQFEKEMEGKKKKRAQRRTFS--RHEIETLQDGDE----LYEAMEQDAAVETRLSHKQMEAVSKYRCCREEKRQAELQERVQKAVMEAQEAEGGCPNRDVTPVWKLSV--IDASDMQSNCVYTLNIWRPTRELQGLLTEGHRYRAYHLASSEGK 2561          
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Xenopus
Match: stard9 (StAR related lipid transfer domain containing 9 [Source:Xenbase;Acc:XB-GENE-995220])

HSP 1 Score: 197.593 bits (501), Expect = 5.416e-50
Identity = 193/714 (27.03%), Postives = 324/714 (45.38%), Query Frame = 2
Query: 1679 VRSINSFSENFDVESN--SLANRVNASIKLQEATASKCITE-ISPNAGRFSRLRLNRSQLFPMRKLFKLAAPA--SVEE-----AAGEHIDFMS--CIHVRFYCDQ--------SVVSLDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFI------------EKIE-----NDSFKVLVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVS----TNKKRYHLGQKK---DKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVSDALQE--KCPNRNVVTLLRILVGGCLAVDV--------------DSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGKLDXXXXXXXXXXXXXXXXXTTRFERNKEIHENLISKIYQSRQLFSITNACQFLSDTSTA--CEIDCIGIVIAFSKVNTTSNDSWQHVVLSDPDDMDNGIILVKLWGGLKGNFLTSVIEIGNFVKFFNLQYR 3634
            V +I S  + FD +S+   + + +  S  LQE    K + + I P+ G   RL+++  +   ++       P   S E+         HI   S   +  +F+C          S   + + D G ++P E G  G  +   +F   P VDPKLISAEW+ NHY+ I+WKL A+++R+ +  A   L+P  ++LQLKYRYD EID ++R  ++KI E+DD+  K LVL +A I             K E       S  + V+D WY +  + D  L   +   ++  G KL+   A   G D+    P++  P    LK+  NSTR  R   KLGY  + +PF + L SL   GG    ++VVI               RIYP+Q+ME + +        VFRN+RAEE   ++    ++  +     K+ +       T  +R  L ++     ++  L +G +I   + N  D     + LS  Q   L  +R+ L++D  Q   +   R  +        GC   DV              +++   I  +W+P  D+++LL EG   K+Y +  +  K       S +A + L +   TRF++  ++ E+++ +IY  R+   +T+  +F     +A   E+D +G++I+  K       +   V +S   D  + I+ +K W  L    L  + +   ++   NL++R
Sbjct: 2234 VETICSSKDQFD-DSDILQMTSNLRCSKDLQEMRIRKKLRQKIKPHPGSLYRLKMSHVKRISLQSAVAERCPTLYSREQLYRYGIVKNHIGVSSENALSFQFHCSNYFTKELLLSGNGVQLADGGWLIPTEQGNAGKEEIYRAFCDTPGVDPKLISAEWVHNHYRWIVWKLAAMEVRFPKTFACRCLTPERVLLQLKYRYDVEIDKSQRSAIKKIMERDDSPAKTLVLCIAKIISQGTRLPNACSNKTEPADSKESSAVIEVTDSWYGIKVLLDPCLTALLHKGRLFIGQKLIVHGAELIGSDD-ACSPLE-APESLMLKIAANSTRPVRWHTKLGYFKDPRPFCLHLSSLLSEGGVVGCVDVVIQ--------------RIYPMQWMEKMAN-----GLYVFRNDRAEEREAEKHSANQQKKLEMLFSKIQAEFEQREVTCNRRKGLRRRSLNAQQMQTLQDGAEIYEAIQNESDPGYLESYLSAEQLKALNHHRQ-LLNDKKQALIQAEFRKAIECSEQDANGCTRRDVTPVWKLRIADYRNYETDAAYILNIWRPLPDVLSLLKEGCRYKMYHLAASTSK-----GKSLAADLQLTATKKTRFQQ-LQLSESILEQIYSPRE---VTDFSRFQEPLFSAPYAEVDLVGLIISIYK----KTGAAPVVYIS---DESHNIVALKFWTDLGQLGLEEITKPRTYISASNLRWR 2908          
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Xenopus
Match: stard9 (StAR related lipid transfer domain containing 9 [Source:Xenbase;Acc:XB-GENE-995220])

HSP 1 Score: 197.593 bits (501), Expect = 5.884e-50
Identity = 193/714 (27.03%), Postives = 324/714 (45.38%), Query Frame = 2
Query: 1679 VRSINSFSENFDVESN--SLANRVNASIKLQEATASKCITE-ISPNAGRFSRLRLNRSQLFPMRKLFKLAAPA--SVEE-----AAGEHIDFMS--CIHVRFYCDQ--------SVVSLDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFI------------EKIE-----NDSFKVLVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVS----TNKKRYHLGQKK---DKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVSDALQE--KCPNRNVVTLLRILVGGCLAVDV--------------DSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGKLDXXXXXXXXXXXXXXXXXTTRFERNKEIHENLISKIYQSRQLFSITNACQFLSDTSTA--CEIDCIGIVIAFSKVNTTSNDSWQHVVLSDPDDMDNGIILVKLWGGLKGNFLTSVIEIGNFVKFFNLQYR 3634
            V +I S  + FD +S+   + + +  S  LQE    K + + I P+ G   RL+++  +   ++       P   S E+         HI   S   +  +F+C          S   + + D G ++P E G  G  +   +F   P VDPKLISAEW+ NHY+ I+WKL A+++R+ +  A   L+P  ++LQLKYRYD EID ++R  ++KI E+DD+  K LVL +A I             K E       S  + V+D WY +  + D  L   +   ++  G KL+   A   G D+    P++  P    LK+  NSTR  R   KLGY  + +PF + L SL   GG    ++VVI               RIYP+Q+ME + +        VFRN+RAEE   ++    ++  +     K+ +       T  +R  L ++     ++  L +G +I   + N  D     + LS  Q   L  +R+ L++D  Q   +   R  +        GC   DV              +++   I  +W+P  D+++LL EG   K+Y +  +  K       S +A + L +   TRF++  ++ E+++ +IY  R+   +T+  +F     +A   E+D +G++I+  K       +   V +S   D  + I+ +K W  L    L  + +   ++   NL++R
Sbjct: 2218 VETICSSKDQFD-DSDILQMTSNLRCSKDLQEMRIRKKLRQKIKPHPGSLYRLKMSHVKRISLQSAVAERCPTLYSREQLYRYGIVKNHIGVSSENALSFQFHCSNYFTKELLLSGNGVQLADGGWLIPTEQGNAGKEEIYRAFCDTPGVDPKLISAEWVHNHYRWIVWKLAAMEVRFPKTFACRCLTPERVLLQLKYRYDVEIDKSQRSAIKKIMERDDSPAKTLVLCIAKIISQGTRLPNACSNKTEPADSKESSAVIEVTDSWYGIKVLLDPCLTALLHKGRLFIGQKLIVHGAELIGSDD-ACSPLE-APESLMLKIAANSTRPVRWHTKLGYFKDPRPFCLHLSSLLSEGGVVGCVDVVIQ--------------RIYPMQWMEKMAN-----GLYVFRNDRAEEREAEKHSANQQKKLEMLFSKIQAEFEQREVTCNRRKGLRRRSLNAQQMQTLQDGAEIYEAIQNESDPGYLESYLSAEQLKALNHHRQ-LLNDKKQALIQAEFRKAIECSEQDANGCTRRDVTPVWKLRIADYRNYETDAAYILNIWRPLPDVLSLLKEGCRYKMYHLAASTSK-----GKSLAADLQLTATKKTRFQQ-LQLSESILEQIYSPRE---VTDFSRFQEPLFSAPYAEVDLVGLIISIYK----KTGAAPVVYIS---DESHNIVALKFWTDLGQLGLEEITKPRTYISASNLRWR 2892          
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Mouse
Match: Brca2 (breast cancer 2, early onset [Source:MGI Symbol;Acc:MGI:109337])

HSP 1 Score: 188.734 bits (478), Expect = 2.276e-47
Identity = 132/466 (28.33%), Postives = 226/466 (48.50%), Query Frame = 2
Query: 1973 LDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFI-------------EKIENDSFKV---LVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMET----IYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNK----KRYHLGQ--KKDKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENL---------------VSDALQEKCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGK 3247
              + D G ++P   G  G  +F  +    P VDPKLIS+ W+ NHY+ I+WKL A++  + +  A+  L+P  ++LQLKYRYD EID ++R  L+KI E+DDTA K LVL ++ I             +    D+ KV    ++DGWY V A  D  L   + + K+  G K+++  A   G  +    P++  P    LK+  NSTR AR  ++LG+  + +PFP+ L SL  +GG    +++++               R+YPLQ++E     +Y         +FR+ER EE    +F   ++  +     K+ +    ++    +R  L +   + +V  L +G ++   +  + D +      S  Q   L  YR+ L               +  A +E+  +R+V T+ ++ V      +    + A+ ++W+P+ DL +LL EG   ++Y + V+  K
Sbjct: 2500 FQLADGGWLIPSNDGKAGKEEFYRALCDTPGVDPKLISSIWVANHYRWIVWKLAAMEFAFPKEFANRCLNPERVLLQLKYRYDVEIDNSRRSALKKILERDDTAAKTLVLCISDIISPSTKVSETSGGKTSGEDANKVDTIELTDGWYAVRAQLDPPLMALVKSGKLTVGQKIITQGAELVGSPD-ACAPLE-APDSLRLKISANSTRPARWHSRLGFFRDPRPFPLPLSSLFSDGGNVGCVDIIVQ--------------RVYPLQWVEKTVSGLY---------IFRSEREEEKEALRFAEAQQKKLEALFTKVHTEFKDHEEDTTQRCVLSRTLTRQQVHALQDGAELYAAVQYASDPDHLEACFSEEQLRALNNYRQMLNDKKQARIQSEFRKALESAEKEEGLSRDVTTVWKLRVTSYKKKE----KSALLSIWRPSSDLSSLLTEGKRYRIYHLAVSKSK 2936          
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Mouse
Match: Brca2 (breast cancer 2, early onset [Source:MGI Symbol;Acc:MGI:109337])

