Protein disulfide-isomerase

Overview
NameProtein disulfide-isomerase
Smed IDSMED30034557
Length (bp)1607
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein disulfide-isomerase (SMED30034557) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein disulfide-isomerase (SMED30034557) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein disulfide-isomerase (SMED30034557) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein disulfide-isomerase (SMED30034557) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034557

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30034557h1SMcG0000926 SmedASXL_013564SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30034557h1SMcG0000926 dd_Smed_v4_13521_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034557h1SMcG0000926 dd_Smed_v4_13521_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30034557h1SMcG0000926 dd_Smed_v4_13521_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30034557h1SMcG0000926 dd_Smed_v6_13521_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034557h1SMcG0000926 OX_Smed_1.0.21824ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: P4HB (prolyl 4-hydroxylase subunit beta [Source:HGNC Symbol;Acc:HGNC:8548])

HSP 1 Score: 170.244 bits (430), Expect = 3.989e-46
Identity = 122/453 (26.93%), Postives = 217/453 (47.90%), Query Frame = 1
Query:   82 QKNFRQIENSSKVVLY-FYERNCSKCNSFF-EIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLR---SLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDV--KYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGK 1416
            + NF +   + K +L  FY   C  C +   E        +   ++I+ AK++AT    L   Y V   P +   R   + +  +Y    + +   N++ +        + +    + L+   E  V+G+F +  S  A  +  A   ++     ITSN DV  KY L   + + + L K  D+     N+ G  T  + + +FI+ N LP +  +  QT  KIF   IK H+L+F+ KS+ ++D  L     A ++ +GK + I  D   + D    L    L   + P    + +E+ E  KY   ++ +T+E I +       G  +P+  S+ L  +W+   V  LVG+N+++V  ++   V V FY+P C H   L  IW++LGE YK+  +IVI+K++S  NE++   ++S P++ F     ++  + +  ER L+ F +F+E+ G+
Sbjct:   31 KSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQL---DKDGVVLFKKFDEGRN--NFEGEVTK-ENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHT-DNQRILEFFGLKKEECPAVRLITLEE-EMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQ 475          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: P4HB (prolyl 4-hydroxylase subunit beta [Source:HGNC Symbol;Acc:HGNC:8548])

HSP 1 Score: 150.214 bits (378), Expect = 4.019e-39
Identity = 117/450 (26.00%), Postives = 203/450 (45.11%), Query Frame = 1
Query:   82 QKNFRQIENSSKVVLY-FYERNCSKCNSFF-EIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDV--KYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGK 1416
            + NF +   + K +L  FY   C  C +   E        +   ++I+ AK++AT    L   Y V   P      ++  F+ G T   + ++  +                                    S  A  +  A   ++     ITSN DV  KY L   + + + L K  D+     N+ G  T  + + +FI+ N LP +  +  QT  KIF   IK H+L+F+ KS+ ++D  L     A ++ +GK + I  D   + D    L    L   + P    + +E+ E  KY   ++ +T+E I +       G  +P+  S+ L  +W+   V  LVG+N+++V  ++   V V FY+P C H   L  IW++LGE YK+  +IVI+K++S  NE++   ++S P++ F     ++  + +  ER L+ F +F+E+ G+
Sbjct:   31 KSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYP------TIKFFRNGDTASPKEYTGDVE-----------------------------------SDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQL---DKDGVVLFKKFDEGRN--NFEGEVTK-ENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHT-DNQRILEFFGLKKEECPAVRLITLEE-EMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQ 431          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: PDIA2 (protein disulfide isomerase family A member 2 [Source:HGNC Symbol;Acc:HGNC:14180])

HSP 1 Score: 145.591 bits (366), Expect = 3.304e-37
Identity = 99/446 (22.20%), Postives = 200/446 (44.84%), Query Frame = 1
Query:  100 IENSSKVVLYFYERNCSKCNSF---FEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLF---QYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKY-PSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDG 1413
            +     +++ FY   C  C +    +     ++  E     +  AK++      L   + V++ P +   R+ N     +Y    D EG + ++        +R+ ++     LI   + +V+G+F +E      +     L + +    +T    +       +D  +   K ++   +F           ++S F+  + +  +  +N+QT +KIF   I  HLL+F++++L    + L G   A    RG+ + ++ D+  + D +  L    L     PT   V +E  +  KY P     VT+  I      + NG  +P   S+ + P+W+   V +LVG+N++ V  ++   V V FY+P C H   +   WE L E Y++  DI+I+++++  NE+D F ++  P++ +      +  + +++ R+L  F +F++N G
Sbjct:   56 LREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAE--SMVVTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPSAMRLEDEAAAQALIGGRDLVVIGFFQDEDVATFLALAQDALDMTFG---LTDRPRLFQQFGLTKDTVVLFKKFDEGRADFPVDEELGLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEAAPRFRGQVLFVVVDV--AADNEHVLQYFGLKAEAAPTLRLVNLETTK--KYAPVDGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKFLDNGG 492          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: PDIA2 (protein disulfide isomerase family A member 2 [Source:HGNC Symbol;Acc:HGNC:14180])

HSP 1 Score: 142.124 bits (357), Expect = 7.426e-36
Identity = 97/446 (21.75%), Postives = 197/446 (44.17%), Query Frame = 1
Query:  100 IENSSKVVLYFYERNCSKCNSF---FEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLF---QYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKY-PSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDG 1413
            +     +++ FY   C  C +    +     ++  E     +  AK++      L   + V++ P +   R+ N     +Y    D EG + ++        +R+ ++     LI   + +V+G+F +       ++             +T    +       +D  +   K ++   +F           ++S F+  + +  +  +N+QT +KIF   I  HLL+F++++L    + L G   A    RG+ + ++ D+  + D +  L    L     PT   V +E  +  KY P     VT+  I      + NG  +P   S+ + P+W+   V +LVG+N++ V  ++   V V FY+P C H   +   WE L E Y++  DI+I+++++  NE+D F ++  P++ +      +  + +++ R+L  F +F++N G
Sbjct:   56 LREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAE--SMVVTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPSAMRLEDEAAAQALIGGRDLVVIGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTVVLFKKFDEGRADFPVDEELGLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEAAPRFRGQVLFVVVDV--AADNEHVLQYFGLKAEAAPTLRLVNLETTK--KYAPVDGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKFLDNGG 495          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: P4HB (prolyl 4-hydroxylase subunit beta [Source:HGNC Symbol;Acc:HGNC:8548])

HSP 1 Score: 116.316 bits (290), Expect = 1.350e-28
Identity = 66/225 (29.33%), Postives = 121/225 (53.78%), Query Frame = 1
Query:  748 KLHLLI-FIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGK 1416
            +L L+I F ++S+ ++D  L     A ++ +GK + I  D   + D    L    L   + P    + +E+ E  KY   ++ +T+E I +       G  +P+  S+ L  +W+   V  LVG+N+++V  ++   V V FY+P C H   L  IW++LGE YK+  +IVI+K++S  NE++   ++S P++ F     ++  + +  ER L+ F +F+E+ G+
Sbjct:   19 QLPLVIEFTEQSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHT-DNQRILEFFGLKKEECPAVRLITLEE-EMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQ 241          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 159.073 bits (401), Expect = 1.559e-42
Identity = 131/492 (26.63%), Postives = 231/492 (46.95%), Query Frame = 1
Query:   19 MIYCIFLFFIHFSYST--------FIEVDQKNFRQIENSSKVVLY-FYERNCSKCNSFF-EIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIF-----INPVLR-IRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEF---LNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILD---LNISDTPTFAFVKVE-DFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGKHS 1422
            M   + LFF+    S          I + + NF ++ N ++ +L  FY   C  C S   E        +   +DIK  K++AT+H  +   ++V   P      +L LF+ G   +Y G  +  + I        PV + + + D +  L    + +V+GYF + +S  A ++      ++     I++ + VK  ++   +  +   K +D    F   L  +G       +  +IQ N L  +  +  +T S IF   IK H L+F+ K    F    +    A K  +GK   +LF +  + D++E   I++   L   + P    + +E D  + K P F + +T+E+I K  +   +GS +P+  SE +  +W+ + V  LVG+N++ V  +    VLV FY+P C H   L   W++LGE + +   IVI+K++S LNE++   I S P+I F    +NK+ + +  +R +  F +F+E +GK  
Sbjct:    1 MFRLVGLFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYP------TLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIGYFKDTTSDDAKTFLEVAAGIDDVPFGISTEDAVKSEIELKGEGIVLFKKFDDGRVAFDEKLTQDG-------LKTWIQANRLALVSEFTQETASVIFGGEIKSHNLLFVSKESSEFAKLEQEFKNAAKQFKGK---VLF-VYINTDVEENARIMEFFGLKKDELPAIRLISLEEDMTKFK-PDF-EEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKV-VDYTGDRTIEGFTKFLETNGKEG 472          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 159.073 bits (401), Expect = 1.559e-42
Identity = 131/492 (26.63%), Postives = 231/492 (46.95%), Query Frame = 1
Query:   19 MIYCIFLFFIHFSYST--------FIEVDQKNFRQIENSSKVVLY-FYERNCSKCNSFF-EIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIF-----INPVLR-IRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEF---LNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILD---LNISDTPTFAFVKVE-DFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGKHS 1422
            M   + LFF+    S          I + + NF ++ N ++ +L  FY   C  C S   E        +   +DIK  K++AT+H  +   ++V   P      +L LF+ G   +Y G  +  + I        PV + + + D +  L    + +V+GYF + +S  A ++      ++     I++ + VK  ++   +  +   K +D    F   L  +G       +  +IQ N L  +  +  +T S IF   IK H L+F+ K    F    +    A K  +GK   +LF +  + D++E   I++   L   + P    + +E D  + K P F + +T+E+I K  +   +GS +P+  SE +  +W+ + V  LVG+N++ V  +    VLV FY+P C H   L   W++LGE + +   IVI+K++S LNE++   I S P+I F    +NK+ + +  +R +  F +F+E +GK  
Sbjct:    1 MFRLVGLFFLVLGASAAVIEEEENVIVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYP------TLKLFRNGKPQEYNGGRDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIGYFKDTTSDDAKTFLEVAAGIDDVPFGISTEDAVKSEIELKGEGIVLFKKFDDGRVAFDEKLTQDG-------LKTWIQANRLALVSEFTQETASVIFGGEIKSHNLLFVSKESSEFAKLEQEFKNAAKQFKGK---VLF-VYINTDVEENARIMEFFGLKKDELPAIRLISLEEDMTKFK-PDF-EEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKV-VDYTGDRTIEGFTKFLETNGKEG 472          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 134.42 bits (337), Expect = 3.841e-34
Identity = 116/458 (25.33%), Postives = 202/458 (44.10%), Query Frame = 1
Query:   70 IEVDQKNFRQIENSSKVVLY-FYERNCSKCNSFF-EIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILD---LNISDTPTFAFVKVE-DFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGKHS 1422
            I + + NF ++ N ++ +L  FY   C  C S   E        +   +DIK  K++AT+H  +   ++V   P      +L LF+ G   +Y G                R+ D +   + K+   V     +  ++         +++ Y K   T+++D K                                      +IQ N L  +  +  +T S IF   IK H L+F+ K    F    +    A K  +GK   +LF +  + D++E   I++   L   + P    + +E D  + K P F + +T+E+I K  +   +GS +P+  SE +  +W+ + V  LVG+N++ V  +    VLV FY+P C H   L   W++LGE + +   IVI+K++S LNE++   I S P+I F    +NK+ + +  +R +  F +F+E +GK  
Sbjct:   26 IVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYP------TLKLFRNGKPQEYNGG---------------RDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIGYFKD--TTSDDAKT-------------------------------------WIQANRLALVSEFTQETASVIFGGEIKSHNLLFVSKESSEFAKLEQEFKNAAKQFKGK---VLF-VYINTDVEENARIMEFFGLKKDELPAIRLISLEEDMTKFK-PDF-EEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKV-VDYTGDRTIEGFTKFLETNGKEG 416          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 134.42 bits (337), Expect = 3.841e-34
Identity = 116/458 (25.33%), Postives = 202/458 (44.10%), Query Frame = 1
Query:   70 IEVDQKNFRQIENSSKVVLY-FYERNCSKCNSFF-EIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILD---LNISDTPTFAFVKVE-DFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGKHS 1422
            I + + NF ++ N ++ +L  FY   C  C S   E        +   +DIK  K++AT+H  +   ++V   P      +L LF+ G   +Y G                R+ D +   + K+   V     +  ++         +++ Y K   T+++D K                                      +IQ N L  +  +  +T S IF   IK H L+F+ K    F    +    A K  +GK   +LF +  + D++E   I++   L   + P    + +E D  + K P F + +T+E+I K  +   +GS +P+  SE +  +W+ + V  LVG+N++ V  +    VLV FY+P C H   L   W++LGE + +   IVI+K++S LNE++   I S P+I F    +NK+ + +  +R +  F +F+E +GK  
Sbjct:   26 IVLTKDNFDEVINGNEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYP------TLKLFRNGKPQEYNGG---------------RDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIGYFKD--TTSDDAKT-------------------------------------WIQANRLALVSEFTQETASVIFGGEIKSHNLLFVSKESSEFAKLEQEFKNAAKQFKGK---VLF-VYINTDVEENARIMEFFGLKKDELPAIRLISLEEDMTKFK-PDF-EEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKV-VDYTGDRTIEGFTKFLETNGKEG 416          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-1 (Protein disulfide-isomerase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q17967])

HSP 1 Score: 134.035 bits (336), Expect = 1.090e-33
Identity = 109/451 (24.17%), Postives = 203/451 (45.01%), Query Frame = 1
Query:   82 QKNFRQIENSSKVVLY-FYERNCSKCNSF---FEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILD---LNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRN----GSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFI 1401
            + NF +  N ++ VL  FY   C  C S    ++   +L+  E   +DIK AK++AT + +L   ++V   P ++  +S    +Y          +++ +     V  + + ++L+ L  K   +V+GYF +  S  A  Y      V+     +  + +V      NED    +    D S          T+   + +++    L A+  + +++  +I    +K    + I KS  +FD+ +   +   K  R K + +L D+    D++E   IL+   ++  +TP    V + D  E   P   +          FE   N    G    + K++ L  +WN   V  LV  N+  +  ++  TV V FY+P C H   L  +W+EL E Y++  ++VI+K+++ LNE+    + S P++ L+   +  P+ ++ +RNL  F EF+
Sbjct:   30 ESNFEETINGNEFVLVKFYAPWCVHCKSLAPKYDEAADLLKEE--GSDIKLAKVDATENQALASKFEVRGYPTILYFKSGKPTKYTGGRATAQIVDWVKKKSGPTVTTVESVEQLEELKGKTRVVVLGYFKDAKSDAATIYNEVADSVDDAFFAVAGSAEVAAAASLNEDGVALIRTDGDDSETSTIAEAEITNTIALKQWLHAYKLSAVTEFTHESAQEIVGGDLKKFHFLIIRKSDSSFDETIAKFTEVAKKFRAKIVFVLLDV----DVEENARILEFLGVDAKNTPANRIVSLADQVEKFKPQEGED---------FEAFTNSYLEGKSAQDLKAQDLPEDWNALPVKVLVASNFNEIALDETKTVFVKFYAPWCGHCKQLVPVWDELAEKYESNPNVVIAKLDATLNELADVKVNSFPTLKLWPAGSSTPVDYDGDRNLEKFEEFV 465          
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Match: Pdi (gene:FBgn0286818 transcript:FBtr0346644)