HSP 1 Score: 188.734 bits (478), Expect = 2.276e-47
Identity = 132/466 (28.33%), Postives = 226/466 (48.50%), Query Frame = 2
Query: 1973 LDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFI-------------EKIENDSFKV---LVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMET----IYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNK----KRYHLGQ--KKDKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENL---------------VSDALQEKCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGK 3247
              + D G ++P   G  G  +F  +    P VDPKLIS+ W+ NHY+ I+WKL A++  + +  A+  L+P  ++LQLKYRYD EID ++R  L+KI E+DDTA K LVL ++ I             +    D+ KV    ++DGWY V A  D  L   + + K+  G K+++  A   G  +    P++  P    LK+  NSTR AR  ++LG+  + +PFP+ L SL  +GG    +++++               R+YPLQ++E     +Y         +FR+ER EE    +F   ++  +     K+ +    ++    +R  L +   + +V  L +G ++   +  + D +      S  Q   L  YR+ L               +  A +E+  +R+V T+ ++ V      +    + A+ ++W+P+ DL +LL EG   ++Y + V+  K
Sbjct: 2500 FQLADGGWLIPSNDGKAGKEEFYRALCDTPGVDPKLISSIWVANHYRWIVWKLAAMEFAFPKEFANRCLNPERVLLQLKYRYDVEIDNSRRSALKKILERDDTAAKTLVLCISDIISPSTKVSETSGGKTSGEDANKVDTIELTDGWYAVRAQLDPPLMALVKSGKLTVGQKIITQGAELVGSPD-ACAPLE-APDSLRLKISANSTRPARWHSRLGFFRDPRPFPLPLSSLFSDGGNVGCVDIIVQ--------------RVYPLQWVEKTVSGLY---------IFRSEREEEKEALRFAEAQQKKLEALFTKVHTEFKDHEEDTTQRCVLSRTLTRQQVHALQDGAELYAAVQYASDPDHLEACFSEEQLRALNNYRQMLNDKKQARIQSEFRKALESAEKEEGLSRDVTTVWKLRVTSYKKKE----KSALLSIWRPSSDLSSLLTEGKRYRIYHLAVSKSK 2936          
BLAST of breast cancer type 2 susceptibility protein homolog vs. UniProt/SwissProt
Match: sp|O35923|BRCA2_RAT (Breast cancer type 2 susceptibility protein homolog OS=Rattus norvegicus OX=10116 GN=Brca2 PE=1 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 2.666e-50
Identity = 141/465 (30.32%), Postives = 230/465 (49.46%), Query Frame = 2
Query: 1979 VGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFI-------------EKIENDSFKV---LVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYH--LGQK--------KDKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVSD----------------ALQEKCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGK 3247
            + D G ++P + G  G  +F  +    P VDPKLIS+ W+ NHY+ I+WKL A++  + +  A+  L+P  ++LQLKYRYD EID + R  L+KI E+DDTA K LVL V+ I             +    DS KV    ++DGWY V A  D  L   + + ++  G K+++  A   G  +    P++  P    LK+  NSTR AR  +KLG+  + +PFP+ L SL  +GG    ++V++               R+YPLQ++E     +      +FRNER EE    +F   ++      LE + + V T  K +   + Q+        + +V  L +G ++   + ++ D E   T  S  Q   L  YR+ ++SD                A +E+  +R+V T+ ++ V      +    + A+ ++W+P+ DL +LL EG   ++Y + V+  K
Sbjct: 2511 LADGGWLIPSDDGKAGKEEFYRALCDTPGVDPKLISSVWVSNHYRWIVWKLAAMEFAFPKEFANRCLNPERVLLQLKYRYDVEIDNSSRSALKKILERDDTAAKTLVLCVSDIISLSTNVSETSGSKASSEDSNKVDTIELTDGWYAVKAQLDPPLLALVKSGRLTVGQKIITQGAELVGSPD-ACAPLE-APDSLRLKISANSTRPARWHSKLGFFHDPRPFPLPLSSLFSDGGNVGCVDVIVQ--------------RVYPLQWVEKTVSGS-----YIFRNEREEEKEALRFAEAQQK----KLEALFTKVHTELKEHEEDIAQRRVLSRALTRQQVHALQDGAELYAAVQDASDPEHLETCFSEEQLRALNNYRQ-MLSDKKQARIQSEFRKALEAAEKEEGLSRDVSTVWKLRVTSYKKRE----KSALLSIWRPSSDLPSLLTEGQRYRIYHLSVSKSK 2945          
BLAST of breast cancer type 2 susceptibility protein homolog vs. UniProt/SwissProt
Match: sp|P51587|BRCA2_HUMAN (Breast cancer type 2 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA2 PE=1 SV=3)

HSP 1 Score: 189.889 bits (481), Expect = 6.221e-47
Identity = 166/592 (28.04%), Postives = 281/592 (47.47%), Query Frame = 2
Query: 1973 LDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFI--------EKIEN-----DSFKVLV---SDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHLGQK---KDKVTDLCNGEDIMNWLNNSMD--------QESALTELSFNQQNM---------LRIYRENLVSDALQEKCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGKLDXXXXXXXXXXXXXXXXXTTRFERNKEIHENLISKIYQSRQLFSITNACQFLS-DTSTAC-EIDCIGIVIAFSKVNTTSNDSWQHVVLSDPDDMDNGIILVKLWGGLKGNFLTSVIEIGNFVKFFNLQYR 3634
            + + D G ++P   G  G  +F  +    P VDPKLIS  W+ NHY+ I+WKL A++  + +  A+  LSP  ++LQLKYRYD EID ++R  ++KI E+DDTA K LVL V+ I        E   N     D+ KV +   +DGWY V A  D  L   + N ++  G K++   A   G  +    P++  P    LK+  NSTR AR + KLG+  + +PFP+ L SL  +GG    ++V+I               R YP+Q+ME                + A ++   Q   L+   + T +++       N  + +L  +   + +V  L +G ++   + N+ D         E  L  L+ ++Q +         L I R+ + S   +E+  +R+V T+ ++ +      + DS    I ++W+P+ DL +LL EG   ++Y +  +  K     S S  A++ L +   T++++   + + ++ +IYQ R+    +   +FL  D   +C E+D IG V++  K    +      V LSD       ++ +K W  L  +    +I+    +   NLQ+R
Sbjct: 2579 IQLADGGWLIPSNDGKAGKEEFYRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPKEFANRCLSPERVLLQLKYRYDTEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSANISETSSNKTSSADTQKVAIIELTDGWYAVKAQLDPPLLAVLKNGRLTVGQKIILHGAELVGSPDACT-PLEA-PESLMLKISANSTRPARWYTKLGFFPDPRPFPLPLSSLFSDGGNVGCVDVIIQ--------------RAYPIQWMEKTSSGLYIFRNEREEEKEAAKYVEAQQKRLE--ALFTKIQEEFEEHEENTTKPYLPSRALTRQQVRALQDGAELYEAVKNAADPAYLEGYFSEEQLRALNNHRQMLNDKKQAQIQLEI-RKAMESAEQKEQGLSRDVTTVWKLRIVSYSKKEKDS---VILSIWRPSSDLYSLLTEGKRYRIYHLATSKSK-----SKSERANIQLAATKKTQYQQ-LPVSDEILFQIYQPREPLHFS---KFLDPDFQPSCSEVDLIGFVVSVVKKTGLA----PFVYLSDE---CYNLLAIKFWIDLNED----IIKPHMLIAASNLQWR 3128          
BLAST of breast cancer type 2 susceptibility protein homolog vs. UniProt/SwissProt
Match: sp|P97929|BRCA2_MOUSE (Breast cancer type 2 susceptibility protein homolog OS=Mus musculus OX=10090 GN=Brca2 PE=1 SV=2)

HSP 1 Score: 188.734 bits (478), Expect = 1.592e-46
Identity = 132/466 (28.33%), Postives = 226/466 (48.50%), Query Frame = 2
Query: 1973 LDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFI-------------EKIENDSFKV---LVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMET----IYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNK----KRYHLGQ--KKDKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENL---------------VSDALQEKCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGK 3247
              + D G ++P   G  G  +F  +    P VDPKLIS+ W+ NHY+ I+WKL A++  + +  A+  L+P  ++LQLKYRYD EID ++R  L+KI E+DDTA K LVL ++ I             +    D+ KV    ++DGWY V A  D  L   + + K+  G K+++  A   G  +    P++  P    LK+  NSTR AR  ++LG+  + +PFP+ L SL  +GG    +++++               R+YPLQ++E     +Y         +FR+ER EE    +F   ++  +     K+ +    ++    +R  L +   + +V  L +G ++   +  + D +      S  Q   L  YR+ L               +  A +E+  +R+V T+ ++ V      +    + A+ ++W+P+ DL +LL EG   ++Y + V+  K
Sbjct: 2500 FQLADGGWLIPSNDGKAGKEEFYRALCDTPGVDPKLISSIWVANHYRWIVWKLAAMEFAFPKEFANRCLNPERVLLQLKYRYDVEIDNSRRSALKKILERDDTAAKTLVLCISDIISPSTKVSETSGGKTSGEDANKVDTIELTDGWYAVRAQLDPPLMALVKSGKLTVGQKIITQGAELVGSPD-ACAPLE-APDSLRLKISANSTRPARWHSRLGFFRDPRPFPLPLSSLFSDGGNVGCVDIIVQ--------------RVYPLQWVEKTVSGLY---------IFRSEREEEKEALRFAEAQQKKLEALFTKVHTEFKDHEEDTTQRCVLSRTLTRQQVHALQDGAELYAAVQYASDPDHLEACFSEEQLRALNNYRQMLNDKKQARIQSEFRKALESAEKEEGLSRDVTTVWKLRVTSYKKKE----KSALLSIWRPSSDLSSLLTEGKRYRIYHLAVSKSK 2936          
BLAST of breast cancer type 2 susceptibility protein homolog vs. UniProt/SwissProt
Match: sp|Q864S8|BRCA2_FELCA (Breast cancer type 2 susceptibility protein homolog OS=Felis catus OX=9685 GN=BRCA2 PE=2 SV=2)

HSP 1 Score: 178.718 bits (452), Expect = 1.546e-43
Identity = 177/674 (26.26%), Postives = 292/674 (43.32%), Query Frame = 2
Query: 1973 LDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFIEKIENDSFK----------------VLVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMETIYHPNQDIPQR--VFRNE--------RAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHL-GQKKDKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVSDALQ-----------------EKCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGKLDXXXXXXXXXXXXXXXXXTTRFERNKEIHENLISKIYQSRQLFSITNACQFLSDTSTAC-EIDCIGIVIAFSKVNTTSNDSWQHVVLSDPDDMDNGIILVKLWGGLKGNFLTSVIEIGNFVKFFNLQYRKSV-----------YSKFNPNSKIPAFECHYNTHSNVVYVSRKWDFHAMKQSIGEKLEKCLPAFEIFTNDKHNSI 3826
            + + D G ++P   G  G  +F  +    P VDP LIS  W+ NHY+ I+WKL A++  + +  A+  LSP  ++LQLKYRYD EID +KR  ++KI E+DDTA K LVL ++       D  +                V ++DGWY + A  D  L   +   ++  G K++   A   G  +    P++  P    LK+  NSTR A  +AKLG+  + +PFP+ L SL  +GG    ++VVI               R YP+Q+ME         P    +FRNE        +  E  +K+ ++L  N I    EK   +++  K+   L    + +V  L +G ++   + N+ D  S     S  Q   L  +R+ +++D  Q                 E+   R+V T+ ++ +      + DS      ++W+P+ DL +LL EG   ++Y +  +  K     S S  A + L +   T++++     E L+ ++YQ R+            D    C E+D IG V++  K             L    D  + ++ +K+W  L  +    +++    +   NLQ+R              +S+F+ + K    E H+           +  FH MK +I           E F ND  N +
Sbjct: 2523 IQLADGGWLIPSNDGKAGKEEFYRALCDTPGVDPNLISRIWVYNHYRWIIWKLAAMEFAFPKEFANRCLSPERVLLQLKYRYDMEIDRSKRSAIKKIMERDDTAAKTLVLCISETISSSTDLSETSGSKTSGVGTKNVGIVELTDGWYAIKAQLDPPLLALVKKGRLTVGHKIIIHGAELAGSPD-ACTPLE-APESLILKISANSTRPACWYAKLGFFPDPRPFPLPLSSLFSDGGNVGCVDVVIQ--------------RTYPIQWME-------KTPSGLCIFRNEREEEREATKYAEAQQKKLEVLF-NKIQAEFEKHDENIT--KRCVPLRALTRQQVCALQDGAELYEAVKNAPDPASLEAYFSEEQIRALNNHRQ-MLNDKKQAQIQLEFRKAMESAEQGEQMLPRDVTTVWKMRIISYGKKEKDS---VTLSIWRPSSDLYSLLTEGKRYRIYHLATSQSK-----SKSERAHIQLTATKKTQYQQLPASDE-LLFQVYQPREPLYFNKLLD--PDFQPPCSEVDLIGFVVSVVK-------KIGFAPLVYLSDECHNLLAIKVWTDLNED----IVKPHTLIAASNLQWRPESKSGIPTLFAGDFSRFSASPK----EGHF-----------QETFHKMKNTIEN--------VETFCNDAENKL 3124          
BLAST of breast cancer type 2 susceptibility protein homolog vs. UniProt/SwissProt
Match: sp|Q7Y1C5|BRC2A_ARATH (Protein BREAST CANCER SUSCEPTIBILITY 2 homolog A OS=Arabidopsis thaliana OX=3702 GN=BRCA2A PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 4.065e-21
Identity = 101/404 (25.00%), Postives = 165/404 (40.84%), Query Frame = 2
Query: 2084 SAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFIE-KIENDS-----------FKVLVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENII---NTTLEKMMSSVSTNKKRYHLGQKKDKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIY-----------RENLVSDALQEK-CPNRNVVTLLRILVGGCLAVDVDSN---QVAIFTLWKPNDDLMTLLVEG 3205
            S +W+ NHY+ I+WKL   D+ Y      ++L+  +++ +LKYRY++E++      +++I   D  A+  +VL ++ I  K +NDS            KV ++DGWY + A  D  L  Q+   K+  G KL    A  +G   P             L L+ N T RA    +LG+   +   P+ L  +  NGG                  +L  + RIYP+ Y E +        + + R+ER E             II   N     ++  +    +R   G      TD   G  I   L  + + E  + E+S  Q      Y           +E  V++ L++     RNV   +RI + G  ++  +     +  I T+W P +   T L EG
Sbjct:  570 SRKWVTNHYRWIVWKLACYDIYYPAKCRGNFLTITNVLEELKYRYEREVNHGHCSAIKRILSGDAPASSMMVLCISAINPKTDNDSQEAHCSDSCSNVKVELTDGWYSMNAALDVVLTKQLNAGKLFVGQKLRILGAGLSGWATPTSPLEAVISSTICLLLNINGTYRAHWADRLGFCKEIG-VPLALNCIKCNGGPVPK--------------TLAGIKRIYPILYKERLGE-----KKSIVRSERIE-----------SRIIQLHNQRRSALVEGIMCEYQRGINGVHSQNDTDSEEGAKIFKLLETAAEPEFLMAEMSPEQLRSFTTYKAKFEAAQQMRKEKSVAETLEDAGLGERNVTPFMRIRLVGLTSLSYEGEHNPKEGIVTIWDPTERQRTELTEG 942          
BLAST of breast cancer type 2 susceptibility protein homolog vs. TrEMBL
Match: A0A0X9SRF7 (Putative BRCA2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 687.182 bits (1772), Expect = 0.000e+0
Identity = 329/348 (94.54%), Postives = 331/348 (95.11%), Query Frame = 2
Query: 2045 SFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFIEKIENDSFKVLVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHLGQKKDKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVSDALQEKCPNRNVV 3088
            SFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFIEKIENDSFKV VSDGWYCVPAIFDKFLKDQIINKKIKPGTKL+SCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVIN              RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHLGQKKDKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVSDAL EKCPNRN +
Sbjct:   14 SFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFIEKIENDSFKVFVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLISCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVIN--------------RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHLGQKKDKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVSDALLEKCPNRNYI 347          
BLAST of breast cancer type 2 susceptibility protein homolog vs. TrEMBL
Match: A0A1S3JJD8 (breast cancer type 2 susceptibility protein homolog OS=Lingula unguis OX=7574 GN=LOC106173426 PE=4 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 1.254e-71
Identity = 203/732 (27.73%), Postives = 340/732 (46.45%), Query Frame = 2
Query: 1826 LRLNRSQLFPMRKLFKLAA-PASVEEAA--GEHIDFMSCIHVRFYCDQSVVSLDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFI-----------------------EKIENDSFKVLVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDE---PLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSV-------STNKKRYHLGQKKDKVTDLCNGEDIMNWLNNSMDQESALTELS---------------FNQQNMLRIYRENLVSDALQEKCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGKLDXXXXXXXXXXXXXXXXXTTRFERNKEIHENLISKIYQSRQLFSITNAC---------QFLSDTSTACEIDCIGIVIAFSKVNTTSNDSWQHVVLSDPDDMDNGIILVKLWGGLKGNFLTSVIEIGNFVKFFNLQYRKSVYSKFNPNSKIPAF----ECHYNTHSNVVYVSRKWDFHAMKQSIGEKLEKCLPAFEIFTNDKHNSIK 3829
            +R    Q +P +KL+ L   P++++ +A   E   F+   H       S     VGD   ++ D+ G  G  +F  +F+ +P VDP+L+S +W+ NHY+ I+WK+ A+++ + Q      L+PH +MLQLKYRYD+E+D ++R  ++KI E+DDT  K ++L V+ +                        K+  ++  V ++DGWY + A  D  L   + + K++ G KL  C A   G  +   PL  P D       LK+ GNSTR AR  A LG+  +  PFPV LGSL P+GG    ++VV+               R+YP+QYME +  PN      VFR  R EE   K+F+  ++  +   L ++ + V       ST +KR  +     ++++L  G++I + + N+ D  S   ELS                +QQ  ++      + D   E+   RNV  LL++ V GC   DVD+      T+W+P+D+++ +L EG  +K+Y++  +  ++      +    V L++   T++  + +I EN    I++ R+++  +  C         +           D      A S+    S    Q V   D  +     + VK WGGLK   +  ++  G  V   NLQ+R          S +P +     CH+ T        R  D H +K ++ EKL+  + + + F N+    ++
Sbjct: 3224 VREELPQWYPKQKLYGLGVLPSTLKVSASNAEEFHFLPKEHFLPSILSSGEGYKVGDGATLILDDQGCAGKDEFYRAFLDMPGVDPRLVSQDWVYNHYRWIVWKMAAMEVAFPQQFGGRCLTPHRVMLQLKYRYDREVDASQRSAVKKITERDDTPAKTMILCVSRVLTNKSIETGGQTHSRGKEGEKEAPKMAVENATVELTDGWYPIRAQLDPALTKLLRSGKLRVGQKLCVCGAELVGSQDACLPLEAPTDLL-----LKVSGNSTRPARWDAILGFHRSPHPFPVPLGSLFPDGGMVGCVDVVVT--------------RVYPIQYMEKL--PNG---SNVFRCGRMEERESKKFEQTRQERMERLLARIQADVELKSSDKSTKRKRRSVKLTHVQISNLTTGKEIYDAIQNAPDPTSIEMELSEAQICALNEHRCRLQMDQQAEVQAQVRKALQDTENEQSSMRNVTPLLKVRVAGCSNSDVDAGMNTFLTVWRPSDEVIQMLQEGKRLKIYNLSASGARV-----KNCPCEVQLSACRGTKYMES-QIEENFKDLIFEPREVYEFSELCSHSVRPAYSEVDVVGFVVHVTDSGDTYSACSR----SGGCMQTVYFVDNTEE---FLEVKFWGGLKALGVDDLLTKGTLVAVTNLQWRGESR------SSVPCYFASEMCHFTT--------RPKDEH-LKSAV-EKLQSVISSPKQFINEMEKKLR 3902          
BLAST of breast cancer type 2 susceptibility protein homolog vs. TrEMBL
Match: A0A3R7H2N9 (Breast cancer type 2 susceptibility-like protein OS=Clonorchis sinensis OX=79923 GN=Brca2 PE=4 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 4.254e-69
Identity = 194/673 (28.83%), Postives = 309/673 (45.91%), Query Frame = 2
Query: 1967 VSLDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMR-------YRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFIEKIENDSFKVLVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNA------VWTGCDEPL--------------VLPVDHFPPGCGLKLHGNSTRRARAFAKLGY-----QSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMETIYHPNQDIPQ--------------RVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHLGQKKDKVTDLC----NGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVSDALQEKCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGK----------------------LDXXXXXXXXXXXXXXXXXTTRFERNKEIH---------ENLISKIYQSRQLFS--------ITNACQF---LSDTSTACEIDCIGIVIAFSKVNTT---------------SNDSWQHVVLSDPDDM---------DNGIILVKLWGGLKGNFLTSVIEIGNFVKFFNLQYRK 3637
             S + GD GV++PD  G +G  + ID+F+  P+V  +L+S  W+ NHY  ++WKL +  +R       +R  L  D+ +PHH++L+LKYRYD+E++  +RP LR+I E DDT  +RLVL V+ +  I++  F V V+DGWY V    D  L   + + +I+ GTK V+  A        TG    +              +   D    G  L+LHGNSTR    F +LGY      S    +PV L +L P+GG  S I VV+               R +PLQYMET+    +D+P+               +FR+ERAE+    QF+  +   ++  L+ ++ +      R   G+K+   + L     +GE +   +  ++D   A +ELS  Q++ +R ++E  +  A+ E    R V  LLR+ V G    DV  N V   T W P DDL+ +L EG ++++Y +  T  +                      L     A S           +   + K I          E LI ++Y+ R   S        ++N+  F   L+D +T  E+D   IV+A  + + T               S    Q    S+ D +         D  +++VK+WGGL+ + L+++++ G  V F +LQ R+
Sbjct:  803 ASYEAGDGGVLIPDAYGCVGKEEIIDAFLASPSVCCQLVSRGWLSNHYDQLVWKLGSTTLRASLPDSPFR--LPVDYFTPHHVLLRLKYRYDRELEQVERPALRRIVELDDTPARRLVLCVSEVTAIDSSQFNVRVTDGWYQVNCQLDGALIRLVRSGRIRVGTKFVTAGAELVHIDAATGASVAVRSVKCSGEDSQYGHLFGADGAAMGVSLRLHGNSTRPCPWFTRLGYSFEQPSSWCGSYPVPLCTLLPDGGLCSGIRVVVQ--------------RRFPLQYMETL----EDLPESANERDRRSPGLRRHLFRSERAEQAEVAQFEQQRRRALDQALDNLIPT-----GRGTTGRKQPTPSQLASLGTDGEALFAAVMGALDPTEAESELSDVQRDAMRQFKETTLRSAMDEVTKPRKVTPLLRVRVAGLHPKDVSLNYVVPVTFWNPTDDLLAVLKEGEAVEIYKLQATTTRTTDPFAPPSAGQMISPVQRAALLPGATLALSGGRNTSARSLVSSARKQKAIKSCLPSDVVDEKLIERVYRPRNAMSVADVQHIYVSNSSDFHAPLTDQNTPIEVDLRCIVVAVHQSHATDISLRTKSDPKTVEPSTAIGQRSTASEVDSVYVTDANSSSDGCLVVVKIWGGLQTHHLSNLLQKGQAVHFTDLQLRR 1450          
BLAST of breast cancer type 2 susceptibility protein homolog vs. TrEMBL
Match: G7YE82 (Breast cancer 2 susceptibility protein OS=Clonorchis sinensis OX=79923 GN=CLF_105802 PE=4 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 1.267e-68
Identity = 194/673 (28.83%), Postives = 308/673 (45.77%), Query Frame = 2
Query: 1967 VSLDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMR-------YRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFIEKIENDSFKVLVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNA------VWTGCDEPL--------------VLPVDHFPPGCGLKLHGNSTRRARAFAKLGY-----QSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMETIYHPNQDIPQ--------------RVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHLGQKKDKVTDLC----NGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVSDALQEKCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGK----------------------LDXXXXXXXXXXXXXXXXXTTRFERNKEIH---------ENLISKIYQSRQLFS--------ITNACQF---LSDTSTACEIDCIGIVIAFSKVNTT---------------SNDSWQHVVLSDPDDM---------DNGIILVKLWGGLKGNFLTSVIEIGNFVKFFNLQYRK 3637
             S + GD GV++PD  G +G  + ID+F+  P+V  +L+S  W+ NHY  ++WKL +  +R       +R  L  D+ +PHH++L+LKYRYD+E++  +RP LR+I E DDT  +RLVL V+ +  I +  F V V+DGWY V    D  L   + + +I+ GTK V+  A        TG    +              +   D    G  L+LHGNSTR    F +LGY      S    +PV L +L P+GG  S I VV+               R +PLQYMET+    +D+P+               +FR+ERAE+    QF+  +   ++  L+ ++ +      R   G+K+   + L     +GE +   +  ++D   A +ELS  Q++ +R ++E  +  A+ E    R V  LLR+ V G    DV  N V   T W P DDL+ +L EG ++++Y +  T  +                      L     A S           +   + K I          E LI ++Y+ R   S        ++N+  F   L+D +T  E+D   IV+A  + + T               S    Q    S+ D +         D  +++VK+WGGL+ + L+++++ G  V F +LQ R+
Sbjct:  803 ASYEAGDGGVLIPDAYGCVGKEEIIDAFLASPSVCCQLVSRGWLSNHYDQLVWKLGSTTLRASLPDSPFR--LPVDYFTPHHVLLRLKYRYDRELEQVERPALRRIVELDDTPARRLVLCVSEVTAIGSSQFNVRVTDGWYQVNCQLDGALIRLVRSGRIRVGTKFVTAGAELVHIDAATGASVAVRSVKCSGEDSQYGHLFGADGAAMGVSLRLHGNSTRPCPWFTRLGYSFEQPSSWCGSYPVPLCTLLPDGGLCSGIRVVVQ--------------RRFPLQYMETL----EDLPESANERDRRSPGLRRHLFRSERAEQAEVAQFEQQRRRALDQALDNLIPT-----GRGTTGRKQPTPSQLASLGTDGEALFAAVMGALDPTEAESELSDVQRDAMRQFKETTLRSAMDEVTKPRKVTPLLRVRVAGLHPKDVSLNYVVPVTFWNPTDDLLAVLKEGEAVEIYKLQATTTRTTDPFAPPSAGQMISPVQRAALLPGATLALSGGRNTSARPLVSSARKQKAIKSCLPSDVVDEKLIERVYRPRNAMSVADVQHIYVSNSSDFHAPLTDQNTPIEVDLRCIVVAVHQSHATDISLRTKSDPKTVEPSTAIGQRSTASEVDSVYVTDANSSSDGCLVVVKIWGGLQTHHLSNLLQKGQAVHFTDLQLRR 1450          
BLAST of breast cancer type 2 susceptibility protein homolog vs. TrEMBL
Match: A0A4S2KYU9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010446 PE=4 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 1.191e-66
Identity = 191/669 (28.55%), Postives = 308/669 (46.04%), Query Frame = 2
Query: 1967 VSLDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMR-------YRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFIEKIENDSFKVLVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNA------VWTGCDEPL--------------VLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKP------FPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMETIYHPNQDIPQR----------VFRNERAEEFSRKQFDLLKENIINTTLEKMMSSV--STNKKRYHLGQKKDKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVSDALQEKCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGK----------------------LDXXXXXXXXXXXXXXXXXTTRFERNKE---------IHENLISKIYQSRQLFS--------ITNACQF---LSDTSTACEIDCIGIVIAFSKVN------------------------TTSNDSWQHVVLSDPDDMDNGIIL-VKLWGGLKGNFLTSVIEIGNFVKFFNLQYRK 3637
             S   GD G+++PD  G +G  + +D+F+  P+V  +L S  W+ NHY  ++WKL +  +R       +R  L  D+ +PHH++L+LKYRYD+E++  +RP LR+I E DDT  +RLVL V+ +  I +  F V V+DGWY V    D  L   + + +I+ GTK V+  A        TG    +              +   D    G  L+LHGNSTR    F +LGY S  +P      +PV L +L P+GG  S I VV+               R +PLQYMET+    +   +R          +FR+ERAE+    QF+  +   ++  L+ ++ +V  +T +K+    Q     TD   GE +   +  ++D   A +ELS  Q++ ++ ++E  +  A+ E    R V  LLR+ V G    DV  N V   T W P DDL+ +L EG ++++Y +  T  +                      L     A S           +   + K          I E LI ++Y+ R   S        ++N+  F   L+D +T  E+D   +V+A  + +                        +T+      V ++D +   +G +L VK+WGGL+ + L+++++ G  V F +LQ R+
Sbjct:  806 ASYGAGDGGILIPDAYGCVGKEEILDAFLASPSVCCQLTSQGWLSNHYDQLVWKLGSTTLRASVPDSPFR--LPVDYFTPHHVLLRLKYRYDRELEQVERPALRRIVELDDTPARRLVLCVSEVTAIGSSQFNVRVTDGWYQVNCQLDGALIRLVRSGRIRVGTKFVTAGAELVHIDAATGASVAVRSVKCSGEDSQYGHLFGADGAAMGVCLRLHGNSTRPCSWFTRLGY-SFEQPGSWCGLYPVPLCTLLPDGGLCSGIRVVVQ--------------RRFPLQYMETLEALPESANERDGKSPGLRRHLFRSERAEQAEVAQFEQQRRRALDQALDNLLPTVRGTTGRKQPTPSQLASLGTD---GEALFAAVMGALDPTEAESELSDVQRDAIKQFKETSLRSAMDEVTKPRKVTPLLRVRVAGLHPKDVSLNYVVPVTFWNPTDDLLAVLKEGEAVEIYKLQATTTRTTDPFAPPSAGQMISSMQRAALLPGATLALSGGRNTSARPLVSSASKQKAVKSCPPSDVIDEKLIERVYRPRNAMSVADVQHLCVSNSSDFHVPLTDQNTPIEVDLRCVVVAVHQSHATDIPLHTKSDPKAVEPSTAIGQRSTTTSEVDSVYVTDANSSSDGCLLVVKIWGGLQAHHLSNLLQKGQAVHFTDLQLRR 1454          
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Cavefish
Match: brca2 (BRCA2 DNA repair associated [Source:ZFIN;Acc:ZDB-GENE-060510-3])