HSP 1 Score: 160.999 bits (406), Expect = 4.369e-43
Identity = 122/452 (26.99%), Postives = 221/452 (48.89%), Query Frame = 1
Query:   88 NFRQ-IENSSKVVLYFYERNCSKCNS----FFEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDV--KYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDET--LNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIENDGK 1416
            NF+Q I ++  V++ FY   C  C +    + +    L + E P   IK AK++AT+   L   Y V   P +   RS +  +Y           ++ +    P   + +  + +  +   E  ++G+F +  S  A ++      ++     ++SN DV  KY  K   DN + L K  D          N  + K+   F Q+  LP I  +N+++ SKIF   IK HLL F+ +   + + +++ +    K  R     ILF   +S + D T       +N  + PT   +K+E+ +  KY   +  +++E I    ++  +G  + +  S+ L  +W+ + V  LV  N+++V  +K+ +VLV FY+P C H   L  I+++L E YK+  DIVI+K++S  NE++   I S P+I  +RK +   + F  +R L++F++F++ +G+
Sbjct:   36 NFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESP---IKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAK---DNGVVLFKPFDDKKSVFEGELNEENLKK---FAQVQSLPLIVDFNHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRD---DILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEE-DMAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFLDANGE 474          
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Match: Pdi (gene:FBgn0286818 transcript:FBtr0075648)

HSP 1 Score: 160.999 bits (406), Expect = 4.369e-43
Identity = 122/452 (26.99%), Postives = 221/452 (48.89%), Query Frame = 1
Query:   88 NFRQ-IENSSKVVLYFYERNCSKCNS----FFEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDV--KYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDET--LNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIENDGK 1416
            NF+Q I ++  V++ FY   C  C +    + +    L + E P   IK AK++AT+   L   Y V   P +   RS +  +Y           ++ +    P   + +  + +  +   E  ++G+F +  S  A ++      ++     ++SN DV  KY  K   DN + L K  D          N  + K+   F Q+  LP I  +N+++ SKIF   IK HLL F+ +   + + +++ +    K  R     ILF   +S + D T       +N  + PT   +K+E+ +  KY   +  +++E I    ++  +G  + +  S+ L  +W+ + V  LV  N+++V  +K+ +VLV FY+P C H   L  I+++L E YK+  DIVI+K++S  NE++   I S P+I  +RK +   + F  +R L++F++F++ +G+
Sbjct:   36 NFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESP---IKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAK---DNGVVLFKPFDDKKSVFEGELNEENLKK---FAQVQSLPLIVDFNHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRD---DILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEE-DMAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFLDANGE 474          
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Match: ERp60 (gene:FBgn0033663 transcript:FBtr0088058)

HSP 1 Score: 75.8702 bits (185), Expect = 2.763e-14
Identity = 105/483 (21.74%), Postives = 200/483 (41.41%), Query Frame = 1
Query:   31 IFLFFIHFSYST---FIEVDQKNFRQ-IENSSKVVLYFYERNCSKCNSF---FEIMNNLIDNEWPDTDIKFAKINAT-LHPSLLFLYQVSDLPMVVGLRSLNLFQ-YGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYT-----KCVITSNEDVKYILKTNEDNHINLVKHNDQSTEF----LNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNP-IKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLN-ISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDG-FPIYSTPSIFLYRKTNK-IPLRFENERNLNNFIEFIENDG 1413
            + L FI  S       +E+   +F   ++     ++ FY   C  C      +     ++ ++  D  IK AK++ T         Y VS  P +   R   + Q Y    +  G + ++          +R   EL   +  +++ + GYF +  S      K A + + +      K     + + + + K  E + I L++    S +F    + + G  +S  ++S F++ N    +  +  Q   K FQNP I  +  +   K+    + +   +    K   G+   I F I +  D    LN    + + D P    V   D + LKY +     + E++    E++      P  KSE + P  N + V   V +N+ ++  N     L+ FY+P C H   L  I+EEL E  +++ D+ I K+++  N++   F +   P++F   K  K  P+ +   R +++F+++I  + 
Sbjct:    9 LLLGFIAISSGAEQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPEYAKAAEIVKDD--DPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREASGIAKYMRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDS------KLAKIFLKFADKNREKYRFGHSSEKEVLDKQGETDKIVLIRAPHLSNKFESSSIKFEG--SSESDLSTFVKEN-FHGLVGHRTQDSVKDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQ---INFAIASKDDFQHELNEYGYDFVGDKPV---VLARDEKNLKY-ALKDEFSVENLQDFVEKLLANELEPYIKSEPI-PESNDAPVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDE-DVAIVKMDATANDVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKEA 471          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: p4hb (prolyl 4-hydroxylase, beta polypeptide [Source:ZFIN;Acc:ZDB-GENE-080610-1])

HSP 1 Score: 162.925 bits (411), Expect = 1.295e-43
Identity = 113/445 (25.39%), Postives = 211/445 (47.42%), Query Frame = 1
Query:  118 VVLYFYERNCSKCNSF---FEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVV---GLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILD---LNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGKHS 1422
            V++ FY   C  C +    +     ++  E   +DI+ AK++AT    L   + V   P +    G    N  +Y      E   +++ +        + +  + + +I   E  V+G+F +  S  + ++      V+     ITS++ V    +  +D+ +   K ++    F        S + +  FI+ N LP +  +  QT  KIF   IK H+L+F+ K+  +F D ++    A +  +GK + I  D     D+D+   IL+   L   + P    + +E+ E  KY   +  +T+E+I+        G+ +P+  S+ +  +W+ + V  LVG+N++ V  N    V V FY+P C H   L  IW++LGE +K+ ++IV++K++S  NEI+   ++S P++ F      +  + +  ER L+ F +F+E+ GK  
Sbjct:   42 VLVEFYAPWCGHCKALAPEYSKAAGMLKAE--GSDIRLAKVDATEESELAQEFGVRGYPTIKFFKGGEKGNPKEYSAGRQAEDIVSWLKKRTGPAATTLNDVMQAESIIADNEVAVIGFFKDVESEDSKAFIKTAEAVDDIPFGITSDDSVFAKFEVAKDSVVLFKKFDEGRNTF----DGEVSKESLLNFIKANQLPLVIEFTEQTAPKIFGGDIKSHILMFVPKAAKDFQDKMDQFKKAAEGFKGKILFIFID----SDVDDNQRILEFFGLKKEECPVIRLITLEE-EMTKYKPESSEITAENIISFCTSFVEGTLKPHLMSQDIPEDWDKNPVKVLVGKNFEEVAFNPANNVFVEFYAPWCGHCKQLAPIWDQLGEKFKDNANIVVAKMDSTANEIEAVKVHSFPTLKFFPAGDERKVIDYNGERTLDGFTKFLESGGKEG 475          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: p4hb (prolyl 4-hydroxylase, beta polypeptide [Source:ZFIN;Acc:ZDB-GENE-080610-1])

HSP 1 Score: 162.925 bits (411), Expect = 1.295e-43
Identity = 113/445 (25.39%), Postives = 211/445 (47.42%), Query Frame = 1
Query:  118 VVLYFYERNCSKCNSF---FEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVV---GLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILD---LNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGKHS 1422
            V++ FY   C  C +    +     ++  E   +DI+ AK++AT    L   + V   P +    G    N  +Y      E   +++ +        + +  + + +I   E  V+G+F +  S  + ++      V+     ITS++ V    +  +D+ +   K ++    F        S + +  FI+ N LP +  +  QT  KIF   IK H+L+F+ K+  +F D ++    A +  +GK + I  D     D+D+   IL+   L   + P    + +E+ E  KY   +  +T+E+I+        G+ +P+  S+ +  +W+ + V  LVG+N++ V  N    V V FY+P C H   L  IW++LGE +K+ ++IV++K++S  NEI+   ++S P++ F      +  + +  ER L+ F +F+E+ GK  
Sbjct:   42 VLVEFYAPWCGHCKALAPEYSKAAGMLKAE--GSDIRLAKVDATEESELAQEFGVRGYPTIKFFKGGEKGNPKEYSAGRQAEDIVSWLKKRTGPAATTLNDVMQAESIIADNEVAVIGFFKDVESEDSKAFIKTAEAVDDIPFGITSDDSVFAKFEVAKDSVVLFKKFDEGRNTF----DGEVSKESLLNFIKANQLPLVIEFTEQTAPKIFGGDIKSHILMFVPKAAKDFQDKMDQFKKAAEGFKGKILFIFID----SDVDDNQRILEFFGLKKEECPVIRLITLEE-EMTKYKPESSEITAENIISFCTSFVEGTLKPHLMSQDIPEDWDKNPVKVLVGKNFEEVAFNPANNVFVEFYAPWCGHCKQLAPIWDQLGEKFKDNANIVVAKMDSTANEIEAVKVHSFPTLKFFPAGDERKVIDYNGERTLDGFTKFLESGGKEG 475          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: pdia2 (protein disulfide isomerase family A, member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-705])

HSP 1 Score: 135.191 bits (339), Expect = 1.192e-33
Identity = 101/456 (22.15%), Postives = 212/456 (46.49%), Query Frame = 1
Query:   94 RQIENSSKVVLYFYERNCSKCNS----FFEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDY---------EGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDV--KYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDG 1413
            R +  +  +++ FY   C  C S    + E+   L +     ++++ AK++A     L   + V   P      +L  F+ G+  +          +G   ++ +        + +    + L+   E LVVG+F +     A ++    L+       ITS+ ++  KY +KT  D+ +   K +++  +    +       E+  FI  N +  +  +N +   +IF + ++ HLL+F++ ++ + +  +E         + K I I  D+ T+  ++  L    ++  D PT   +  ED   + Y     ++  + +    + + +G+ +P  KS+ +  +W+ + V  LVG+N+  V  +++  V V FY+P C H   L  +W+ELGE YK++ +I+I+K+++  N+++   I   P+I +    T K  + ++  R+L  F +F++N G
Sbjct:   68 RALSENKYLLVEFYAPWCGHCRSLEPIYAEVAGQLKN---ASSEVRLAKVDAIEEKELASEFSVDSFP------TLKFFKEGNRQNATTFFGKRTLKGIKRWLEKHTAPSATVLNDVKSAEALLEANEVLVVGFFKDLEGEKAKTFYDVTLIAVDVNFGITSDPELFKKYEVKT--DSLVLFKKFDERRADMPLSDETKLDKGEMISFIHSNSMRLVVPFNEENAEQIFNSKVRKHLLLFLNTTVDSQNALVEEFREVASEFKEKVIFITVDV-TAEKVNHVLKYFSISEDDVPTIRLINTEDV--VTYAMDGSTINKDTLRTFCQGVFDGTVKPYLKSQEIPEDWDKNPVKVLVGKNFNEVAFDESKNVFVEFYAPWCGHCQQLAPVWDELGEKYKDQENIIIAKMDATENDVEDLTIQGFPTIKYFPAGTEKKIVDYDGNRDLETFSKFLDNGG 509          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: pdia2 (protein disulfide isomerase family A, member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-705])

HSP 1 Score: 134.806 bits (338), Expect = 1.728e-33
Identity = 101/456 (22.15%), Postives = 212/456 (46.49%), Query Frame = 1
Query:   94 RQIENSSKVVLYFYERNCSKCNS----FFEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDY---------EGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDV--KYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDG 1413
            R +  +  +++ FY   C  C S    + E+   L +     ++++ AK++A     L   + V   P      +L  F+ G+  +          +G   ++ +        + +    + L+   E LVVG+F +     A ++    L+       ITS+ ++  KY +KT  D+ +   K +++  +    +       E+  FI  N +  +  +N +   +IF + ++ HLL+F++ ++ + +  +E         + K I I  D+ T+  ++  L    ++  D PT   +  ED   + Y     ++  + +    + + +G+ +P  KS+ +  +W+ + V  LVG+N+  V  +++  V V FY+P C H   L  +W+ELGE YK++ +I+I+K+++  N+++   I   P+I +    T K  + ++  R+L  F +F++N G
Sbjct:   68 RALSENKYLLVEFYAPWCGHCRSLEPIYAEVAGQLKN---ASSEVRLAKVDAIEEKELASEFSVDSFP------TLKFFKEGNRQNATTFFGKRTLKGIKRWLEKHTAPSATVLNDVKSAEALLEANEVLVVGFFKDLEGEKAKTFYDVTLIAVDVNFGITSDPELFKKYEVKT--DSLVLFKKFDERRADMPLSDETKLDKGEMISFIHSNSMRLVVPFNEENAEQIFNSKVRKHLLLFLNTTVDSQNALVEEFREVASEFKEKVIFITVDV-TAEKVNHVLKYFSISEDDVPTIRLINTEDV--VTYAMDGSTINKDTLRTFCQGVFDGTVKPYLKSQEIPEDWDKNPVKVLVGKNFNEVAFDESKNVFVEFYAPWCGHCQQLAPVWDELGEKYKDQENIIIAKMDATENDVEDLTIQGFPTIKYFPAGTEKKIVDYDGNRDLETFSKFLDNGG 509          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: pdia4 (protein disulfide isomerase family A, member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5493])

HSP 1 Score: 99.7525 bits (247), Expect = 1.154e-21
Identity = 111/467 (23.77%), Postives = 208/467 (44.54%), Query Frame = 1
Query:   88 NFRQIENSSKVVLY-FYERNCSKCNSF---FEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIM-KEESLVVGYFHNESSIPADSYKTAC--LLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQST-EFLNYN---GNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISIL-------FDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEI--DGFPIYSTPSIFLYRKTNKI-PLRFE-NERNLNNFIEFIENDGKHS 1422
            NF  + N++ ++L  FY   C  C      +E     + N  P   I  AK++AT    L   + VS  P +   R    F Y    +  G  +++++    P  +++   ++  L+   +++++VG F ++     + Y+ AC  L  +Y K + T N DV   LK +    + L     +S  E  +++    + T A E+ +F + + LP   L  ++ +S   +   K  L++       +FD       +A +  R K + +        F I    D  + L  L L+ S       +  E  +  KY    +   S+ +       + G  +P  KS+ L P  N   V  +VG+ +  +  +    VL+ FY+P C H   L+  +  LG+ YKN+ ++VI+K+++  N++  D + +   P+I+     NK  P++FE  +R++  F +F+E   KH+
Sbjct:  183 NFDDVVNNADIILVEFYAPWCGHCKRLAPEYEKAAKELSNRTPP--IPLAKVDATAESDLATRFGVSGYPTLKIFRKGKAFDYNGPREKFGIVDYMSDQAGPPSKQVQTLKQVQELLRDGDDAVIVGVFSSDEDAAYEIYQEACNSLREDY-KFMHTFNNDVTKFLKASPGQVVMLQPEKFRSKYESASHSLTIKDSTPASEVQDFFKKHILP---LVGHRKQSNDAKRYTKRPLVVVYYGVDFSFD-----YRVATQFWRSKVLEVAKDFPEYTFAIADEEDYADELKSLGLSESGEEVNVGIVGEGGK--KYAMEPEEFDSDVLRSFVMAFKKGKLKPIVKSQPL-PKNNKGPVKVVVGKTFDEIVMDSKKDVLIEFYAPWCGHCKKLEPDYISLGKKYKNEKNLVIAKMDATANDVPHDSYKVEGFPTIYFAPSNNKQNPIKFEGGKRDVEEFSKFVE---KHA 632          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:395048])

HSP 1 Score: 161.77 bits (408), Expect = 4.580e-43
Identity = 120/449 (26.73%), Postives = 209/449 (46.55%), Query Frame = 1
Query:  118 VVLYFYERNCSKCNSF---FEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLF---QYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDV--KYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGKHSEITND 1437
            +++ FY   C  C +    +E    ++ +E     I+  K++AT    L   + V   P +   ++ +     +Y    +     N++ +        + ++  +  L+   E  V+G+F + +S PA  +  A   V+     ITS+E    KY L  +    I L K  D+      Y G+ T  +E+  FI+ N LP +  +  QT   IF   IK H+L F+ KS  ++ + LE    A  + +GK + I  D   + D    L    L   + P    + +E+ E  KY   +  +++E I +  +    G  +P+  S+ +S +W+ + V  LVG+N++ V  N+   V V FY+P C H   L  IW++LGE YK+  +I+I+K++S  NEI+   I+S P++ F      K    +  ER L  F +F+E+ G+      D
Sbjct:   34 ILVEFYAPWCGHCKALAPEYEKAAGVLKSE--GLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVNWLKKRTGPAASTLGDEAGVAALVDSSEVAVIGFFKDPASEPAKVFLQAAEAVDDIPFGITSSEAAFSKYELGKD---GIVLFKKFDEGRN--AYEGDITK-EEVLSFIKANRLPLVIEFTEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFKKAAASFKGKILFIFIDSDHT-DNQRILEFFGLKKEECPAVRLITLEE-EMTKYKPESADLSAEAIKEFCDSFLEGKVKPHLMSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESGGQDGAADED 472          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:395048])

HSP 1 Score: 161.77 bits (408), Expect = 5.136e-43
Identity = 120/449 (26.73%), Postives = 209/449 (46.55%), Query Frame = 1
Query:  118 VVLYFYERNCSKCNSF---FEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLF---QYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDV--KYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGKHSEITND 1437
            +++ FY   C  C +    +E    ++ +E     I+  K++AT    L   + V   P +   ++ +     +Y    +     N++ +        + ++  +  L+   E  V+G+F + +S PA  +  A   V+     ITS+E    KY L  +    I L K  D+      Y G+ T  +E+  FI+ N LP +  +  QT   IF   IK H+L F+ KS  ++ + LE    A  + +GK + I  D   + D    L    L   + P    + +E+ E  KY   +  +++E I +  +    G  +P+  S+ +S +W+ + V  LVG+N++ V  N+   V V FY+P C H   L  IW++LGE YK+  +I+I+K++S  NEI+   I+S P++ F      K    +  ER L  F +F+E+ G+      D
Sbjct:   41 ILVEFYAPWCGHCKALAPEYEKAAGVLKSE--GLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVNWLKKRTGPAASTLGDEAGVAALVDSSEVAVIGFFKDPASEPAKVFLQAAEAVDDIPFGITSSEAAFSKYELGKD---GIVLFKKFDEGRN--AYEGDITK-EEVLSFIKANRLPLVIEFTEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFKKAAASFKGKILFIFIDSDHT-DNQRILEFFGLKKEECPAVRLITLEE-EMTKYKPESADLSAEAIKEFCDSFLEGKVKPHLMSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESGGQDGAADED 479          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:395048])

HSP 1 Score: 160.999 bits (406), Expect = 1.101e-42
Identity = 120/449 (26.73%), Postives = 208/449 (46.33%), Query Frame = 1
Query:  118 VVLYFYERNCSKCNSF---FEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLR---SLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDV--KYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGKHSEITND 1437
            +++ FY   C  C +    +E    ++ +E     I+  K++AT    L   + V   P +   +     +  +Y    +     N++ +        + ++  +  L+   E  V+G+F + +S PA  +  A   V+     ITS+E    KY L  +    I L K  D+      Y G+ T  +E+  FI+ N LP +  +  QT   IF   IK H+L F+ KS  ++ + LE    A  + +GK + I  D   + D    L    L   + P    + +E+ E  KY   +  +++E I +  +    G  +P+  S+ +S +W+ + V  LVG+N++ V  N+   V V FY+P C H   L  IW++LGE YK+  +I+I+K++S  NEI+   I+S P++ F      K    +  ER L  F +F+E+ G+      D
Sbjct:   61 ILVEFYAPWCGHCKALAPEYEKAAGVLKSE--GLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVNWLKKRTGPAASTLGDEAGVAALVDSSEVAVIGFFKDPASEPAKVFLQAAEAVDDIPFGITSSEAAFSKYELGKD---GIVLFKKFDEGRN--AYEGDITK-EEVLSFIKANRLPLVIEFTEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFKKAAASFKGKILFIFIDSDHT-DNQRILEFFGLKKEECPAVRLITLEE-EMTKYKPESADLSAEAIKEFCDSFLEGKVKPHLMSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESGGQDGAADED 499          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:395048])

HSP 1 Score: 157.532 bits (397), Expect = 9.191e-42
Identity = 118/440 (26.82%), Postives = 204/440 (46.36%), Query Frame = 1
Query:  145 CSKCNSF---FEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLF---QYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDV--KYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGKHSEITND 1437
            C  C +    +E    ++ +E     I+  K++AT    L   + V   P +   ++ +     +Y    +     N++ +        + ++  +  L+   E  V+G+F + +S PA  +  A   V+     ITS+E    KY L  +    I L K  D+      Y G+ T  +E+  FI+ N LP +  +  QT   IF   IK H+L F+ KS  ++ + LE    A  + +GK + I  D   + D    L    L   + P    + +E+ E  KY   +  +++E I +  +    G  +P+  S+ +S +W+ + V  LVG+N++ V  N+   V V FY+P C H   L  IW++LGE YK+  +I+I+K++S  NEI+   I+S P++ F      K    +  ER L  F +F+E+ G+      D
Sbjct:   16 CGHCKALAPEYEKAAGVLKSE--GLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVNWLKKRTGPAASTLGDEAGVAALVDSSEVAVIGFFKDPASEPAKVFLQAAEAVDDIPFGITSSEAAFSKYELGKD---GIVLFKKFDEGRN--AYEGDITK-EEVLSFIKANRLPLVIEFTEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFKKAAASFKGKILFIFIDSDHT-DNQRILEFFGLKKEECPAVRLITLEE-EMTKYKPESADLSAEAIKEFCDSFLEGKVKPHLMSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESGGQDGAADED 445          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:395048])

HSP 1 Score: 157.532 bits (397), Expect = 9.591e-42
Identity = 119/444 (26.80%), Postives = 205/444 (46.17%), Query Frame = 1
Query:  133 YERNCSKCNSF---FEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLF---QYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDV--KYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGKHSEITND 1437
            Y   C  C +    +E    ++ +E     I+  K++AT    L   + V   P +   ++ +     +Y    +     N++ +        + ++  +  L+   E  V+G+F + +S PA  +  A   V+     ITS+E    KY L  +    I L K  D+      Y G+ T  +E+  FI+ N LP +  +  QT   IF   IK H+L F+ KS  ++ + LE    A  + +GK + I  D   + D    L    L   + P    + +E+ E  KY   +  +++E I +  +    G  +P+  S+ +S +W+ + V  LVG+N++ V  N+   V V FY+P C H   L  IW++LGE YK+  +I+I+K++S  NEI+   I+S P++ F      K    +  ER L  F +F+E+ G+      D
Sbjct:   18 YAPWCGHCKALAPEYEKAAGVLKSE--GLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVNWLKKRTGPAASTLGDEAGVAALVDSSEVAVIGFFKDPASEPAKVFLQAAEAVDDIPFGITSSEAAFSKYELGKD---GIVLFKKFDEGRN--AYEGDITK-EEVLSFIKANRLPLVIEFTEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFKKAAASFKGKILFIFIDSDHT-DNQRILEFFGLKKEECPAVRLITLEE-EMTKYKPESADLSAEAIKEFCDSFLEGKVKPHLMSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESGGQDGAADED 451          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: P4hb (prolyl 4-hydroxylase, beta polypeptide [Source:MGI Symbol;Acc:MGI:97464])

HSP 1 Score: 162.925 bits (411), Expect = 1.412e-43
Identity = 126/485 (25.98%), Postives = 223/485 (45.98%), Query Frame = 1
Query:   82 QKNFRQIENSSKVVLY-FYERNCSKCNSFF-EIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLR---SLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDV--KYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGKHS---------EITNDPDKKTVVDVENKRDEL 1485
            + NF +   + K +L  FY   C  C +   E        +   ++I+ AK++AT    L   Y V   P +   +   + +  +Y    + +   N++ +        + +    + L+   E  V+G+F +  S  A  +  A   ++     ITSN  V  KY L   + + + L K  D+     N+ G  T  K + +FI+ N LP +  +  QT  KIF   IK H+L+F+ KS+ ++D  L     A +  +GK + I  D   + D    L    L   + P    + +E+ E  KY   +  +T+E I +       G  +P+  S+ +  +W+   V  LVG N++ V  ++   V V FY+P C H   L  IW++LGE YK+  +I+I+K++S  NE++   ++S P++ F     ++  + +  ER L+ F +F+E+ G+           E   +PD +   D +  +DEL
Sbjct:   33 KSNFEEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAAKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLSDTAAAESLVDSSEVTVIGFFKDVESDSAKQFLLAAEAIDDIPFGITSNSGVFSKYQL---DKDGVVLFKKFDEGRN--NFEGEITKEK-LLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSSFKRAAEGFKGKILFIFIDSDHT-DNQRILEFFGLKKEECPAVRLITLEE-EMTKYKPESDELTAEKITEFCHRFLEGKIKPHLMSQEVPEDWDKQPVKVLVGANFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIIIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGDDEDLDLEEALEPDMEEDDDQKAVKDEL 509          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdia2 (protein disulfide isomerase associated 2 [Source:MGI Symbol;Acc:MGI:1916441])

HSP 1 Score: 137.502 bits (345), Expect = 1.875e-34
Identity = 97/450 (21.56%), Postives = 197/450 (43.78%), Query Frame = 1
Query:  100 IENSSKVVLYFYERNCSKCNSFF-EIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQ---------YGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKY-PSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDG 1413
            ++  S +++ FY   C  C     E              +  AK++    P L   ++V      VG  +L  FQ         Y      EG + ++          + +++ +  L+ K + +V+G+F  +      +     L + +     T    +       +D  +   K ++   +F           ++S F+ I+ +  +  +N+QT  KIF   I  HLL+F++++L    + L     A    RG+ + ++ D+    D    LN   L   + PT   + VE  +  KY P+   ++T+  +    + + +G  +    S+ + P+W+   V +LV +N++ V  ++   V V FY+P C H   +   WE L E YK++ DIVI+++++  NE++ F +   P++ F     ++  + +++ R+L  F +F+++ G
Sbjct:   59 LQEHSALMVEFYAPWCGHCKELAPEYSKAAALLAAESAVVTLAKVDGPAEPELTKEFEV------VGYPTLKFFQNGNRTNPEEYAGPKTAEGIAEWLRRRVGPSATHLEDEEGVQALMAKWDMVVIGFFQGKDMATFLALAKDALDMTFG---FTDQPQLFEKFGLTKDTVVLFKKFDEGRADFPVDKETGLDLGDLSRFLVIHSMHLVTEFNSQTSPKIFAAKILNHLLLFVNQTLAQHRELLTDFREAAPPFRGQVLFVMVDVAA--DNSHVLNYFGLKAEEAPTLRLINVETTK--KYAPTGVIAITAASVAAFCQAVLHGEIKHYLLSQEIPPDWDQGPVKTLVSKNFEQVAFDETKNVFVKFYAPWCSHCKEMAPAWEALAEKYKDREDIVIAELDATANELEAFSVLGYPTLKFFPAGPDRKVIDYKSTRDLETFSKFLDSGG 495          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdia2 (protein disulfide isomerase associated 2 [Source:MGI Symbol;Acc:MGI:1916441])

HSP 1 Score: 135.961 bits (341), Expect = 6.699e-34
Identity = 98/453 (21.63%), Postives = 198/453 (43.71%), Query Frame = 1
Query:  100 IENSSKVVLYFYERNCSKCNSFF-EIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQ---------YGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKT---NEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKY-PSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDG 1413
            ++  S +++ FY   C  C     E              +  AK++    P L   ++V      VG  +L  FQ         Y      EG + ++          + +++ +  L+ K + +V+G+F +   +      T   L      +     D   + +     +D  +   K ++   +F           ++S F+ I+ +  +  +N+QT  KIF   I  HLL+F++++L    + L     A    RG+ + ++ D+    D    LN   L   + PT   + VE  +  KY P+   ++T+  +    + + +G  +    S+ + P+W+   V +LV +N++ V  ++   V V FY+P C H   +   WE L E YK++ DIVI+++++  NE++ F +   P++ F     ++  + +++ R+L  F +F+++ G
Sbjct:   59 LQEHSALMVEFYAPWCGHCKELAPEYSKAAALLAAESAVVTLAKVDGPAEPELTKEFEV------VGYPTLKFFQNGNRTNPEEYAGPKTAEGIAEWLRRRVGPSATHLEDEEGVQALMAKWDMVVIGFFQD---LQGKDMATFLALAKDALDMTFGFTDQPQLFEKFGLTKDTVVLFKKFDEGRADFPVDKETGLDLGDLSRFLVIHSMHLVTEFNSQTSPKIFAAKILNHLLLFVNQTLAQHRELLTDFREAAPPFRGQVLFVMVDVAA--DNSHVLNYFGLKAEEAPTLRLINVETTK--KYAPTGVIAITAASVAAFCQAVLHGEIKHYLLSQEIPPDWDQGPVKTLVSKNFEQVAFDETKNVFVKFYAPWCSHCKEMAPAWEALAEKYKDREDIVIAELDATANELEAFSVLGYPTLKFFPAGPDRKVIDYKSTRDLETFSKFLDSGG 498          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdia2 (protein disulfide isomerase associated 2 [Source:MGI Symbol;Acc:MGI:1916441])