HSP 1 Score: 186.422 bits (472), Expect = 6.957e-47
Identity = 154/588 (26.19%), Postives = 263/588 (44.73%), Query Frame = 2
Query: 1847 LFPMRKLFKLAAPASVEEAAGEHID-----FMSCIHVRFYCDQSVVSLDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFIEK-------------------IENDSFKVLVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMET----IYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHLGQKKDK-----VTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVSD---ALQEK--------------CPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGKLDXXXXXXXXXXXXXXXXXTTRFERNKEIHENLISKIYQSRQLFSITNACQFLSDTSTACEIDCIGIVIAF 3460
            L    KL++      V +   E+ +     F        + D + V L   D G ++PD  G +G  +F  +    P VDPKL+S  W+ NHY+ ++WK   ++  + + +    L+P  ++LQLK RYD E+D ++R  L+KI E+DDT  K LVL V    K                    E+ +  + ++DGWY + A+ D  L   +   ++  G K++   A   G  +   LP++  P    LK+  NSTRRAR  +KLG+  + +PF + L SL  NGG    ++V+              V R YP Q+ME     ++         VFRNERAE+   ++    K+  +     ++ +     ++     +++ +     +  + +GE++   + N  D       LS  Q   +  YR  +       LQE+              CPNR+V  + ++ +      D+ SN      +W+P+ +L +LL EG   K Y +  +  K       S +A+V   +   T+F+  +   E L++  + +RQ F+I    Q  + +S   E+D +G VI+ 
Sbjct: 1806 LHSQEKLYQYGVHCQVSQITAENAELFRFNFDDFFKREMFIDNTGVQL--ADGGWLIPDNRGTVGKEEFYKAMCDTPGVDPKLMSEAWVFNHYRWVVWKRACMERTFPEVMGGRCLTPEQVLLQLKLRYDTEVDNSRRSALKKIMERDDTPAKTLVLAVCGFAKSSSSPVNSEKAVGTPDSKTSESTAAIIWLTDGWYSIKALLDPPLSSMLQKGRLSIGGKVMIHGAELIGSQD-ACLPLEA-PDSLMLKISANSTRRARWDSKLGFYKDPRPFSLPLSSLYSNGGVVGCVDVI--------------VLRSYPTQWMEKRTGGVF---------VFRNERAEDREARRHSSAKQKTMELLFTRIQAQFEKEEEEKKKTRRRKRFRRCDIHSMQDGEELYEAMEN--DPAYVEAHLSAQQMEAVSSYRRVMADRRQVQLQERMQKSVQEAQESEGLCPNRDVTPVWKLTIADF--SDLHSNCTYTLNIWRPSLELRSLLKEGCRYKAYYLSTSETK-----KRSGTANVQFTATKKTQFQDIEVCPEWLMAN-FPARQ-FTIFRDLQNSAFSSPCGEVDVVGYVISI 2355          
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Cavefish
Match: brca2 (BRCA2 DNA repair associated [Source:ZFIN;Acc:ZDB-GENE-060510-3])

HSP 1 Score: 186.422 bits (472), Expect = 7.907e-47
Identity = 152/582 (26.12%), Postives = 268/582 (46.05%), Query Frame = 2
Query: 1847 LFPMRKLFKLAAPASVEEAAGEHID-----FMSCIHVRFYCDQSVVSLDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFIEK-------------------IENDSFKVLVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMET----IYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHLGQKKDK-----VTDLCNGEDIMNWLNN-----SMDQESALTE----LSFNQQNMLRIYRENLVSDALQEK--CPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGKLDXXXXXXXXXXXXXXXXXTTRFERNKEIHENLISKIYQSRQLFSITNACQFLSDTSTACEIDCIGIVIAF 3460
            L    KL++      V +   E+ +     F        + D + V L   D G ++PD  G +G  +F  +    P VDPKL+S  W+ NHY+ ++WK   ++  + + +    L+P  ++LQLK RYD E+D ++R  L+KI E+DDT  K LVL V    K                    E+ +  + ++DGWY + A+ D  L   +   ++  G K++   A   G  +   LP++  P    LK+  NSTRRAR  +KLG+  + +PF + L SL  NGG    ++V+              V R YP Q+ME     ++         VFRNERAE+   ++    K+  +     ++ +     ++     +++ +     +  + +GE++   + N     S  Q  A++     ++  +Q  L+   +  V +A + +  CPNR+V  + ++ +      D+ SN      +W+P+ +L +LL EG   K Y +  +  K       S +A+V   +   T+F+  +   E L++  + +RQ F+I    Q  + +S   E+D +G VI+ 
Sbjct: 1683 LHSQEKLYQYGVHCQVSQITAENAELFRFNFDDFFKREMFIDNTGVQL--ADGGWLIPDNRGTVGKEEFYKAMCDTPGVDPKLMSEAWVFNHYRWVVWKRACMERTFPEVMGGRCLTPEQVLLQLKLRYDTEVDNSRRSALKKIMERDDTPAKTLVLAVCGFAKSSSSPVNSEKAVGTPDSKTSESTAAIIWLTDGWYSIKALLDPPLSSMLQKGRLSIGGKVMIHGAELIGSQD-ACLPLEA-PDSLMLKISANSTRRARWDSKLGFYKDPRPFSLPLSSLYSNGGVVGCVDVI--------------VLRSYPTQWMEKRTGGVF---------VFRNERAEDREARRHSSAKQKTMELLFTRIQAQFEKEEEEKKKTRRRKRFRRCDIHSMQDGEELYEAMENDPAHLSAQQMEAVSSYRRVMADRRQVQLQERMQKSVQEAQESEGLCPNRDVTPVWKLTIADF--SDLHSNCTYTLNIWRPSLELRSLLKEGCRYKAYYLSTSETK-----KRSGTANVQFTATKKTQFQDIEVCPEWLMAN-FPARQ-FTIFRDLQNSAFSSPCGEVDVVGYVISI 2228          
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Nematostella
Match: EDO34687 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNN6])

HSP 1 Score: 203.756 bits (517), Expect = 2.794e-56
Identity = 140/474 (29.54%), Postives = 222/474 (46.84%), Query Frame = 2
Query: 1943 RFYCDQSVVSLDVG----DNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFI------------EKIENDSF---------------KVLVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTN----------KKRYHLGQKKDKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVSDALQEKCPNRNVVTLLRILVGGCLAVDVDSNQ------VAIFTLWKPNDDLMTLLVEGASIKLY 3223
            R +C +   + + G    D G++     G +GL +   +F+G P VDP L+   W+ NH++ I+WKL AL++ + Q  A   L+P  +M QLKYRYD EID + R  L+K+ E+DD + K +VL V+ +             KI +D                  + V+DGWY V A  D+ L   +   +I  G KL    A   G D+P V P++  P    L+LH NSTRRA+  A+LG+Q +  PFP+ LGSL  +GG    ++VV              V R YPL++ME +          VFR  RAE+     + + +E      L ++   + +            KR         V  L  G++I   LN++ D  +    L  +Q   L+ YR  L+ +  ++    R      + + G     D+ S        VA  ++W+P++++M +L EG+ +K+Y
Sbjct:   32 RAFCSEHARATEGGIRTEDGGLVRLGSDGRVGLEEIEAAFLGTPGVDPSLVCTGWVANHFRWIVWKLAALEVSFPQCFAGRCLTPDWVMCQLKYRYDLEIDRSHRSALKKVLERDDASTKTMVLCVSGVNPPDLNQENGTSNKITDDEATPIRGSTPLRHQTCGTITVTDGWYSVQASLDRPLDHLVRTGQIHVGQKLCVNGAELIGYDQP-VSPLE-APNSLMLRLHANSTRRAQWNARLGFQRHSHPFPLPLGSLFADGGAVGCVDVV--------------VLRTYPLEFMEKLSDGTT-----VFRCARAEDRESNHYHMEQERAREDLLSRVQREIESEAGQTDSLPKLSKRMRRSCSTRDVMKLTGGKEINEALNSAPDPSTLEECLDCDQLRSLQEYRRTLMEEQRRDM-EERFQQAWQKHIQGVGGGHDIISTALLFLLPVATLSIWRPSEEIMQMLTEGSRLKIY 483          
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Medaka
Match: brca2 (BRCA2 DNA repair associated [Source:NCBI gene;Acc:101156345])

HSP 1 Score: 206.838 bits (525), Expect = 5.254e-53
Identity = 139/456 (30.48%), Postives = 214/456 (46.93%), Query Frame = 2
Query: 1979 VGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFIE--------------KIENDSFKVLVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHLGQKKDK---VTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVS-----------DALQE-----KCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGK 3247
            + D G ++P + G  G  +F  +    P VDPKLI+  W  NHY+ I+WK  +++  + + +    L+P  ++LQLKYRYD E+D ++RP LRKI E+DDTA K LVL V  I               K +  +  V ++DGWY + A  D+ L   +    +  G KL++  A   G  +    P    P    LK+  NSTRRAR   KLG+  + +PF + + SL  NGG     +VV              V R YP+Q+ME            VFR  RAEE   ++FD +K   +     K+ +     ++  +   ++ +   V  L +GE++   + +  D       LS  Q   L  Y+ +L+             AL+E     KCP R+V  + R+ V   L      + V   +LW+P+ D+ +LL EG   K+Y++    GK
Sbjct: 2416 LADGGCLIPSKDGTAGKEEFFRALCDTPGVDPKLITEAWGYNHYKWIIWKQASMEKSFPERMGGICLTPEQVLLQLKYRYDVEVDHSRRPALRKITEKDDTAAKTLVLCVCGIASKGGGASGSESSDPKTQAPTAVVWLTDGWYAIKAQLDQPLTAMLNKGLLAVGGKLITHGAQLVGSQD--ACPPLEAPESLMLKICANSTRRARWDTKLGFHRDPRPFLLPIASLFSNGGPVGCADVV--------------VLRSYPVQWMERKADGG-----VVFRTTRAEEKEARRFDEMKHKAMEVLFAKVQAEFENEEREKNKSLRRKQNLDVAKLQDGEELHAAVGD--DPTYLEAHLSEQQLQTLHAYKRSLMERKQAELQDRYHRALEEDDQEIKCPKRDVTPVWRLSVADSLGP---PSCVYQLSLWRPSSDVESLLKEGGRYKVYNLATAEGK 2845          
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Medaka
Match: brca2 (BRCA2 DNA repair associated [Source:NCBI gene;Acc:101156345])

HSP 1 Score: 206.453 bits (524), Expect = 5.299e-53
Identity = 139/456 (30.48%), Postives = 214/456 (46.93%), Query Frame = 2
Query: 1979 VGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFIE--------------KIENDSFKVLVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHLGQKKDK---VTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVS-----------DALQE-----KCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGK 3247
            + D G ++P + G  G  +F  +    P VDPKLI+  W  NHY+ I+WK  +++  + + +    L+P  ++LQLKYRYD E+D ++RP LRKI E+DDTA K LVL V  I               K +  +  V ++DGWY + A  D+ L   +    +  G KL++  A   G  +    P    P    LK+  NSTRRAR   KLG+  + +PF + + SL  NGG     +VV              V R YP+Q+ME            VFR  RAEE   ++FD +K   +     K+ +     ++  +   ++ +   V  L +GE++   + +  D       LS  Q   L  Y+ +L+             AL+E     KCP R+V  + R+ V   L      + V   +LW+P+ D+ +LL EG   K+Y++    GK
Sbjct: 2293 LADGGCLIPSKDGTAGKEEFFRALCDTPGVDPKLITEAWGYNHYKWIIWKQASMEKSFPERMGGICLTPEQVLLQLKYRYDVEVDHSRRPALRKITEKDDTAAKTLVLCVCGIASKGGGASGSESSDPKTQAPTAVVWLTDGWYAIKAQLDQPLTAMLNKGLLAVGGKLITHGAQLVGSQD--ACPPLEAPESLMLKICANSTRRARWDTKLGFHRDPRPFLLPIASLFSNGGPVGCADVV--------------VLRSYPVQWMERKADGG-----VVFRTTRAEEKEARRFDEMKHKAMEVLFAKVQAEFENEEREKNKSLRRKQNLDVAKLQDGEELHAAVGD--DPTYLEAHLSEQQLQTLHAYKRSLMERKQAELQDRYHRALEEDDQEIKCPKRDVTPVWRLSVADSLGP---PSCVYQLSLWRPSSDVESLLKEGGRYKVYNLATAEGK 2722          
BLAST of breast cancer type 2 susceptibility protein homolog vs. Planmine SMEST
Match: SMESG000039871.1 (SMESG000039871.1)