HSP 1 Score: 81.2629 bits (199), Expect = 9.879e-18
Identity = 34/115 (29.57%), Postives = 68/115 (59.13%), Query Frame = 1
Query: 1072 LSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDG 1413
            + P+W+   V +LV +N++ V  ++   V V FY+P C H   +   WE L E YK++ DIVI+++++  NE++ F +   P++ F     ++  + +++ R+L  F +F+++ G
Sbjct:   11 IPPDWDQGPVKTLVSKNFEQVAFDETKNVFVKFYAPWCSHCKEMAPAWEALAEKYKDREDIVIAELDATANELEAFSVLGYPTLKFFPAGPDRKVIDYKSTRDLETFSKFLDSGG 125          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdia4 (protein disulfide isomerase associated 4 [Source:MGI Symbol;Acc:MGI:104864])

HSP 1 Score: 82.4185 bits (202), Expect = 4.816e-16
Identity = 102/475 (21.47%), Postives = 191/475 (40.21%), Query Frame = 1
Query:   88 NFRQIENSSKVVLY-FYERNCSKCNSF---FEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIFINP---VLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTAC--------------------LLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKT-----SPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEI--DGFPIYSTPSIFLYRKTNKI-PLRFENE-RNLNNFIEFIE 1404
            NF  + N++ ++L  FY   C  C      +E     +    P   I  AK++AT    L   + VS  P +   R    F Y    +  G  +++ E    P   +L ++   E   L   ++ +++G F  +       Y+ A                     L V+  K V+T  E  K+  K     H+            ++  G+ T A  I +++  + LP +        +K +    K  L++       +FD        A +  R K + +  D        + + D    + DL +S++       + D    K+    +   S+ + +     + G  +P  KS+ +  N N   V  +VG+ +  +  +    VL+ FY+P C H   L+ I+  LG+ YK + D+VI+K+++  N+I  D + +   P+I+     +K  P++FE   R+L +  +FI+
Sbjct:  182 NFDDVVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPP--IPLAKVDATEQTDLAKRFDVSGYPTLKIFRKGRPFDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEF--LKDGDDVVIIGLFQGDGDPAYLQYQDAANNLREDYKFHHTFSPEIAKFLKVSLGKLVLTHPE--KFQSKYEPRFHV------------MDVQGS-TEASAIKDYVVKHALPLVGHRKTSNDAKRYS---KRPLVVVYYSVDFSFD-----YRAATQFWRNKVLEVAKDFPEYTFAIADEEDYATEVKDLGLSESGEDVNAAILDESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKN-NKGPVKVVVGKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPIYTSLGKKYKGQKDLVIAKMDATANDITNDQYKVEGFPTIYFAPSGDKKNPIKFEGGNRDLEHLSKFID 628          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|Q2HWU2|PDIA1_MACFU (Protein disulfide-isomerase OS=Macaca fuscata fuscata OX=9543 GN=P4HB PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 7.528e-46
Identity = 123/453 (27.15%), Postives = 216/453 (47.68%), Query Frame = 1
Query:   82 QKNFRQIENSSKVVLY-FYERNCSKCNSFF-EIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLR---SLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDV--KYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGK 1416
            + NF +   + K +L  FY   C  C +   E        +   ++I+ AK++AT    L   Y V   P +   R   + +  +Y    + +   N++ +        + +    + L+   E  V+G+F +  S  A  +  A   ++     ITSN DV  KY L   + + + L K  D+     N+ G  T  + + +FI+ N LP +  +  QT  KIF   IK H+L+F+ KS+ ++D  L     A ++ +GK + I  D   + D    L    L   + P    + +E+ E  KY   +  +T+E I +       G  +P+  S+ L  +W+   V  LVG+N++ V  ++N  V V FY+P C H   L  IW++LGE YK+  +IVI+K++S  NE++   ++S P++ F     ++  + +  ER L+ F +F+E+ G+
Sbjct:   33 KSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQL---DKDGVVLFKKFDEGRN--NFEGEVTK-ENLLDFIKYNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHT-DNQRILEFFGLKKEECPAVRLITLEE-EMTKYKPESDELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEEVAFDENKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAIKVHSFPTLKFFPASVDRTVIDYNGERTLDGFKKFLESGGQ 477          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|P04785|PDIA1_RAT (Protein disulfide-isomerase OS=Rattus norvegicus OX=10116 GN=P4hb PE=1 SV=2)

HSP 1 Score: 171.014 bits (432), Expect = 1.177e-45
Identity = 127/472 (26.91%), Postives = 220/472 (46.61%), Query Frame = 1
Query:  118 VVLYFYERNCSKCNSFF-EIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLF---QYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDV--KYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGKHSEITND---------PDKKTVVDVENKRDEL 1485
            +++ FY   C  C +   E        +   ++I+ AK++AT    L   Y V   P +   ++ +     +Y    + +   N++ +        + +    + L+   E  V+G+F +  S  A  +  A   V+     ITSN DV  KY L   + + + L K  D+     N+ G  T  K + +FI+ N LP +  +  QT  KIF   IK H+L+F+ KS+ ++D  L     A +  +GK + I  D   + D    L    L   + P    + +E+ E  KY   +  +T+E I +       G  +P+  S+ L  +W+   V  LVG+N++ V  ++   V V FY+P C H   L  IW++LGE YK+  +IVI+K++S  NE++   ++S P++ F     ++  + +  ER L+ F +F+E+ G+     ND         PD +   D +  +DEL
Sbjct:   46 LLVEFYAPWCGHCKALAPEYAKAAAKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLSDTAAAESLVDSSEVTVIGFFKDAGSDSAKQFLLAAEAVDDIPFGITSNSDVFSKYQL---DKDGVVLFKKFDEGRN--NFEGEITKEK-LLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKKAAEGFKGKILFIFIDSDHT-DNQRILEFFGLKKEECPAVRLITLEE-EMTKYKPESDELTAEKITQFCHHFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGDNDDLDLEEALEPDMEEDDDQKAVKDEL 509          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|Q5R5B6|PDIA1_PONAB (Protein disulfide-isomerase OS=Pongo abelii OX=9601 GN=P4HB PE=2 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 1.896e-45
Identity = 123/453 (27.15%), Postives = 217/453 (47.90%), Query Frame = 1
Query:   82 QKNFRQIENSSKVVLY-FYERNCSKCNSFF-EIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLR---SLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDV--KYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGK 1416
            + NF +   + K +L  FY   C  C +   E        +   ++I+ AK++AT    L   Y V   P +   R   + +  +Y    + +   N++ +        + +    + L+   E  VVG+F +  S  A  +  A   ++     ITSN DV  KY L   + + + L K  D+     N+ G  T  + + +FI+ N LP +  +  QT  KIF   IK H+L+F+ KS+ ++D  L     A ++ +GK + I  D   + D    L    L   + P    + +E+ E  KY   ++ +T+E I +       G  +P+  S+ L  +W+   V  LVG+N+++V  ++   V V FY+P C H   L  IW++LGE YK+  +IVI+K++S  NE++   ++S P++ F     ++  + +  ER L+ F +F+E+ G+
Sbjct:   31 KSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATILPDGAAAESLVESSEVAVVGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQL---DKDGVVLFKKFDEGRN--NFEGEVTK-ENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHT-DNQRILEFFGLKKEECPAVRLITLEE-EMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPDDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQ 475          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|P07237|PDIA1_HUMAN (Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3)

HSP 1 Score: 170.244 bits (430), Expect = 1.916e-45
Identity = 122/453 (26.93%), Postives = 217/453 (47.90%), Query Frame = 1
Query:   82 QKNFRQIENSSKVVLY-FYERNCSKCNSFF-EIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLR---SLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDV--KYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGK 1416
            + NF +   + K +L  FY   C  C +   E        +   ++I+ AK++AT    L   Y V   P +   R   + +  +Y    + +   N++ +        + +    + L+   E  V+G+F +  S  A  +  A   ++     ITSN DV  KY L   + + + L K  D+     N+ G  T  + + +FI+ N LP +  +  QT  KIF   IK H+L+F+ KS+ ++D  L     A ++ +GK + I  D   + D    L    L   + P    + +E+ E  KY   ++ +T+E I +       G  +P+  S+ L  +W+   V  LVG+N+++V  ++   V V FY+P C H   L  IW++LGE YK+  +IVI+K++S  NE++   ++S P++ F     ++  + +  ER L+ F +F+E+ G+
Sbjct:   31 KSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQL---DKDGVVLFKKFDEGRN--NFEGEVTK-ENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHT-DNQRILEFFGLKKEECPAVRLITLEE-EMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQ 475          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|P21195|PDIA1_RABIT (Protein disulfide-isomerase OS=Oryctolagus cuniculus OX=9986 GN=P4HB PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 8.068e-45
Identity = 116/445 (26.07%), Postives = 206/445 (46.29%), Query Frame = 1
Query:  118 VVLYFYERNCSKCNSFF-EIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLR---SLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGKHSEITND 1437
            +++ FY   C  C +   E        +   +DI+ AK++AT    L   Y V   P +   +   + +  +Y    + +   N++ +        + +    + L+   E  V+G+F +  S  A  +  A    +     +T++ DV    + ++D  + L K  D+     N+ G  T  K + +FI+ N LP +  +  QT  KIF   IK H+L+F+ +S  + D  L G   A +  +GK + I  D   + D    L    L   + P    + +E+ E  KY   +  +T+E I +  +    G  +P+  S+ L  +W+   V  LVG+N++ V  ++   V V FY+P C H   L  IW++LGE YK   DIVI+K++S  NE++   ++S P++ F      +  + +  ER L+ F +F+E+ G+      D
Sbjct:   45 LLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSDIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLADSAAAESLVESSEVAVIGFFKDVESDAAKQFLLAAEATDDIPFGLTASSDVFSRYQVHQDG-VVLFKKFDEGRN--NFEGEVTKEK-LLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPRSAADHDGKLSGFKQAAEGFKGKILFIFIDSDHA-DNQRILEFFGLKKEECPAVRLITLEE-EMTKYKPESDELTAEGITEFCQRFLEGKIKPHLMSQELPEDWDRQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKEHQDIVIAKMDSTANEVEAVKVHSFPTLKFFPAGPGRTVIDYNGERTLDGFKKFLESGGQDGAGDED 483          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: R7VJ39 (Protein disulfide-isomerase OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_156715 PE=3 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 1.933e-51
Identity = 132/482 (27.39%), Postives = 230/482 (47.72%), Query Frame = 1
Query:   19 MIYCIFLFFIHFSYSTFIEVDQ-------KNF-RQIENSSKVVLYFYERNCSKCNSF---FEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILD---LNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIENDGKHS 1422
            ++  +FL    F++   I  D+        NF   +E    +++ FY   C  C +    +      +++E   + +K  K++AT+   L   + V   P +   R+ N   Y      + F N++ +    P + +   DE   LI K++ ++VG+F ++S+  A ++       +     IT  EDV +     E   + L K  D+     +   + T A  I EFI  N LP +  +  +   KIF    K HLL FI K+  +F   ++         +GK + I  DI    D ++ L IL+   L+    P   ++ + D E  KY   T ++ +E I K   ++R G+ +P+  SE +  +W+ + V +LVG+N+  V ++K   VLV FY+P C H   L  IWEELGE +K+  ++VI+K++S  NE++   + S P+I  + K ++  + +  ER L  F +F+E+ GK  
Sbjct:    3 VLAALFLTLFAFAHCDDIAEDEGVLVLTEANFDAALEKHDAILVEFYAPWCGHCKALAPEYATAAKKLNDE--GSTLKLGKVDATVETKLATKFSVRGYPTIKFFRNGNPIDYSAGRKADDFINWMKKKTGPPAVTVATVDEAKALIEKDDVVIVGFFKDQSTDAAKAFLAVASQYDDVPFAITEAEDV-FTDNKVEGEAVVLFKKFDEGRN--DLTADLTEAN-IKEFIGANQLPTVIEFTQEAAPKIFGGDAKNHLLFFISKTSDDFQAKMDEYKKVAPEFKGKVLFIYIDI----DDEDNLRILEFFGLSPDVCPAVRYITLGD-EMTKYKPETDALDAESIKKFVTDVRAGTVKPHLMSEDVPEDWDATPVKTLVGKNFNEVAKDKTKGVLVEFYAPWCGHCKQLAPIWEELGEKFKDNDEVVIAKMDSTANELEDVKVQSFPTIKFFPKDSEEVIDYNGERTLEGFTKFLESGGKDG 473          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: A0A3M6TYB6 (Protein disulfide-isomerase OS=Pocillopora damicornis OX=46731 GN=pdam_00000527 PE=3 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 1.954e-51
Identity = 130/478 (27.20%), Postives = 236/478 (49.37%), Query Frame = 1
Query:   34 FLFFIHFSYSTFIEVDQKNF--------RQIENSSKVVLYFYERNCSKCNSFF-EIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSN------FINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFD--IKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIENDGK 1416
            FL F+  S+   IE ++           + I ++  +++ FY   C  C +   E        +   + IK AK++AT    L   YQV   P      +L  F+ G   +Y G         ++ +    P + +   DE+     K + +VVG++ ++ S  A ++  A   ++  +  I  + D+    + N   ++ L K  D+     +Y+G + S ++I +F++ N LP +  +N++   KIF   IK H+L+F  K   +F    E  S A K  +G+ + +L D  I+ +  I E   I   +  + PT   + + + +  KY + T  VT+E++      + +GS +P+  S+ +  +W+   V  LVG+N+  V ++K   VLV FY+P C H   L  IW+ELGE +K++ DIVI+K++S  NE++   I S P++  + K +   + ++  R L +F++F+E+DGK
Sbjct:    8 FLSFVALSFGADIEEEENVLVLTEAVFDQAISDNEHILVEFYAPWCGHCKALAPEYAKAATKLKEEGSAIKLAKVDATKETKLGEKYQVQGYP------TLKFFRSGKPVEYSGGRTESEIITWLKKKTGPPAVELTTADEVKEFKEKSDVVVVGFYADKESDAAKAFVGAAQGMDDVQFGIVHDADIAK--EHNVAENVVLFKKFDEGR--ADYDGEHKS-EDIIKFVKGNQLPLVTEFNDENAPKIFGGDIKKHVLLFASKEAEDFQAIQEAFSAAAKEFKGQVLFVLVDTNIEDNSRISEFFGI---DTKEIPTVRLINLAEDDMTKYKAETTEVTTENVKAFVSSVLDGSLKPHLLSQEIPEDWDAKPVKVLVGKNFDEVVKDKTKAVLVEFYAPWCGHCKKLAPIWDELGEKFKDRDDIVIAKMDSTANEVESVKIQSFPTLKYFPKDSDEIVDYKGGRTLEDFVKFLESDGK 471          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: A0A1I8HRX2 (Protein disulfide-isomerase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011389g1 PE=3 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 2.475e-51
Identity = 127/451 (28.16%), Postives = 224/451 (49.67%), Query Frame = 1
Query:   82 QKNFRQIENSSKVVLY-FYERNCSKCNSFF-EIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACL-LVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKS-LLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKY-PSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIENDGKH 1419
            +KNF     ++K +L  FY   C  C +   E        +  +++IK AK++AT+   L   Y V   P +   +     +Y      +   +++ +    P  R+ + D     I  +E  V+G+F + +S  A SY+ A    +    C +  + D+    K ++D  + L K  D +   + Y G +T A E+++F++ N LP I  +  +T   IF   +K HLL+F+ KS    F + ++ +    +  +GKA+ I  DI    D +  L    L   D P   F+ + D + +KY P FT  +T++++ +  + + +G  +P+  S+ +  +W+   V  LVG+N+  V  +K   VLV FY+P C H   L  IW++LGE YKN  +IVI+K++S  NE++   + S P+I  +   +   + +E +R L  F +F+E+ GK 
Sbjct:   33 EKNFDSALQANKYILVEFYAPWCGHCKALAPEYAKAAQQLKEKNSEIKLAKVDATVEGKLAEKYGVQGYPTIKFFKEQTPIEYSGGRTADTIISWLEKKLGPPTQRLDSVDAAQKFINDKEITVIGFFKDTTSDSAKSYEDAAFSKLEDIPCGMADSADIMAEFKVDQDT-VMLFKKTDGAR--IPYTGPFT-ADEVAKFVKNNKLPLINEFTQETAGDIFGGDVKKHLLVFLKKSDEAQFSNIMDQLKAPAEQFKGKALFIYVDIGVE-DNERILEFFGLKKEDCPAVRFIAL-DEDMVKYKPEFT-DITADNLAQFVQSVLDGKLKPHLMSQEVPADWDKEPVKVLVGKNFNEVARDKTKNVLVEFYAPWCGHCKQLAPIWDKLGEEYKNHENIVIAKMDSTANEVEDVKVQSFPTIKFFPANSDEIIDYEGDRTLEGFKKFLESGGKQ 476          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: A0A1I8JH11 (Protein disulfide-isomerase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 3.072e-49
Identity = 117/407 (28.75%), Postives = 207/407 (50.86%), Query Frame = 1
Query:  208 TDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACL-LVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKS-LLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKY-PSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIENDGKH 1419
            ++IK AK++AT+   L   Y V   P +   +     +Y      +   +++ +    P  R+ + D     I  +E  V+G+F + +S  A SY+ A    +    C +  + D+    K ++D  + L K  D +   + Y G +T A E+++F++ N LP I  +  +T   IF   +K HLL+F+ KS    F + ++ +    +  +GKA+ I  DI    D +  L    L   D P   F+ + D + +KY P FT  +T++++ +  + + +G  +P+  S+ +  +W+   V  LVG+N+  V  +K   VLV FY+P C H   L  IW++LGE YKN  +IVI+K++S  NE++   + S P+I  +   +   + +E +R L  F +F+E+ GK 
Sbjct:   60 SEIKLAKVDATVEGKLAEKYGVQGYPTIKFFKEQTPIEYSGGRTADTIISWLEKKLGPPTQRLDSVDAAQKFINDKEITVIGFFKDTTSDSAKSYEDAAFSKLEDIPCGMADSADIMAEFKVDQDT-VMLFKKTDGAR--IPYTGPFT-ADEVAKFVKNNKLPLINEFTQETAGDIFGGDVKKHLLVFLKKSDEAQFSNIMDQLKAPAEQFKGKALFIYVDIGVE-DNERILEFFGLKKEDCPAVRFIAL-DEDMVKYKPEFT-DITADNLAQFVQSVLDGKLKPHLMSQEVPADWDKEPVKVLVGKNFNEVARDKTKNVLVEFYAPWCGHCKQLAPIWDKLGEEYKNHENIVIAKMDSTANEVEDVKVQSFPTIKFFPANSDEIIDYEGDRTLEGFKKFLESGGKQ 459          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: A0A183CAK4 (Protein disulfide-isomerase OS=Globodera pallida OX=36090 PE=3 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 3.751e-49
Identity = 129/449 (28.73%), Postives = 218/449 (48.55%), Query Frame = 1
Query:  118 VVLYFYERNCSKCNS----FFEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIF-----INPVLR-IRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKH-NDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILD---LNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIENDGKHS 1422
            V++ FY   C  C +    + +    L + E  ++ IK  K++AT+H  L   ++V   P      +L LF+ G   +Y G  +  + +        PV + ++N DEL       E +VV YF ++ S  A +Y      ++     I  + DV    +  +D+ I L K  +D  T+F   +G  T   EI +F+Q N LP +  ++ +T S IF   IK H L+F+ K    F+        A K  +GK + +  +     D+++   I++   L   D P    + +E+ +  KY      +T+E+I+K      +G  +P+  SE +  +W    V  LVG+N++ V  ++   VLV FY+P C H   L  IW++LGE YK+  +IVI+K++S  NEI+   I S P+I  +   +K  + +  ER L  F +F+++ GK  
Sbjct:   53 VLVEFYAPWCGHCKALAPEYAKAATQLKEEE--ESSIKLGKVDATVHSELASNFEVRGYP------TLKLFKNGKPTEYGGGRDAASIVAWLKKKAGPVAKELKNADELKDYKDSAEVVVVAYFKDKDSAAAKAYLEVAGAIDDVPFGIVHDSDVSKEAELKKDDSIALFKKFDDGRTDF---DGKATDVDEIKKFVQANRLPLVSEFSQETASVIFGGEIKSHNLLFVSKESSEFEKLESEFRAAAKEFKGKVLFVFINT----DVEDNARIMEFFGLRKEDLPAVRLISLEE-DMTKYKPEWNDITTENIVKFTASYVDGKLKPHLMSEEVPDDWEKQLVKVLVGKNFEQVARDETKNVLVEFYAPWCGHCKQLAPIWDKLGEKYKDHENIVIAKMDSTANEIEDVKIQSFPTIKYFPANSKKVIDYTGERTLEGFSKFLDSGGKEG 485          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:103023413])