HSP 1 Score: 1787.31 bits (4628), Expect = 0.000e+0
Identity = 894/919 (97.28%), Postives = 898/919 (97.71%), Query Frame = 2
Query: 1451 QEQLLETDLIMKEVENMECSWDYVETSDSWNNDRTVNCLSNLIQSPIINKTARSITDQKAHLLSSTPIRKSKPDIHVRSINSFSENFDVESNSLANRVNASIKLQEATASKCITEISPNAGRFSRLRLNRSQLFPMRKLFKLAAPASVEEAAGEHIDFMSCIHVRFYCDQSVVSLDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFIEKIENDSFKVLVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHLGQKKDKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVSDALQEKCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGKLDXXXXXXXXXXXXXXXXXTTRFERNKEIHENLISKIYQSRQLFSITNACQFLSDTSTACEIDCIGIVIAFSKVNTTSNDSWQHVVLSDPDDMDNGIILVKLWGGLKGNFLTSVIEIGNFVKFFNLQYRKSVYSKFNPNSKIPAFECHYNTHSNVVYVSRKWDFHAMKQSIGEKLEKCLPAFEIFTNDKHNSIKXXXXXXXXXXXXKNKLIKNHGNSLNVSELKSNLSLNIAASTPKRLGLSSKRILKTTTLETIFQKNELLKSTGIEESKIQTDIPKPSNSSSYNYHDSFGMDSSIAELVKIRKRTSTVNASYFINKKK 4207
            +EQLLETDLIMKEVENMECSWDYVETSDSWNNDRTVNCLSNLIQSPIINKT  SIT+QKAHLLSSTPIRKSKPDIHVRSINSFSENFDVESNSLANRVNASIKLQEATASKCITEISPNAGRFSRLRLNRSQLFPMRKLFKLAAPASVEEAAGEHIDFMSCIHVRFYCDQSVVSLDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFIEKIENDSFKV VSDGWYCVPAIFDKFLKDQIINKKIKPGTKL+SCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVIN              RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHLGQKKDKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVSDAL EKCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGKLDAQFSASSSASVALNSISTTRFERNKEIHENLISKIYQSRQLFSITNACQFLSDTSTACEIDCIGIVIAFSKVNTTSNDSWQHVVLSDPDDMDNGIILVKLWGGLKGNFLTSVIEIGNFVKFFNLQYRKSVYSKFNP SK PAFECHYNTHSNVVYVSRKWDFHAMKQSIGEKLEKCLPAFEIFTNDK+NSIKSLSSRTLSPLTPKNKLIKNHGNSLNVSELKSNLSLNIAASTPKRLGLSSKRILKTTTLETI QKNELLKSTGIEESKIQTDIPKPSNSSSYNYHDSFGMDSSIAELVKIRKRTSTVNASYFINKKK
Sbjct:  446 KEQLLETDLIMKEVENMECSWDYVETSDSWNNDRTVNCLSNLIQSPIINKTTGSITNQKAHLLSSTPIRKSKPDIHVRSINSFSENFDVESNSLANRVNASIKLQEATASKCITEISPNAGRFSRLRLNRSQLFPMRKLFKLAAPASVEEAAGEHIDFMSCIHVRFYCDQSVVSLDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFIEKIENDSFKVFVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLISCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVIN--------------RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHLGQKKDKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVSDALLEKCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGKLDAQFSASSSASVALNSISTTRFERNKEIHENLISKIYQSRQLFSITNACQFLSDTSTACEIDCIGIVIAFSKVNTTSNDSWQHVVLSDPDDMDNGIILVKLWGGLKGNFLTSVIEIGNFVKFFNLQYRKSVYSKFNPTSKTPAFECHYNTHSNVVYVSRKWDFHAMKQSIGEKLEKCLPAFEIFTNDKYNSIKSLSSRTLSPLTPKNKLIKNHGNSLNVSELKSNLSLNIAASTPKRLGLSSKRILKTTTLETISQKNELLKSTGIEESKIQTDIPKPSNSSSYNYHDSFGMDSSIAELVKIRKRTSTVNASYFINKKK 1350          

HSP 2 Score: 816.994 bits (2109), Expect = 0.000e+0
Identity = 445/468 (95.09%), Postives = 451/468 (96.37%), Query Frame = 1
Query:  118 MNSEDDLFDFDYSQKDNSNINSTTSVLNDIFEVTQKQIKMNANIVNLTKKCAINTLLNSEFNYKKFIYPSNDDIIKEMEDTKNPNINCKSVVPDETCSQLDPEILRQFDIPMTLPHENIETRYENSPVHEISKELNKNIYVNSDFEVDLDLSIVSEENQKEIEFDNQEIFSDFKTETRKRKAIPFNXXXXXXXXXXXXVTNNKMACFGFKTGTGKQVSISKLAEQKAKQLFEEIEEKEIIVDQDESINLNRIVFNPSTNTDNQISKTKSTLIHKEXXXXXXXXXXXXXGFATATGRIIPKSKSALNQAKKLLNEIEEYGHENIFEPVEFKSNLAEPFCPSKMSGIEIETNSNQSHSNKENKEFIGFKTGTGRAISVSESAKLTYQRMLENVAKEISFEESAVSKETPHLNTTENLGDTDSIYKFDSDKAATIIHPDNGGTVSKLSR-------TVIRNRSNYEGSGKY 1500
            MNSEDDLFDFDYSQKDNSNINSTTSVLNDIFEVTQKQIKMNANIVNLTKKCAINTLLNSEFNYKKFIYPSNDDIIKEMEDTKNPNINCKSVVP+ETCSQLDPEILRQFDIPMTLPHENIETRYEN PVHEISKELNKNIYVNSDFEVDLDLSIVSEENQKEIEF+NQEIFSDFKTETRKRKAIPFNEHSIEESEYISEVTNNKMACFGFKTGTGKQVSISKLAEQKAKQLFEEIEEKEIIVDQDESINLNRIVFNPSTN DNQISKTKSTLIHKETSSRNVSSSTVTVGFATATGRIIPKSKSALNQAKKLLNEIEEYGHENIFEPVEFKSNLAEPFCPSKMSGIEIETNSNQSHSNKENKEFIGFKTGTGRAISVSESAKLTYQRMLENVAKEISFEESAVSKETPHLNTTENLGDTDSIYKFDSDKAATIIHPDNGGTVSKLS+        +++   N E S  Y
Sbjct:    1 MNSEDDLFDFDYSQKDNSNINSTTSVLNDIFEVTQKQIKMNANIVNLTKKCAINTLLNSEFNYKKFIYPSNDDIIKEMEDTKNPNINCKSVVPNETCSQLDPEILRQFDIPMTLPHENIETRYENFPVHEISKELNKNIYVNSDFEVDLDLSIVSEENQKEIEFENQEIFSDFKTETRKRKAIPFNEHSIEESEYISEVTNNKMACFGFKTGTGKQVSISKLAEQKAKQLFEEIEEKEIIVDQDESINLNRIVFNPSTNADNQISKTKSTLIHKETSSRNVSSSTVTVGFATATGRIIPKSKSALNQAKKLLNEIEEYGHENIFEPVEFKSNLAEPFCPSKMSGIEIETNSNQSHSNKENKEFIGFKTGTGRAISVSESAKLTYQRMLENVAKEISFEESAVSKETPHLNTTENLGDTDSIYKFDSDKAATIIHPDNGGTVSKLSKEQLLETDLIMKEVENMECSWDY 468          
BLAST of breast cancer type 2 susceptibility protein homolog vs. Planmine SMEST
Match: SMESG000039871.1 (SMESG000039871.1)

HSP 1 Score: 1766.13 bits (4573), Expect = 0.000e+0
Identity = 883/908 (97.25%), Postives = 887/908 (97.69%), Query Frame = 2
Query: 1451 QEQLLETDLIMKEVENMECSWDYVETSDSWNNDRTVNCLSNLIQSPIINKTARSITDQKAHLLSSTPIRKSKPDIHVRSINSFSENFDVESNSLANRVNASIKLQEATASKCITEISPNAGRFSRLRLNRSQLFPMRKLFKLAAPASVEEAAGEHIDFMSCIHVRFYCDQSVVSLDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFIEKIENDSFKVLVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFSSEFSLISV*RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHLGQKKDKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVSDALQEKCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGKLDXXXXXXXXXXXXXXXXXTTRFERNKEIHENLISKIYQSRQLFSITNACQFLSDTSTACEIDCIGIVIAFSKVNTTSNDSWQHVVLSDPDDMDNGIILVKLWGGLKGNFLTSVIEIGNFVKFFNLQYRKSVYSKFNPNSKIPAFECHYNTHSNVVYVSRKWDFHAMKQSIGEKLEKCLPAFEIFTNDKHNSIKXXXXXXXXXXXXKNKLIKNHGNSLNVSELKSNLSLNIAASTPKRLGLSSKRILKTTTLETIFQKNELLKSTGIEESKIQTDIPKPSNSSSYNYHDSFGMDSSIAELVKIRKRTST 4174
            +EQLLETDLIMKEVENMECSWDYVETSDSWNNDRTVNCLSNLIQSPIINKT  SIT+QKAHLLSSTPIRKSKPDIHVRSINSFSENFDVESNSLANRVNASIKLQEATASKCITEISPNAGRFSRLRLNRSQLFPMRKLFKLAAPASVEEAAGEHIDFMSCIHVRFYCDQSVVSLDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFIEKIENDSFKV VSDGWYCVPAIFDKFLKDQIINKKIKPGTKL+SCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVIN              RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHLGQKKDKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVSDAL EKCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGKLDAQFSASSSASVALNSISTTRFERNKEIHENLISKIYQSRQLFSITNACQFLSDTSTACEIDCIGIVIAFSKVNTTSNDSWQHVVLSDPDDMDNGIILVKLWGGLKGNFLTSVIEIGNFVKFFNLQYRKSVYSKFNP SK PAFECHYNTHSNVVYVSRKWDFHAMKQSIGEKLEKCLPAFEIFTNDK+NSIKSLSSRTLSPLTPKNKLIKNHGNSLNVSELKSNLSLNIAASTPKRLGLSSKRILKTTTLETI QKNELLKSTGIEESKIQTDIPKPSNSSSYNYHDSFGMDSSIAELVKIRKRTST
Sbjct:  446 KEQLLETDLIMKEVENMECSWDYVETSDSWNNDRTVNCLSNLIQSPIINKTTGSITNQKAHLLSSTPIRKSKPDIHVRSINSFSENFDVESNSLANRVNASIKLQEATASKCITEISPNAGRFSRLRLNRSQLFPMRKLFKLAAPASVEEAAGEHIDFMSCIHVRFYCDQSVVSLDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKLISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEIDLAKRPCLRKICEQDDTANKRLVLVVAFIEKIENDSFKVFVSDGWYCVPAIFDKFLKDQIINKKIKPGTKLISCNAVWTGCDEPLVLPVDHFPPGCGLKLHGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVIN--------------RIYPLQYMETIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVSTNKKRYHLGQKKDKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRIYRENLVSDALLEKCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPNDDLMTLLVEGASIKLYSVGVTHGKLDAQFSASSSASVALNSISTTRFERNKEIHENLISKIYQSRQLFSITNACQFLSDTSTACEIDCIGIVIAFSKVNTTSNDSWQHVVLSDPDDMDNGIILVKLWGGLKGNFLTSVIEIGNFVKFFNLQYRKSVYSKFNPTSKTPAFECHYNTHSNVVYVSRKWDFHAMKQSIGEKLEKCLPAFEIFTNDKYNSIKSLSSRTLSPLTPKNKLIKNHGNSLNVSELKSNLSLNIAASTPKRLGLSSKRILKTTTLETISQKNELLKSTGIEESKIQTDIPKPSNSSSYNYHDSFGMDSSIAELVKIRKRTST 1339          