HSP 1 Score: 172.17 bits (435), Expect = 5.013e-47
Identity = 118/446 (26.46%), Postives = 213/446 (47.76%), Query Frame = 1
Query:  118 VVLYFYERNCSKCNSF---FEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVV---GLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILD---LNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI--FLYRKTNKIPLRFENERNLNNFIEFIENDGKHS 1422
            +++ FY   C  C +    +     ++  E   +DI+  K++AT    L   + V   P +    G    +  +Y      +   N++ +        +    + + LI   E  V+G+F +  S  A ++  A   V+     I+S++ V    +  ED+ +   K ++    F   +G  +    +S FI+ N LP +  +  QT  KIF   IK H+L+F+ K+  +F D ++    A +  +GK + I  D     D+D+   IL+   L   + P    + +ED E  KY      +T+E+I+        G  +P+  S+ +  +W+ + V +LVG+N++ V  +    V V FY+P C H   L  IW++LGE YK+  D+VI+K++S  NEI+   ++S P++  F   + +KI + +  ER L+ F +F+E+ GK  
Sbjct:   42 ILVEFYAPWCGHCKALAPEYAKAAGMLKAE--GSDIRLGKVDATEEADLAQEFGVRGYPTIKFFKGGEKSSPKEYSAGRQADDIVNWLKKRTGPAAAALTEVTQAESLIADNEVAVIGFFKDVESDGAKAFIKAAEAVDDIPFGISSDDAVFSKFEVTEDSVVLFKKFDEGRNTF---DGELSKEGLLS-FIKANQLPLVIEFTEQTAPKIFGGEIKSHILLFVPKASKDFQDKMDNFRKAAEGFKGKILFIFID----SDVDDNQRILEFFGLKKEECPALRLITLED-EMTKYKPEASEITAENIITFCTAFTEGKLKPHLMSQDIPEDWDKTPVKTLVGKNFEEVVFDPTKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDSKDVVIAKMDSTANEIEAVKVHSFPTLKFFPAGEEHKI-IDYSGERTLDGFTKFLESGGKEG 475          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: pdia2 (protein disulfide isomerase family A, member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-705])

HSP 1 Score: 146.362 bits (368), Expect = 2.122e-37
Identity = 104/454 (22.91%), Postives = 212/454 (46.70%), Query Frame = 1
Query:   94 RQIENSSKVVLYFYERNCSKCNS----FFEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIFIN---------PVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDG 1413
            R +  S  +++ FY   CS C      + ++   L +   P   I+ AK++AT    L   + +   P      +L  F+ G   +   F+    E  I          P   ++N  +   L+   + +VVG+F + +   A  + +  + +      ITS+ ++      N+D+ +   K +D+  +             +  FIQ N L  I  ++ +   KIF + +  H+L+FI+ ++ + +  L+    A    +GK + I  D+  + ++   +    ++ SDTP   F+  +  +  KY    +++  + +    + + +G  +P+  S+ +  +WN + V  LVG+N++++  +++  V V FY+P C H   L  +WE+LGE YK+  DI+I+ ++S  NE++G  +   P++ F    T +  + +  +R+L  F +F++N G
Sbjct:   65 RALSESKYLLVEFYAPWCSHCRMLEPVYSQVARQLKNESSP---IRLAKVDATEEKELAEEFGIDGFP------TLKFFKEGRRQNATDFTGKRTEKGIKLWLQRQVEPPATVLKNTKDAQELLDAHDVVVVGFFDDLNGEEAKVFYSVAVDMVSLNFGITSSPELFKKYNVNKDSVVLFKKFDDKRADISLPEDGKLDKDNLVTFIQNNSLELIITFSEENADKIFSSKVHNHILLFINTTIESHNALLDDYRAAAVEFKGKVLFIKIDV--NEEVSHVMKYFGISASDTPVLRFINTDTVK--KYAMEEETINKDTLKTFCQGVLDGKIKPHLMSQEIPEDWNKNPVKVLVGKNFEHIAFDESKNVFVEFYAPWCGHCKELAPVWEKLGEKYKDHEDIIIANMDSTANEVEGVTVQGFPTLKFFPAGTERKIVDYNGKRDLETFSKFLDNGG 505          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: pdia4 (protein disulfide isomerase family A member 4 [Source:NCBI gene;Acc:103026638])

HSP 1 Score: 105.531 bits (262), Expect = 1.247e-23
Identity = 117/474 (24.68%), Postives = 208/474 (43.88%), Query Frame = 1
Query:   88 NFRQIENSSKVVLY-FYERNCSKCNSF---FEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIM-KEESLVVGYFHNESSIPADSYKTAC--LLVNYTKCVITSNEDVKYILKTNEDNHINL------VKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFD-------IKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEI--DGFPIYSTPSIFLYRKTNKI-PLRFE-NERNLNNFIEFIENDGKHSEITND 1437
            NF  + N++ ++L  FY   C  C      +E     + N  P   I  AK++AT+   L   + V+  P +   R   +F Y    +  G  ++++E    P  +++   ++  L+   +++L+VG F +E     + Y+ AC  L  +Y      S+E VK+ LK +    + L       KH   S  F   +   TSA E+ +F + + LP   L  ++ +S   +   K  L++       +FD       +A +  R K + +  D       I    D  + L  L L+ S       +  E  +  KY    +   +E + +     + G  +P  KS+ +  N     VI  VG+ +  +  +K   VL+ FY+P C H   L+  +  L + YKN+ ++VI+K+++  N++  D + +   P+I+     NK  P++FE  ERN+  F +FIE        T D
Sbjct:  185 NFDDVVNNADIILVEFYAPWCGHCKRLAPEYEKAAKELSNRTPP--ILLAKVDATVENDLASRFDVTGYPTLKMFRKGKVFDYNGPREKIGIVDYMSEQAGPPSKQVQALKQIQELLKDGDDALIVGVFSSEEDAVYEIYQEACNTLRDDYKFRHTFSSEIVKF-LKASPGQVVMLQPEKFRSKHEPSSYSFTIKDS--TSASELQDFFKKHTLP---LVGHRKQSNDAKRYTKRPLVVVYYGVDFSFD-----YRVATQFWRSKVLEVAMDFPEYTFAIADEEDYADELKSLGLSESGEEVNVAILGEGGK--KYAMEPEEFDTEVLREFVVAFKKGKLKPIIKSQPVPKNKGPVKVI--VGKTFDEIVLDKKKDVLIEFYAPWCGHCKKLEPDYLALAKKYKNEKNLVIAKMDATANDVPHDSYKVEGFPTIYFAPSNNKQNPIKFEGGERNVEGFSKFIEEHATKLSQTRD 641          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: zgc:136472 (protein disulfide-isomerase-like [Source:NCBI gene;Acc:103036532])

HSP 1 Score: 104.375 bits (259), Expect = 2.279e-23
Identity = 108/502 (21.51%), Postives = 211/502 (42.03%), Query Frame = 1
Query:   82 QKNF-RQIENSSKVVLYFYER-NCSKCNSFFEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIFINPVLR-------------------IRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDV--KYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEI-----DGFP-IYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIENDGKHSEITNDP---DKKTVVDV--ENKRDEL 1485
            + NF R ++  S+++++FY   +     S  E      + +  ++D+K   ++ +    L     V+ +P      S+ L+  G  Y         N ++  PVL+                   I++  +L+    +++ +++G F +        +      V      +T NE V  KY      +N + L++ +  +  F     + T   ++  FI+I+++P +  YN +T SKI  + ++ HL++F+DK+   F           K  RGK + +L D    P     +    +   D P    V + D  + + PS    + +       E    G  +   +SE +   W+   V  LVG N++ V  N    VL+ FYSP    S  L  +WE+L E + +  D+V+++I+   N++     D +P I   P+++  R  +     +  E  L   +EF+  + + +++       ++K  +D   E  +DEL
Sbjct:   40 ESNFNRALKLHSQLLVHFYAPLSGESLGSILEFAQAASELKEANSDVKLGGLDVSKQKDLAKTLNVTTVP------SVRLYLSGDKY---------NPVYC-PVLKSSASIISWLKRRKGPSADLIKDLSQLEKFTAEDDLVILGLFKDVEEGAVKVFYEVAADVPDLPFGVTGNEQVFSKY---GRTENSVLLLRKSKMAEHF--EMTSETVKDDVILFIRIHEMPLVTEYNGKTSSKILSSVVQNHLILFMDKAGKGFKQTYRAFKSTAKEFRGKVLFVLID-SGEPRNGRIMEYFRVRKEDAPLVRMVNLTDSFQYQLPSDLMDIQT--FTDFIESYLQGKAKLKLQSEPVPDGWDKQPVKELVGMNFERVAFNHEKNVLILFYSPWSSDSRALFPLWEDLAEHFSDSEDVVVARIDITANDVNIRMMDRYPCIKVFPAVYAERVVS-----YSGEAKLEPIVEFVNAESERAKVDKAKEVIERKKYLDAQKEAAKDEL 512          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: zgc:136472 (protein disulfide-isomerase-like [Source:NCBI gene;Acc:103036532])

HSP 1 Score: 103.99 bits (258), Expect = 2.567e-23
Identity = 102/478 (21.34%), Postives = 201/478 (42.05%), Query Frame = 1
Query:   82 QKNF-RQIENSSKVVLYFYER-NCSKCNSFFEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIFINPVLR-------------------IRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDV--KYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEI-----DGFP-IYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIENDGKHSEI 1428
            + NF R ++  S+++++FY   +     S  E      + +  ++D+K   ++ +    L     V+ +P      S+ L+  G  Y         N ++  PVL+                   I++  +L+    +++ +++G F +        +      V      +T NE V  KY      +N + L++ +  +  F     + T   ++  FI+I+++P +  YN +T SKI  + ++ HL++F+DK+   F           K  RGK + +L D    P     +    +   D P    V + D  + + PS    + +       E    G  +   +SE +   W+   V  LVG N++ V  N    VL+ FYSP    S  L  +WE+L E + +  D+V+++I+   N++     D +P I   P+++  R  +     +  E  L   +EF+  + + +++
Sbjct:   37 ESNFNRALKLHSQLLVHFYAPLSGESLGSILEFAQAASELKEANSDVKLGGLDVSKQKDLAKTLNVTTVP------SVRLYLSGDKY---------NPVYC-PVLKSSASIISWLKRRKGPSADLIKDLSQLEKFTAEDDLVILGLFKDVEEGAVKVFYEVAADVPDLPFGVTGNEQVFSKY---GRTENSVLLLRKSKMAEHF--EMTSETVKDDVILFIRIHEMPLVTEYNGKTSSKILSSVVQNHLILFMDKAGKGFKQTYRAFKSTAKEFRGKVLFVLID-SGEPRNGRIMEYFRVRKEDAPLVRMVNLTDSFQYQLPSDLMDIQT--FTDFIESYLQGKAKLKLQSEPVPDGWDKQPVKELVGMNFERVAFNHEKNVLILFYSPWSSDSRALFPLWEDLAEHFSDSEDVVVARIDITANDVNIRMMDRYPCIKVFPAVYAERVVS-----YSGEAKLEPIVEFVNAESERAKV 485          
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002052.1 (pep scaffold:Pmarinus_7.0:GL480798:2613:20969:-1 gene:ENSPMAG00000001848.1 transcript:ENSPMAT00000002052.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 1.306e-21
Identity = 82/375 (21.87%), Postives = 159/375 (42.40%), Query Frame = 1
Query:  214 IKFAKINATLHPSLLFLYQVSDLPMVV----GLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDL-NISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI 1323
            ++   ++   H +L   + VS  P  +    G R+     Y    + E  + +       P + +    E    +  +  +++G+F +  S    ++       +     +TS+E+V      + D+ +   K ++    F   + N+    + S    ++    +     QT   +F   + +H+L+F + S   F +  E    A    RGK + +L +    P+ D  L++ +L + +  P    VKV        PSF+   T+ +I    ++  +   +P  KS+ +  +WN   V  LVG+N+     ++   V V FY+  C H   L  +WE+LG  YK+  +IVI+K+++  NE+    I   P I
Sbjct:   25 VRLGSLDGETHATLATEFDVSHYPDFLLFDPGSRA-KPRHYHAQREAEALAKWATRRAGPPAVTVATTAEAQAFVDSDSLVLLGFFKDTESRDLKTFLEIADTYDEVPFGVTSSEEVFAKYGVSTDSIVLFKKFDEGQKSFTPIDLNFRHGIK-SHTAVVHGCECLCGCTVQTFPLLFSGLVNVHILLFANASSEGFPELFEQFKAAAPPFRGKILFVLLN-SAVPENDNVLDLFELTDGARLPAIRLVKVNKDMVKHVPSFS-DFTTANITSFCQDYLDEHNKPFSKSQEIPKDWNKRPVKVLVGKNFDEFVFDETKNVFVEFYASWCDHCKKLAPVWEQLGVQYKDHDNIVIAKMDAEKNEVAAVHIPGYPKI 395          
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Match: pdia4 (protein disulfide isomerase family A, member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5493])

HSP 1 Score: 84.3445 bits (207), Expect = 1.641e-17
Identity = 111/482 (23.03%), Postives = 212/482 (43.98%), Query Frame = 1
Query:   82 QKNFRQIENSSKVVLY-FYERNCSKCNS----FFEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEG-------FSNFINEIFINPVLR-IRNKDELDVLIMKEESLVV-GYFHNESSIPADSYK-TACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQST----EF-LNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIF-IDKSLLNFDDFLEGISLALKTIRGKAISIL-----FDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEI-------DGFP-IYSTPSIFLYRKTNKIPLRF-ENERNLNNFIEFIENDGKHS 1422
            + NF +I N + ++L  FY   C  C      + +    L  N  P   I  AK++AT+   L   + VS  P      +L LF+ G  YDY G        S+ I +    P  + +++  +L+  +   + +V+ G F NE  +    ++ T   +    K   T  E++K  LK  +   + L     QS     +F  +   + T + ++  F++ + +P +       ++K + +   L ++ + +D    +FD        A +  R K + +      F    + + D +  + DL ++++       + D    KY    +   ++ +         G  +   KS+ L P  N   V  +VG  ++ +  + +  VL+ FY+P C H  +L+ I+++LG+ YK    +VI+K+++ +N+I       +GFP IY +PS    R     P++F +  R+L +  +FIE   KH+
Sbjct:  178 ESNFDEIVNDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKNTPP---IPLAKVDATVESELGKRFGVSGYP------TLKLFRKGKAYDYNGPREQYGIVSHMIEQA--GPASQELKSMKQLNGFVQNGDDVVILGVFKNEQDVALQLFQETGNNVREEFKFYHTFEENIKNHLKAVDGQVVVLHPERFQSKYEPKQFTFDIQADSTDS-DLKAFVEKHSVPLVGQRKPSNEAKRYASRRPLVVVFYGVD---FSFD-----YRTATQFWRSKVLEVAKDFPKFTFAIASEDDYSKELSDLGLAESGEEVNAAILDASGKKYAMAPEEFDADVLRDFVISFEKGKLKAVVKSQPL-PKSNKGPVKVVVGRTFEQMVLDNSKDVLIEFYAPWCGHCKSLEPIYKDLGKKYKGHKGLVIAKMDATVNDIPHDSYKAEGFPTIYFSPSGAKDR-----PIKFADGSRDLESLSKFIE---KHA 630          
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Match: pdia3 (protein disulfide isomerase family A, member 3 [Source:ZFIN;Acc:ZDB-GENE-031002-9])

HSP 1 Score: 60.8474 bits (146), Expect = 3.636e-10
Identity = 41/167 (24.55%), Postives = 84/167 (50.30%), Query Frame = 1
Query:  919 SDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDG-FPIYSTPSIFLYRKTNK-IPLRFENERNLNNFIEFIENDG 1413
             D P  A  K    + +    FT+   S  +    ++  +G  + + KSE + P  N   V  +V E +  +  +++  VL+ FY+P C H  NL+  + EL +  KN  +I+I+K+++  N++   + +   P+I+     +K  P ++E  R +++FI +++ + 
Sbjct:  317 GDVPVVAIKKSNGDKYILREEFTRDGKS--LENFLQDYFDGKLKKHLKSEPI-PEDNDGPVKVVVAEIFDELVNDESKDVLIEFYAPWCGHCKNLEPKYLELADKLKNDPNILIAKMDATANDVPAQYDVRGFPTIYFSPMGSKDSPKKYEGGREVSDFISYLKREA 480          
BLAST of Protein disulfide-isomerase vs. Ensembl Yeast
Match: EUG1 (Protein disulfide isomerase of the endoplasmic reticulum lumen; EUG1 has a paralog, PDI1, that arose from the whole genome duplication; function overlaps with that of Pdi1p; may interact with nascent polypeptides in the ER [Source:SGD;Acc:S000002926])

HSP 1 Score: 77.0258 bits (188), Expect = 1.720e-15
Identity = 49/161 (30.43%), Postives = 87/161 (54.04%), Query Frame = 1
Query:  952 EDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKN----KSDIVISKINSNLNEIDGFPIYSTPSIFLYRKT-NKIPLRFENERNLNNFIEFIENDGKH 1419
            E++ +L+ P   + +  + I++L ++ R G+ +P  KSE + P    SNV  +VG+ + ++  + +  VLV +Y+  C HS     I+EE+     +    +  I+I++++S  N+I  FP+   P+I LY    N  P+ F   RNL +  EFI+  G H
Sbjct:  332 EEYAKLEKP---QPLDRDMIVQLVKDYREGTAKPIVKSEEI-PKEQKSNVYKIVGKTHDDIVHDDDKDVLVKYYATWCIHSKRFAPIYEEIANVLASDESVRDKILIAEVDSGANDILSFPVTGYPTIALYPAGNNSKPIIFNKIRNLEDVFEFIKESGTH 488          
BLAST of Protein disulfide-isomerase vs. Ensembl Yeast
Match: PDI1 (Protein disulfide isomerase; multifunctional oxidoreductase of the ER lumen, essential for disulfide bond formation in secretory and cell-surface proteins, processing of non-native disulfide bonds; Ero1p activator; complexes with exomannosidase, Mnl1p to facilitate the recognition of misfolded glycoproteins and the trimming of glycan Man8GlcNAc2 to Man7GlcNAc2 on substrates, thereby accelerating ERAD; PDI1 has a paralog, EUG1, that arose from the whole genome duplication [Source:SGD;Acc:S000000548])

HSP 1 Score: 72.7886 bits (177), Expect = 3.837e-14
Identity = 43/140 (30.71%), Postives = 76/140 (54.29%), Query Frame = 1
Query: 1000 SEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNK-SDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKI-PLRFENERNLNNFIEFIENDG 1413
            S+ I  L ++   G   P  KS+ +  N ++S V  LVG+N+  +  +    VLV +Y+P C H   L   ++EL + Y N  SD++I+K++   N++ G  I   P+I LY    K   + ++  R+L++  +FI+ +G
Sbjct:  346 SKAIESLVKDFLKGDASPIVKSQEIFENQDSS-VFQLVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGYPTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENG 484          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO36830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHH5])

HSP 1 Score: 181.03 bits (458), Expect = 6.058e-51
Identity = 124/463 (26.78%), Postives = 231/463 (49.89%), Query Frame = 1
Query:   82 QKNFRQIENSSK-VVLYFYERNCSKCNSF---FEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFS------NFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIENDGKHSEITNDP 1440
            +KNF +   ++K V++ FY   C  C +    +      + +E   ++IK AK++AT    L   +QV   P      ++  F+ G   +Y G        +++N+    P   +   D +   I KE + VVG+F ++ S  A ++ +A   ++  +  I S++ +    K  E + I L K  D+     +Y+G Y   K I +F++ N LP +  ++++T  KIF   +K H+L+F +K+   F    E  +   K  +GK + +  + +   D    +    +  S+ PT   + + D +  KY      +TSE++ +  +   +   +P+  S  +  +W++  V  L G+N+  V  NK+  V V FY+P C H   L  IW++LGE YK+ +DIV++K++S  NE++G  ++S P+I  + K  +  + +   R L++F++F+E+ GK     N+P
Sbjct:   31 EKNFDEAVAANKHVLVEFYAPWCGHCKALAPEYAKAAGQLKSE--KSEIKLAKVDATAETKLGEKFQVQGYP------TIKFFKDGKPSEYAGGRTAPEIVSWLNKKTGPPAKDLATADAMKDFITKEVA-VVGFFTDKESDAAKAFLSAADGIDDVEFGIVSDKAIASEHKV-EGDKIVLFKKFDEGRN--DYDGEYDFEK-IQQFVKANQLPLVTEFSDETAPKIFGGDVKHHILLFTNKTSDGFKATHEAFTGGAKDFKGKVLFVYVNTEVE-DNQRIVEFFGIQSSELPTIRLINLADDDMTKYKPTAAEITSENVKEFVQAFLDKKLKPHLLSAEIPEDWDSKPVKVLCGKNFDEVARNKDKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHADIVVAKMDSTANEVEGVKVHSFPTIKYFPKEGEA-VDYNGGRTLDDFVKFLESGGKAG---NEP 475          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO32930 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STM8])

HSP 1 Score: 99.3673 bits (246), Expect = 5.621e-22
Identity = 115/484 (23.76%), Postives = 200/484 (41.32%), Query Frame = 1
Query:   82 QKNFRQIENSSKVVLY-FYERNCSKCNS----FFEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRN--KDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVK------YILKTNEDNHINLVKHND---QSTEFLN--------YNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVT-----------SEHILKLF-EEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNE------IDGFP-IYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIE 1404
            ++NF ++ N   ++L  F+   C  C      + +    L  N+ P   I  A ++AT+   L   Y+V   P +   R     +Y    D  G ++++    + P  RI +  K   D +  K++  ++G+F  E     +SY             + +N DV+      +        H  + K +    Q   FL+        Y G   S   +  F +   +P + LY +  K K +       +   +D     FD+      +A +  R K I +  D +     D T  I +   S+     F   E  EE+    F K              SE  L+ F EE + G+ +P  KS+ + P  N   V  +VG+ +  +  +    VL+ FY+P C H   L+  +++LG+ ++N  +IVI+KI++  N+      ++GFP IY     F   K  K P++F+  R L + I+F+E
Sbjct:  183 KENFTEVVNRESLMLVEFFAPWCGHCKQLAPEYEKAAQELQKNDPP---IPLAIVDATIESELAQKYEVQGYPTLKVFRKGKATEYKGQRDQYGIASYMRSQ-VGPSSRILSSLKAVQDFMKEKDDVTIMGFFDGEDDKMLESY-------------LEANNDVRDDYPFAHTFDAAAKKHFGIKKSSIVLFQPERFLSKYEPKHFVYEGKDLSPAALQGFYKDKRVPLVGLYTSYDKDKKYAARPLCIVYYGVD---FGFDN-----RVATQFWRSKVIEVAKDHR-----DITFAIANEEESEQELKDFGLAESGEEVNVGCFDKEGRKFRMDPDEEEFSEDSLREFVEEFKAGNLKPIIKSQPV-PKSNKEPVTVVVGKTFDEIVNDPKKDVLIEFYAPWCGHCKALEPTFKKLGKHFRNDKNIVIAKIDATANDVPSTYAVEGFPTIY-----FATSKDKKNPIKFDGGRELKDLIKFVE 630          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO31634 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXD7])