HSP 2 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 445/468 (95.09%), Postives = 451/468 (96.37%), Query Frame = 1
Query:  118 MNSEDDLFDFDYSQKDNSNINSTTSVLNDIFEVTQKQIKMNANIVNLTKKCAINTLLNSEFNYKKFIYPSNDDIIKEMEDTKNPNINCKSVVPDETCSQLDPEILRQFDIPMTLPHENIETRYENSPVHEISKELNKNIYVNSDFEVDLDLSIVSEENQKEIEFDNQEIFSDFKTETRKRKAIPFNXXXXXXXXXXXXVTNNKMACFGFKTGTGKQVSISKLAEQKAKQLFEEIEEKEIIVDQDESINLNRIVFNPSTNTDNQISKTKSTLIHKEXXXXXXXXXXXXXGFATATGRIIPKSKSALNQAKKLLNEIEEYGHENIFEPVEFKSNLAEPFCPSKMSGIEIETNSNQSHSNKENKEFIGFKTGTGRAISVSESAKLTYQRMLENVAKEISFEESAVSKETPHLNTTENLGDTDSIYKFDSDKAATIIHPDNGGTVSKLSR-------TVIRNRSNYEGSGKY 1500
            MNSEDDLFDFDYSQKDNSNINSTTSVLNDIFEVTQKQIKMNANIVNLTKKCAINTLLNSEFNYKKFIYPSNDDIIKEMEDTKNPNINCKSVVP+ETCSQLDPEILRQFDIPMTLPHENIETRYEN PVHEISKELNKNIYVNSDFEVDLDLSIVSEENQKEIEF+NQEIFSDFKTETRKRKAIPFNEHSIEESEYISEVTNNKMACFGFKTGTGKQVSISKLAEQKAKQLFEEIEEKEIIVDQDESINLNRIVFNPSTN DNQISKTKSTLIHKETSSRNVSSSTVTVGFATATGRIIPKSKSALNQAKKLLNEIEEYGHENIFEPVEFKSNLAEPFCPSKMSGIEIETNSNQSHSNKENKEFIGFKTGTGRAISVSESAKLTYQRMLENVAKEISFEESAVSKETPHLNTTENLGDTDSIYKFDSDKAATIIHPDNGGTVSKLS+        +++   N E S  Y
Sbjct:    1 MNSEDDLFDFDYSQKDNSNINSTTSVLNDIFEVTQKQIKMNANIVNLTKKCAINTLLNSEFNYKKFIYPSNDDIIKEMEDTKNPNINCKSVVPNETCSQLDPEILRQFDIPMTLPHENIETRYENFPVHEISKELNKNIYVNSDFEVDLDLSIVSEENQKEIEFENQEIFSDFKTETRKRKAIPFNEHSIEESEYISEVTNNKMACFGFKTGTGKQVSISKLAEQKAKQLFEEIEEKEIIVDQDESINLNRIVFNPSTNADNQISKTKSTLIHKETSSRNVSSSTVTVGFATATGRIIPKSKSALNQAKKLLNEIEEYGHENIFEPVEFKSNLAEPFCPSKMSGIEIETNSNQSHSNKENKEFIGFKTGTGRAISVSESAKLTYQRMLENVAKEISFEESAVSKETPHLNTTENLGDTDSIYKFDSDKAATIIHPDNGGTVSKLSKEQLLETDLIMKEVENMECSWDY 468          
The following BLAST results are available for this feature:
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
BRCA21.446e-4728.04BRCA2 DNA repair associated [Source:HGNC Symbol;Ac... [more]
BRCA21.446e-4728.04BRCA2 DNA repair associated [Source:HGNC Symbol;Ac... [more]
BRCA29.841e-4336.53BRCA2 DNA repair associated [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
brca21.363e-5231.13BRCA2 DNA repair associated [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
stard95.416e-5027.03StAR related lipid transfer domain containing 9 [S... [more]
stard95.884e-5027.03StAR related lipid transfer domain containing 9 [S... [more]
back to top
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Brca22.276e-4728.33breast cancer 2, early onset [Source:MGI Symbol;Ac... [more]
Brca22.276e-4728.33breast cancer 2, early onset [Source:MGI Symbol;Ac... [more]
back to top
BLAST of breast cancer type 2 susceptibility protein homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O35923|BRCA2_RAT2.666e-5030.32Breast cancer type 2 susceptibility protein homolo... [more]
sp|P51587|BRCA2_HUMAN6.221e-4728.04Breast cancer type 2 susceptibility protein OS=Hom... [more]
sp|P97929|BRCA2_MOUSE1.592e-4628.33Breast cancer type 2 susceptibility protein homolo... [more]
sp|Q864S8|BRCA2_FELCA1.546e-4326.26Breast cancer type 2 susceptibility protein homolo... [more]
sp|Q7Y1C5|BRC2A_ARATH4.065e-2125.00Protein BREAST CANCER SUSCEPTIBILITY 2 homolog A O... [more]
back to top
BLAST of breast cancer type 2 susceptibility protein homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X9SRF70.000e+094.54Putative BRCA2 OS=Schmidtea mediterranea OX=79327 ... [more]
A0A1S3JJD81.254e-7127.73breast cancer type 2 susceptibility protein homolo... [more]
A0A3R7H2N94.254e-6928.83Breast cancer type 2 susceptibility-like protein O... [more]
G7YE821.267e-6828.83Breast cancer 2 susceptibility protein OS=Clonorch... [more]
A0A4S2KYU91.191e-6628.55Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
brca26.957e-4726.19BRCA2 DNA repair associated [Source:ZFIN;Acc:ZDB-G... [more]
brca27.907e-4726.12BRCA2 DNA repair associated [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO346872.794e-5629.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of breast cancer type 2 susceptibility protein homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
brca25.254e-5330.48BRCA2 DNA repair associated [Source:NCBI gene;Acc:... [more]
brca25.299e-5330.48BRCA2 DNA repair associated [Source:NCBI gene;Acc:... [more]
back to top
BLAST of breast cancer type 2 susceptibility protein homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000039871.10.000e+097.28SMESG000039871.1[more]
SMESG000039871.10.000e+097.25SMESG000039871.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034558 ID=SMED30034558|Name=breast cancer type 2 susceptibility protein homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=4339bp
CGAAAATATTTTGAATTCATTACTTTTGAAAATAATAATTTTGAATATTA
AATTTATAAAATTGTCTTTCATTTTAAATTATTAAATCTCATATTAAATC
TCAATTTGATTTTTAAAATGAATAGTGAAGACGATTTATTTGATTTCGAT
TATTCACAGAAGGATAATTCGAATATCAATAGTACTACCTCGGTACTTAA
TGATATATTTGAAGTGACACAAAAACAAATAAAAATGAATGCCAATATAG
TTAATTTGACAAAGAAATGCGCGATTAATACACTTTTAAATTCAGAATTT
AATTACAAAAAATTCATTTATCCATCAAATGATGATATCATAAAAGAAAT
GGAAGATACTAAAAATCCAAATATTAATTGCAAATCTGTAGTACCAGATG
AAACATGTAGTCAGTTAGATCCTGAAATTTTACGACAATTTGACATTCCA
ATGACGCTTCCGCACGAAAATATTGAAACTCGATATGAAAATTCTCCTGT
TCATGAAATTTCAAAGGAATTGAATAAAAATATATATGTTAATAGTGATT
TCGAAGTAGATTTGGATCTCTCTATTGTTTCGGAAGAAAATCAAAAAGAA
ATTGAATTTGACAATCAAGAAATATTTAGTGATTTTAAAACAGAAACTAG
AAAAAGAAAAGCTATTCCATTTAATGAGCATTCTATAGAAGAAAGTGAAT
ATATCAGTGAAGTTACCAACAACAAAATGGCATGCTTTGGGTTTAAAACT
GGAACCGGTAAACAAGTTTCAATTTCAAAATTAGCTGAACAGAAAGCAAA
GCAATTATTTGAAGAAATTGAAGAAAAGGAAATTATTGTTGATCAAGATG
AATCAATAAATTTAAATAGAATTGTTTTCAATCCATCAACAAATACTGAC
AACCAAATATCGAAAACAAAATCAACACTAATTCATAAAGAAACATCATC
CAGGAATGTTTCTTCGTCAACAGTTACTGTTGGATTTGCTACAGCTACTG
GTCGTATAATCCCAAAATCCAAATCAGCTCTGAACCAAGCCAAAAAACTT
CTAAACGAAATTGAAGAATATGGCCATGAAAATATTTTCGAACCGGTTGA
ATTCAAATCGAATCTCGCTGAACCATTCTGTCCATCAAAAATGTCCGGAA
TAGAAATTGAAACAAATTCCAACCAATCACATTCAAATAAAGAAAATAAA
GAATTTATTGGATTTAAAACAGGCACTGGTCGTGCTATTTCAGTGTCGGA
GTCAGCAAAACTAACCTACCAAAGAATGTTGGAAAATGTTGCCAAGGAGA
TTAGTTTCGAAGAATCTGCTGTTTCTAAGGAAACCCCTCACCTGAATACT
ACTGAAAATCTTGGTGATACAGATTCAATATACAAATTCGATAGTGACAA
AGCAGCAACGATAATTCACCCTGACAACGGTGGAACGGTTTCCAAGCTGT
CAAGAACAGTTATTAGAAACCGATCTAATTATGAAGGAAGTGGAAAATAT
GGAGTGTTCTTGGGATTATGTTGAAACTTCTGACTCTTGGAATAACGACC
GCACAGTAAATTGCCTCAGCAATTTGATCCAATCGCCGATCATCAATAAA
ACTGCGAGATCAATAACAGATCAAAAAGCGCATTTGCTTAGCAGCACCCC
GATTAGGAAATCAAAACCCGATATTCACGTCCGTTCAATAAACAGCTTCA
GTGAAAACTTTGATGTCGAATCCAATTCATTGGCTAATCGTGTCAATGCA
TCGATTAAACTCCAAGAAGCGACTGCAAGCAAATGCATAACTGAGATCTC
CCCCAATGCCGGTCGGTTTTCACGACTACGTTTAAATAGGTCGCAATTAT
TCCCGATGAGGAAATTGTTCAAATTGGCGGCACCGGCAAGTGTCGAGGAG
GCTGCTGGTGAGCATATCGATTTCATGTCTTGCATTCACGTGAGGTTCTA
CTGCGATCAGTCTGTAGTGTCATTGGATGTTGGAGATAATGGAGTCATCG
TGCCCGATGAGGGAGGTTACATTGGGTTACCGCAATTTATTGACTCATTT
ATGGGTTTGCCTAATGTTGATCCAAAACTTATATCTGCCGAATGGATTAA
AAATCATTATCAGATGATTCTTTGGAAGTTAATGGCATTAGATATGCGTT
ACCGGCAGTATCTAGCTGATGATTGGCTATCTCCCCATCATATAATGTTA
CAGTTGAAATATCGTTACGACAAGGAAATAGATCTTGCAAAGAGACCCTG
CTTGAGGAAAATCTGTGAACAGGATGACACTGCAAATAAAAGATTAGTTT
TGGTTGTTGCCTTTATTGAAAAAATTGAAAATGACTCTTTTAAAGTTCTT
GTTTCTGACGGATGGTACTGTGTTCCGGCTATTTTTGATAAGTTCTTGAA
AGATCAAATAATTAACAAGAAAATCAAACCAGGAACAAAACTCGTCTCAT
GTAATGCTGTATGGACGGGATGTGATGAGCCACTAGTACTTCCGGTTGAT
CATTTTCCTCCTGGTTGTGGTCTTAAACTTCATGGAAATTCTACTCGTCG
TGCAAGAGCTTTTGCTAAATTAGGGTATCAATCTAACCTTAAACCGTTTC
CAGTTACTTTAGGAAGTTTGAATCCAAATGGAGGAACTGCTTCTTTAATA
AATGTCGTAATCAATGTTGGAAAATTTAGCTCAGAATTCTCATTAATTTC
CGTTTAGAGAATTTATCCTCTTCAATATATGGAAACGATTTACCACCCGA
ATCAAGATATTCCACAGAGAGTTTTTCGGAATGAAAGAGCTGAAGAATTT
TCTCGAAAACAATTTGACCTATTAAAAGAAAACATTATAAATACCACTTT
GGAGAAAATGATGTCTTCAGTTTCTACAAATAAGAAACGTTATCATTTAG
GTCAAAAGAAAGACAAAGTTACAGATCTATGTAACGGAGAAGATATTATG
AACTGGTTAAACAATTCGATGGATCAAGAATCAGCTCTGACAGAATTATC
TTTCAATCAACAAAACATGCTCAGAATATACAGAGAAAACTTAGTGTCTG
ACGCTCTGCAAGAAAAATGTCCAAATCGGAACGTAGTAACATTGTTGAGA
ATTCTTGTCGGTGGATGTCTAGCTGTTGATGTTGACTCTAACCAAGTTGC
CATATTTACTCTCTGGAAGCCAAATGATGACTTAATGACATTGCTCGTGG
AAGGTGCATCAATAAAGTTATATTCTGTTGGGGTTACCCATGGAAAACTC
GATGCCCAATTTTCTGCTAGTAGTAGTGCCTCAGTTGCTTTAAATAGTAT
TTCAACGACAAGATTTGAACGAAATAAAGAAATTCATGAAAATCTGATCT
CAAAAATTTATCAATCTCGCCAATTATTCTCAATTACCAATGCCTGCCAA
TTTCTATCGGATACATCTACAGCATGTGAAATCGATTGTATTGGCATTGT
GATAGCATTTAGTAAAGTGAATACAACCTCGAATGATTCTTGGCAACACG
TTGTTTTATCAGATCCGGATGATATGGATAATGGTATAATTCTGGTCAAG
CTCTGGGGTGGCTTGAAAGGAAATTTCTTGACAAGCGTCATTGAAATTGG
GAATTTCGTCAAATTTTTCAATTTGCAATATCGTAAATCAGTTTATTCAA
AATTCAATCCAAATTCTAAAATCCCTGCGTTTGAATGCCACTATAACACA
CACAGTAATGTTGTCTATGTTAGCAGAAAATGGGATTTTCATGCAATGAA
ACAATCGATAGGGGAAAAACTTGAGAAATGTTTGCCAGCGTTTGAAATAT
TTACCAACGACAAACATAATTCAATTAAGTCATTAAGTAGCAGAACGTTA
TCGCCATTAACTCCGAAAAATAAGCTTATTAAAAATCATGGCAATTCATT
GAATGTCTCTGAATTAAAGTCCAATCTTAGCCTTAACATAGCAGCTTCAA
CGCCTAAAAGATTAGGTCTCAGCAGTAAAAGGATATTAAAAACGACTACA
TTAGAAACCATTTTTCAGAAAAATGAGTTACTGAAATCAACTGGAATCGA
AGAAAGCAAAATCCAAACTGATATCCCTAAACCAAGTAACTCATCAAGCT
ATAATTATCACGACAGTTTTGGCATGGATTCTAGCATAGCAGAACTTGTC
AAAATACGTAAACGGACTTCAACGGTGAACGCATCATATTTTATTAATAA
AAAAAAATAAAATTTCACTATTTTTTGTTAATCGTTTGAAAAAAATCGAT
TGTTTGTTCGTTTATGTTGCTACGATTCTTTCCTCCGGATTCGCAATTCC
TTTCAATTCGTTGAGCGTTTTGTCGTTTTGATCGTTACT
back to top