HSP 1 Score: 80.4925 bits (197), Expect = 4.205e-16
Identity = 45/132 (34.09%), Postives = 76/132 (57.58%), Query Frame = 1
Query: 1015 KLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEI-DGFPIYSTPSIFLYRKTNKI-PLRFENERNLNNFIEFIE 1404
            +  E+   GS +P+ KSE L P  N   V  +VGEN+K +  +    VL+ FY+P C H  +L+  + ELGE  ++  DIVI+K+++  N+    F +   P+I+     NK  P ++E  R +++F++FI+
Sbjct:  336 QFLEDYFAGSLKPHIKSEPL-PESNDGPVKVVVGENFKEIVNDPTKDVLIEFYAPWCGHCKSLEPKYNELGEKLQDVKDIVIAKMDATANDAPPNFSVQGFPTIYWAPANNKENPEKYEGGREVSDFVDFIK 466          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO33843 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR22])

HSP 1 Score: 73.9442 bits (180), Expect = 1.011e-15
Identity = 41/130 (31.54%), Postives = 73/130 (56.15%), Query Frame = 1
Query: 1036 NGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNE------IDGFP-IYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIE 1404
            +G+ +P  KS+ + P  N   V  +VG+ +  +  +    VL+ FY+P C H   L+  +++LG+ ++N  +IVI+KI++  N+      ++GFP IY     F   K  K P++F+  R L + I+F+E
Sbjct:    9 SGNLKPIVKSQPV-PKSNKEPVTVVVGKTFDEIVNDPKKDVLIEFYAPWCGHCKALEPTFKKLGKHFRNDKNIVIAKIDATANDVPSTYAVEGFPTIY-----FATSKDKKNPIKFDGGRELKDLIKFVE 132          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO47340 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMG9])

HSP 1 Score: 68.5514 bits (166), Expect = 1.638e-12
Identity = 35/106 (33.02%), Postives = 58/106 (54.72%), Query Frame = 1
Query: 1093 SNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDG--FPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIE 1404
              VI L  +N+  V   +    LV FY+P C H   L   +E+LGE Y   SD++I+K++++ +   G  F +   P+I  + K +  P  +   R++N+FI+FIE
Sbjct:   22 GKVIDLTKDNFDEVVNGEKF-ALVEFYAPWCGHCKQLAPTYEQLGEAYTQSSDVIIAKVDADGDRDLGSRFDVKGFPTIKYFPKGSTTPEEYNGGRDINDFIKFIE 126          

HSP 2 Score: 64.3142 bits (155), Expect = 3.565e-11
Identity = 31/105 (29.52%), Postives = 62/105 (59.05%), Query Frame = 1
Query: 1093 SNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDG--FPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFI 1401
            S V  L   N+  + +N +  VLV F++P C H  NL  ++E++GE +KN+ + VI+K++++ +   G  + +   P++  + KTNK    + + R+  +F++F+
Sbjct:  140 SAVADLDESNFDKIVKNPDNNVLVEFFAPWCGHCKNLAPVYEKVGEAFKNEPNCVIAKVDADAHSALGQKYGVSGYPTLKFFSKTNKDGEEYSSGRDEQSFVDFM 244          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:101155742])

HSP 1 Score: 161.77 bits (408), Expect = 2.609e-43
Identity = 115/445 (25.84%), Postives = 212/445 (47.64%), Query Frame = 1
Query:  118 VVLYFYERNCSKCNSF---FEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVV---GLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILD---LNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSI-FLYRKTNKIPLRFENERNLNNFIEFIENDGKHS 1422
            +++ FY   C  C +    +     ++  E   + I+  K++AT    L   + V   P +    G    +  +Y      +   N++ +     V  +    + + LI   E  V+G+F + +S  A +Y+ A   ++     ITS++ V    + ++D  +   K ++    F   +G  T    ++ F++ N LP +  +  QT  KIF   IK H+L+F+ K+  +F + +E    A    +G+ + I  D     D+D+   IL+   L   + P    + +ED E  KY   +K +T+E I+    +   G  +P+  S+ +  +W+ + V  LVG+N++ V  +    V + FY+P C H   L  IW++LGE YK+ SDIV++K++S  NEI+   ++S P++ F      +  + +  ER L  F +F+E+ GK  
Sbjct:   42 ILVEFYAPWCGHCKALAPEYAKAAGMLKAE--GSQIRLGKVDATEETELAQEFGVRGYPTIKFFKGGDKESPKEYSAGRQADDMVNWLKKRTGPAVTSLTEVTDAESLIADNEVAVIGFFKDANSDDAKAYEKAAEAMDDVPFAITSSDAVYSKFEVSKDGVVLFKKFDEGRNTF---DGELTKDGLLA-FVKANQLPLVIEFTEQTAPKIFGGDIKSHILMFLPKAASDFQEKMEQFKKAAAGFKGQILFIFID----SDVDDNQRILEFFGLKKEECPAIRLITLED-EMTKYKPESKDITAESIVAFCTQFVEGKLKPHLMSQDIPEDWDKNPVKVLVGKNFEEVAFDPKKNVFIEFYAPWCGHCKQLAPIWDKLGEKYKDSSDIVVAKMDSTANEIESVKVHSFPTLKFFPAGEERQVIDYNGERTLEGFTKFLESGGKEG 475          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia2 (protein disulfide-isomerase [Source:NCBI gene;Acc:101164281])

HSP 1 Score: 138.658 bits (348), Expect = 7.101e-35
Identity = 105/447 (23.49%), Postives = 200/447 (44.74%), Query Frame = 1
Query:   94 RQIENSSKVVLYFYERNCSKCNSFFEI---MNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVV----GLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIENDG 1413
            R +  +  +++ FY   C  C  F  I      ++  E   ++++ AK++A     L   + V   P V     G R   + +Y       G   ++          + + D     I      VVG+F N  S  A  +K     +   +  +T++ +V    +   +  +   K +D   +F     +      ++ FI+ N L  I  +N +T  KIF + ++LH L+FI+ ++ +    LE      +  +GK + IL D+ T+  +   LN   +   D+PT   + ++  ++ K  S    +T + + +L +E+ + +  P  +SE +  +W+   V  LV +N++ V  +    V V FY+P C H   L  IWE+LGE Y +  DI+I+K+++  NE++   I   P++  +   +K    +   R+L    +F++N G
Sbjct:   77 RALSETRHLMVEFYAPWCGYCRRFEPIYAEAAGMLKEE--GSEMRLAKVDAIEEKELAEEFNVDSFPTVKLFMNGDRKEPI-EYTGKRTPSGIVQWLKRRSGPGAADLNSADSAAEFINTHNVSVVGFFDNLESEAAAVFKEVAFDLTDVEFAVTASPEVFKEYEVTANKVVLFKKFDDGRADFELSEEDKLDKHNLTNFIKENSLELIVPFNQETSDKIFTSRVRLHCLLFINSTVESQMSLLEESKTVAREFKGKVLYILIDMTTA--VSHVLNYFGVLEKDSPTVRMINMDTQKKFKIAS---EMTIDSLRQLSQEVVDDTAEPYLRSEEIPEDWDKGPVKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYADHDDIIIAKMDATANEVESVAIDGFPTLKYFPAGDK--EVYTGNRDLETLSKFLDNGG 513          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia2 (protein disulfide-isomerase [Source:NCBI gene;Acc:101164281])

HSP 1 Score: 136.346 bits (342), Expect = 1.659e-34
Identity = 84/323 (26.01%), Postives = 160/323 (49.54%), Query Frame = 1
Query:  445 VVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIENDG 1413
            VVG+F N  S  A  +K     +   +  +T++ +V    +   +  +   K +D   +F     +      ++ FI+ N L  I  +N +T  KIF + ++LH L+FI+ ++ +    LE      +  +GK + IL D+ T+  +   LN   +   D+PT   + ++  ++ K  S    +T + + +L +E+ + +  P  +SE +  +W+   V  LV +N++ V  +    V V FY+P C H   L  IWE+LGE Y +  DI+I+K+++  NE++   I   P++  +   +K  + +   R+L    +F++N G
Sbjct:   89 VVGFFDNLESEAAAVFKEVAFDLTDVEFAVTASPEVFKEYEVTANKVVLFKKFDDGRADFELSEEDKLDKHNLTNFIKENSLELIVPFNQETSDKIFTSRVRLHCLLFINSTVESQMSLLEESKTVAREFKGKVLYILIDMTTA--VSHVLNYFGVLEKDSPTVRMINMDTQKKFKIAS---EMTIDSLRQLSQEVVDDTAEPYLRSEEIPEDWDKGPVKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYADHDDIIIAKMDATANEVESVAIDGFPTLKYFPAGDKEVISYTGNRDLETLSKFLDNGG 406          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia2 (protein disulfide-isomerase [Source:NCBI gene;Acc:101164281])

HSP 1 Score: 134.035 bits (336), Expect = 4.143e-33
Identity = 102/447 (22.82%), Postives = 193/447 (43.18%), Query Frame = 1
Query:   94 RQIENSSKVVLYFYERNCSKCNSFFEI---MNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVV----GLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIENDG 1413
            R +  +  +++ FY   C  C  F  I      ++  E   ++++ AK++A     L   + V   P V     G R   + +Y       G   ++          + + D     I      VVG+F N  S  A  +K     +   +  +T++ +V    +   +  +   K +D   +F     +      ++ FI+ N L  I  +N +T  KIF + ++LH L+FI+ ++ +    LE      +  +GK + IL D+ T+  +   LN   +   D+PT   + ++  ++ K                  E+ + +  P  +SE +  +W+   V  LV +N++ V  +    V V FY+P C H   L  IWE+LGE Y +  DI+I+K+++  NE++   I   P++  +   +K  + +   R+L    +F++N G
Sbjct:   81 RALSETRHLMVEFYAPWCGYCRRFEPIYAEAAGMLKEE--GSEMRLAKVDAIEEKELAEEFNVDSFPTVKLFMNGDRKEPI-EYTGKRTPSGIVQWLKRRSGPGAADLNSADSAAEFINTHNVSVVGFFDNLESEAAAVFKEVAFDLTDVEFAVTASPEVFKEYEVTANKVVLFKKFDDGRADFELSEEDKLDKHNLTNFIKENSLELIVPFNQETSDKIFTSRVRLHCLLFINSTVESQMSLLEESKTVAREFKGKVLYILIDMTTA--VSHVLNYFGVLEKDSPTVRMINMDTQKKFKI-----------------EVVDDTAEPYLRSEEIPEDWDKGPVKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYADHDDIIIAKMDATANEVESVAIDGFPTLKYFPAGDKEVISYTGNRDLETLSKFLDNGG 505          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia2 (protein disulfide-isomerase [Source:NCBI gene;Acc:101164281])

HSP 1 Score: 120.168 bits (300), Expect = 1.587e-28
Identity = 101/450 (22.44%), Postives = 191/450 (42.44%), Query Frame = 1
Query:   94 RQIENSSKVVLYFYERNCSKCNSFFEI---MNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVV----GLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTK---SKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIENDG 1413
            R +  +  +++ FY   C  C  F  I      ++  E   ++++ AK++A     L   + V   P V     G R     +Y       G   ++          + + D     I      VVG+F N  S  A  +K     +   +  +T++ +V                       F  Y     +A ++  F ++   P+  L + + +    KIF + ++LH L+FI+ ++ +    LE      +  +GK + IL D+ T+  +   LN   +   D+PT   + ++  ++ K       + SE  +   + +R  S+ P  +SE +  +W+   V  LV +N++ V  +    V V FY+P C H   L  IWE+LGE Y +  DI+I+K+++  NE++   I   P++  +   +K  + +   R+L    +F++N G
Sbjct:   81 RALSETRHLMVEFYAPWCGYCRRFEPIYAEAAGMLKEE--GSEMRLAKVDAIEEKELAEEFNVDSFPTVKLFMNGDRK-EPIEYTGKRTPSGIVQWLKRRSGPGAADLNSADSAAEFINTHNVSVVGFFDNLESEAAAVFKEVAFDLTDVEFAVTASPEV-----------------------FKEYE---VTANKVVLFKKVRLKPSSGLLSTERQCNADKIFTSRVRLHCLLFINSTVESQMSLLEESKTVAREFKGKVLYILIDMTTA--VSHVLNYFGVLEKDSPTVRMINMDTQKKFK-------IASEMTI---DSLRQLSQEPYLRSEEIPEDWDKGPVKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYADHDDIIIAKMDATANEVESVAIDGFPTLKYFPAGDKEVISYTGNRDLETLSKFLDNGG 489          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000074835.1 (SMESG000074835.1)

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 395/400 (98.75%), Postives = 399/400 (99.75%), Query Frame = 1
Query:  286 MVVGLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIENDGKHSEITNDPDKKTVVDVENKRDEL 1485
            MVVGLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTS+KEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKS+TSEHILKLFE+IRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKN TVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPS+FLYRKTNKIPLRFENERNLNNFIEFIENDGKHSEITNDPDKKTVVDVENKRDEL
Sbjct:    1 MVVGLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSSKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSITSEHILKLFEKIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNFTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSVFLYRKTNKIPLRFENERNLNNFIEFIENDGKHSEITNDPDKKTVVDVENKRDEL 400          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000023147.1 (SMESG000023147.1)

HSP 1 Score: 184.496 bits (467), Expect = 8.731e-52
Identity = 116/437 (26.54%), Postives = 223/437 (51.03%), Query Frame = 1
Query:  100 IENSSKVVLYFYERNCSKCNSFF-EIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIEN 1407
            IE +  V++ FY   C  C +   E  +     +  ++ IK AK++AT+   L   +++   P +   +   +  YG     +   +++ +    P   +++ +E   LI  ++ +VVG+F +++S  A ++++     +     +TS + V    K + D+ I L K  D+     ++ G +   K+I  FI    LP +  +N +T  KIF   IK H+L FI K    + +       + K   G+ + ++ +     D D  L    +  +DTP+F  +++ED + +K+     +++SE++    + + +G  +P+  ++ +  +W+ + V  LVG+N+ +V  +K+  V V FY+P C H   L  IW++LGE YK+ +DIVI+K++S  NE++G  I S P+I  + K +   + FE +R L  F +FI++
Sbjct:   38 IEKNKYVLVEFYAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQASAAAKAFESVADSKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKKFDEGRN--DFTGPFVD-KDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINTDEE-DNDRVLEFFGMAKTDTPSFRMIQLED-DMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDS 469          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000009885.1 (SMESG000009885.1)