protein sequence of SMED30034558-orf-1

>SMED30034558-orf-1 ID=SMED30034558-orf-1|Name=SMED30034558-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=409bp
MKEVENMECSWDYVETSDSWNNDRTVNCLSNLIQSPIINKTARSITDQKA
HLLSSTPIRKSKPDIHVRSINSFSENFDVESNSLANRVNASIKLQEATAS
KCITEISPNAGRFSRLRLNRSQLFPMRKLFKLAAPASVEEAAGEHIDFMS
CIHVRFYCDQSVVSLDVGDNGVIVPDEGGYIGLPQFIDSFMGLPNVDPKL
ISAEWIKNHYQMILWKLMALDMRYRQYLADDWLSPHHIMLQLKYRYDKEI
DLAKRPCLRKICEQDDTANKRLVLVVAFIEKIENDSFKVLVSDGWYCVPA
IFDKFLKDQIINKKIKPGTKLVSCNAVWTGCDEPLVLPVDHFPPGCGLKL
HGNSTRRARAFAKLGYQSNLKPFPVTLGSLNPNGGTASLINVVINVGKFS
SEFSLISV*
back to top

protein sequence of SMED30034558-orf-2

>SMED30034558-orf-2 ID=SMED30034558-orf-2|Name=SMED30034558-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=469bp
MNSEDDLFDFDYSQKDNSNINSTTSVLNDIFEVTQKQIKMNANIVNLTKK
CAINTLLNSEFNYKKFIYPSNDDIIKEMEDTKNPNINCKSVVPDETCSQL
DPEILRQFDIPMTLPHENIETRYENSPVHEISKELNKNIYVNSDFEVDLD
LSIVSEENQKEIEFDNQEIFSDFKTETRKRKAIPFNEHSIEESEYISEVT
NNKMACFGFKTGTGKQVSISKLAEQKAKQLFEEIEEKEIIVDQDESINLN
RIVFNPSTNTDNQISKTKSTLIHKETSSRNVSSSTVTVGFATATGRIIPK
SKSALNQAKKLLNEIEEYGHENIFEPVEFKSNLAEPFCPSKMSGIEIETN
SNQSHSNKENKEFIGFKTGTGRAISVSESAKLTYQRMLENVAKEISFEES
AVSKETPHLNTTENLGDTDSIYKFDSDKAATIIHPDNGGTVSKLSRTVIR
NRSNYEGSGKYGVFLGLC*
back to top

protein sequence of SMED30034558-orf-3

>SMED30034558-orf-3 ID=SMED30034558-orf-3|Name=SMED30034558-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=494bp
METIYHPNQDIPQRVFRNERAEEFSRKQFDLLKENIINTTLEKMMSSVST
NKKRYHLGQKKDKVTDLCNGEDIMNWLNNSMDQESALTELSFNQQNMLRI
YRENLVSDALQEKCPNRNVVTLLRILVGGCLAVDVDSNQVAIFTLWKPND
DLMTLLVEGASIKLYSVGVTHGKLDAQFSASSSASVALNSISTTRFERNK
EIHENLISKIYQSRQLFSITNACQFLSDTSTACEIDCIGIVIAFSKVNTT
SNDSWQHVVLSDPDDMDNGIILVKLWGGLKGNFLTSVIEIGNFVKFFNLQ
YRKSVYSKFNPNSKIPAFECHYNTHSNVVYVSRKWDFHAMKQSIGEKLEK
CLPAFEIFTNDKHNSIKSLSSRTLSPLTPKNKLIKNHGNSLNVSELKSNL
SLNIAASTPKRLGLSSKRILKTTTLETIFQKNELLKSTGIEESKIQTDIP
KPSNSSSYNYHDSFGMDSSIAELVKIRKRTSTVNASYFINKKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR015525BRCA2
IPR002093BRCA2_repeat
IPR012340NA-bd_OB-fold
IPR015188BRCA2_OB_3
IPR015252BRCA2_hlx
IPR015187BRCA2_OB_1
Vocabulary: biological process
TermDefinition
GO:0000724double-strand break repair via homologous recombination
GO:0006281DNA repair
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 220..240
NoneNo IPR availableCOILSCoilCoilcoord: 301..321
IPR002093BRCA2 repeatPFAMPF00634BRCA2coord: 205..235
e-value: 2.7E-7
score: 30.1
IPR002093BRCA2 repeatPROSITEPS50138BRCA2_REPEATcoord: 202..236
score: 12.711
IPR002093BRCA2 repeatPROSITEPS50138BRCA2_REPEATcoord: 283..317
score: 11.124
IPR015525Breast cancer type 2 susceptibility proteinPANTHERPTHR11289BREAST CANCER TYPE 2 SUSCEPTIBILITY PROTEIN BRCA2coord: 178..409