HSP 1 Score: 135.191 bits (339), Expect = 6.409e-34
Identity = 115/487 (23.61%), Postives = 224/487 (46.00%), Query Frame = 1
Query:   22 IYCIFLFFIHFSYSTFIEV---DQKNFRQIENSSKVVLY-FYERNCSKCNSF---FEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEG------FSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKS--KIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKV-EDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIENDGKHSEITN 1434
            I+ I +  +H  Y  F  V   D  N ++     K VL  FY   C +C  F   F ++  ++ +  PD  I    +N   +  ++  Y + ++P      S+ LFQ   ++DY        F+ ++ E      + +   + L  L+  E  + VG+F N S++   +++           +I +NE +  +     D+ I + +  D     +++   +T  K + EFI     P +  ++N+ +   +IF   I  +L+  ID+    F      +  + K   GK +  ++    +P     L +L LN  D PT+ F+++  D+  + Y    + +T++ I+   + + +G+  P ++SE L   WN   V  LVG NY+ V +N+N +V V   +  C     L  +W  L   ++++ ++ I+ I+ + N+I    +   P+ FLY K ++  + F+ ER LN+  +F++++G  S  +N
Sbjct:    6 IFGISVGLVHTIYENFPHVKPLDSVNLKKRILLEKFVLVNFYATKCEQCVEFESTFSLVAKMLTDIRPDVYI--GSLNCFENTQIMREYDIPNIP------SVKLFQKTRSFDYRAVESTLRFAQWVFERMDEEFIIVDRLEILKELVETELFMAVGFFKNISALKCKTFQKVAKSTEKLPWIIVTNETLFNVYSIRLDDSIVMFRQFDDPR--IDFAVEFTE-KNVKEFIIKYSSPLLSEFHNRKRKIPEIFDTAILNYLVSIIDEKHKKFTLHKMMLQKSAKLFLGK-VKFVYVKLDNPATHYFLTVLRLNKEDIPTYRFMELFPDYRTVIYRPVDEKMTAKRIVTFVQNVLDGNLSPYYRSEKLHQRWNKYPVKMLVGSNYEEVVKNENRSVFVLLCAEKCKQCSKLRHMWHNLAIQFQDQPEVWIATIDVDKNDIRNARVEKFPTFFLYPKGSQKAIEFDGERTLNDLKQFVDSNGTLSRPSN 480          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000069732.1 (SMESG000069732.1)

HSP 1 Score: 110.153 bits (274), Expect = 1.317e-25
Identity = 100/472 (21.19%), Postives = 203/472 (43.01%), Query Frame = 1
Query:   25 YCIFLFFIHFSYSTFIEVDQKN---------FRQIENSSKVVLY-FYERNCSKCNSFFEIMNNLIDNEWP-DTDIKFAKINATLHPSLLFLYQVSDLPMVVGLRSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVKHNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIK-LHLLIFIDKSLLNFDDFLEG-ISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFI 1401
            +C FL       + F E++ +N         F ++ N  K +L  FY   C           N   N    ++ IK  K++ T+   L   +++   P ++  +      Y   + +    N++       ++ + + D LD +  K + L V      + I  D++  A  L++  +           +    +     L++  D +   + +     + +++ +F++ N++P++  Y+     K+FQN  + +H ++F+D      D F E    L    I    I+ +    T       +   ++++S+ P       +  + L  P F + +  + I +   +++NG      KS+++  NWN+  V  LVG+N++ V  NK  TV V FY+P C++   L+ IWE L +   +  D++I+K++   N+I  F I S P++ L+ K +   + +   R      EF+
Sbjct:    4 FCRFLLIFFLPAAIFDELEIENDVFVVNNETFEELINDHKPILINFYAPWCKFSQKLLPHFENAAKNLLQMESRIKLGKVDVTVETDLANKFKIKSYPTIILFKEDRQIPYSKAHHHLTILNWLISKVDKLIISVNSTDSLDEVRQKTDVLFVI----NNDIMGDTFVGAAELIDDVQFATMEKHLFHSLFSNTDQTKAILIRKIDNN--LIPFGKGEINQEDVIKFVRSNEIPSVVRYSFDIGGKVFQNSHRFMHFMVFMD------DKFEEAHKELEEAAINHPEITFVMTDVTDNTTSSLIKHFNVDLSNLPHLVLSDAKH-KRLFLPGFNE-INGKRIDQFLMDVKNGKIGQFLKSQNIPENWNSEPVKILVGKNFEEVALNKQKTVFVEFYAPWCNYCKQLEPIWERLAKELLDVPDLIIAKLDKTENDIKNFEIKSFPTLKLFLKDSNEVVDYSGPRTRERLKEFL 461          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000078546.1 (SMESG000078546.1)

HSP 1 Score: 89.7373 bits (221), Expect = 9.699e-19
Identity = 53/197 (26.90%), Postives = 101/197 (51.27%), Query Frame = 1
Query:  826 KTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGNLDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKIPLRFENERNLNNFIEFIENDGK 1416
            K + GKAI I FDI +   +   L    L+I +   F  V+  +      P    ++   ++L    ++ +G+  P   +     NW+   +  L  + Y  V  +K   V V  Y+P C +S  + ++ ++LGE YK+  +++++K++S+++E+    + STP +FLY K     ++F  ER + N  +FIE++G+
Sbjct:  286 KELDGKAIFIHFDI-SKKKVQRFLE--HLSIPENEGFRVVESSEHLVNFKPENPLNLNGTYMLSFIRQVMDGTAEPELMASEPRENWHLEPIKHLTRKTYDQVVMDKTKNVFVIIYAPDCPYSREMLELLDKLGEMYKDDENVLLAKLDSSVDELPRIRVRSTPMMFLYLKDTNERIKFHGERTIENLKKFIESNGQ 479          
The following BLAST results are available for this feature:
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P4HB3.989e-4626.93prolyl 4-hydroxylase subunit beta [Source:HGNC Sym... [more]
P4HB4.019e-3926.00prolyl 4-hydroxylase subunit beta [Source:HGNC Sym... [more]
PDIA23.304e-3722.20protein disulfide isomerase family A member 2 [Sou... [more]
PDIA27.426e-3621.75protein disulfide isomerase family A member 2 [Sou... [more]
P4HB1.350e-2829.33prolyl 4-hydroxylase subunit beta [Source:HGNC Sym... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdi-21.559e-4226.63Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
pdi-21.559e-4226.63Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
pdi-23.841e-3425.33Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
pdi-23.841e-3425.33Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
pdi-11.090e-3324.17Protein disulfide-isomerase 1 [Source:UniProtKB/S... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pdi4.369e-4326.99gene:FBgn0286818 transcript:FBtr0346644[more]
Pdi4.369e-4326.99gene:FBgn0286818 transcript:FBtr0075648[more]
ERp602.763e-1421.74gene:FBgn0033663 transcript:FBtr0088058[more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p4hb1.295e-4325.39prolyl 4-hydroxylase, beta polypeptide [Source:ZFI... [more]
p4hb1.295e-4325.39prolyl 4-hydroxylase, beta polypeptide [Source:ZFI... [more]
pdia21.192e-3322.15protein disulfide isomerase family A, member 2 [So... [more]
pdia21.728e-3322.15protein disulfide isomerase family A, member 2 [So... [more]
pdia41.154e-2123.77protein disulfide isomerase family A, member 4 [So... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p4hb4.580e-4326.73prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
p4hb5.136e-4326.73prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
p4hb1.101e-4226.73prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
p4hb9.191e-4226.82prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
p4hb9.591e-4226.80prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P4hb1.412e-4325.98prolyl 4-hydroxylase, beta polypeptide [Source:MGI... [more]
Pdia21.875e-3421.56protein disulfide isomerase associated 2 [Source:M... [more]
Pdia26.699e-3421.63protein disulfide isomerase associated 2 [Source:M... [more]
Pdia29.879e-1829.57protein disulfide isomerase associated 2 [Source:M... [more]
Pdia44.816e-1621.47protein disulfide isomerase associated 4 [Source:M... [more]
back to top
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2HWU2|PDIA1_MACFU7.528e-4627.15Protein disulfide-isomerase OS=Macaca fuscata fusc... [more]
sp|P04785|PDIA1_RAT1.177e-4526.91Protein disulfide-isomerase OS=Rattus norvegicus O... [more]
sp|Q5R5B6|PDIA1_PONAB1.896e-4527.15Protein disulfide-isomerase OS=Pongo abelii OX=960... [more]
sp|P07237|PDIA1_HUMAN1.916e-4526.93Protein disulfide-isomerase OS=Homo sapiens OX=960... [more]
sp|P21195|PDIA1_RABIT8.068e-4526.07Protein disulfide-isomerase OS=Oryctolagus cunicul... [more]
back to top
BLAST of Protein disulfide-isomerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7VJ391.933e-5127.39Protein disulfide-isomerase OS=Capitella teleta OX... [more]
A0A3M6TYB61.954e-5127.20Protein disulfide-isomerase OS=Pocillopora damicor... [more]
A0A1I8HRX22.475e-5128.16Protein disulfide-isomerase OS=Macrostomum lignano... [more]
A0A1I8JH113.072e-4928.75Protein disulfide-isomerase OS=Macrostomum lignano... [more]
A0A183CAK43.751e-4928.73Protein disulfide-isomerase OS=Globodera pallida O... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p4hb5.013e-4726.46prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
pdia22.122e-3722.91protein disulfide isomerase family A, member 2 [So... [more]
pdia41.247e-2324.68protein disulfide isomerase family A member 4 [Sou... [more]
zgc:1364722.279e-2321.51protein disulfide-isomerase-like [Source:NCBI gene... [more]
zgc:1364722.567e-2321.34protein disulfide-isomerase-like [Source:NCBI gene... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002052.11.306e-2121.87pep scaffold:Pmarinus_7.0:GL480798:2613:20969:-1 g... [more]
pdia41.641e-1723.03protein disulfide isomerase family A, member 4 [So... [more]
pdia33.636e-1024.55protein disulfide isomerase family A, member 3 [So... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
EUG11.720e-1530.43Protein disulfide isomerase of the endoplasmic ret... [more]
PDI13.837e-1430.71Protein disulfide isomerase; multifunctional oxido... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO368306.058e-5126.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329305.621e-2223.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316344.205e-1634.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO338431.011e-1531.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473401.638e-1233.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p4hb2.609e-4325.84prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
pdia27.101e-3523.49protein disulfide-isomerase [Source:NCBI gene;Acc:... [more]
pdia21.659e-3426.01protein disulfide-isomerase [Source:NCBI gene;Acc:... [more]
pdia24.143e-3322.82protein disulfide-isomerase [Source:NCBI gene;Acc:... [more]
pdia21.587e-2822.44protein disulfide-isomerase [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074835.10.000e+098.75SMESG000074835.1[more]
SMESG000023147.18.731e-5226.54SMESG000023147.1[more]
SMESG000009885.16.409e-3423.61SMESG000009885.1[more]
SMESG000069732.11.317e-2521.19SMESG000069732.1[more]
SMESG000078546.19.699e-1926.90SMESG000078546.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034557 ID=SMED30034557|Name=Protein disulfide-isomerase|organism=Schmidtea mediterranea sexual|type=transcript|length=1607bp
ATGAATTGCAACGATATTATGATTTATTGCATATTTTTATTCTTTATTCA
TTTCTCCTATTCTACTTTTATTGAAGTTGACCAAAAAAATTTTAGACAAA
TTGAAAATTCATCTAAAGTTGTCTTATATTTTTATGAAAGGAATTGTTCA
AAATGCAATTCCTTCTTTGAAATAATGAATAATTTAATAGATAATGAATG
GCCTGATACGGATATTAAGTTCGCAAAAATTAATGCAACATTGCATCCGT
CTCTTTTATTTCTATATCAGGTCAGTGATTTGCCGATGGTTGTTGGTCTC
AGAAGTTTGAATTTATTCCAATATGGTCATACGTACGATTACGAGGGATT
TTCAAATTTTATAAACGAAATATTTATAAATCCAGTTCTGAGAATCAGGA
ATAAGGATGAGCTGGATGTACTAATCATGAAAGAGGAATCTCTAGTCGTT
GGATATTTTCATAACGAGAGCTCTATTCCAGCAGATTCATACAAAACGGC
ATGTTTACTGGTGAACTACACAAAATGTGTTATCACATCAAACGAGGACG
TAAAATATATTCTTAAGACTAATGAAGACAACCATATAAACCTAGTGAAG
CATAATGATCAATCAACAGAATTTCTTAACTACAACGGAAATTACACATC
GGCTAAAGAAATTTCAGAATTCATTCAAATAAATGACTTGCCGGCCATTT
TCCTGTACAACAATCAAACCAAATCGAAAATATTCCAAAATCCCATAAAA
TTACACTTGTTAATATTCATTGACAAATCGTTGCTGAATTTTGACGATTT
CCTAGAAGGAATCTCACTGGCTTTGAAAACTATCCGAGGAAAAGCTATTT
CCATTTTATTCGATATCAAGACATCTCCCGATATTGACGAGACCTTAAAT
ATTTTGGACTTAAACATATCCGACACCCCTACCTTTGCATTTGTAAAAGT
TGAGGATTTTGAAGAATTAAAATATCCGTCTTTCACTAAATCAGTCACAT
CTGAACATATTCTAAAACTGTTTGAGGAGATCCGAAACGGATCTAGGAGG
CCAAATTTCAAGTCAGAAAGTTTATCGCCGAATTGGAATACGAGTAATGT
CATTAGTCTCGTGGGTGAAAATTACAAAAATGTCACCGAAAATAAAAATT
TAACAGTTCTCGTCAATTTTTACTCCCCAAGTTGCCACCATTCTGGAAAC
CTTGACAAAATATGGGAGGAGCTTGGTGAATTTTACAAGAATAAATCGGA
TATTGTCATAAGTAAAATTAATTCCAATCTAAATGAAATAGACGGATTTC
CGATTTATTCCACTCCGTCGATTTTTCTTTATAGGAAGACCAATAAAATT
CCCCTTCGATTCGAGAATGAGAGGAATTTAAATAATTTTATAGAATTCAT
TGAAAATGATGGGAAACATTCTGAAATTACAAACGATCCAGACAAAAAAA
CCGTTGTAGACGTTGAAAATAAACGAGATGAGTTGTGAAAATAATGAAAT
ATGAAATGAAATGTTCATTAAACAAAAAAAAACCGTTGTAGACGTTGAAA
ATAAACGAGATGAGTTGTGAAAATAATGAAATATGAAATGAAATGTTCAT
TAAACAA
back to top

protein sequence of SMED30034557-orf-1

>SMED30034557-orf-1 ID=SMED30034557-orf-1|Name=SMED30034557-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=496bp
MNCNDIMIYCIFLFFIHFSYSTFIEVDQKNFRQIENSSKVVLYFYERNCS
KCNSFFEIMNNLIDNEWPDTDIKFAKINATLHPSLLFLYQVSDLPMVVGL
RSLNLFQYGHTYDYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVV
GYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVK
HNDQSTEFLNYNGNYTSAKEISEFIQINDLPAIFLYNNQTKSKIFQNPIK
LHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLN
ILDLNISDTPTFAFVKVEDFEELKYPSFTKSVTSEHILKLFEEIRNGSRR
PNFKSESLSPNWNTSNVISLVGENYKNVTENKNLTVLVNFYSPSCHHSGN
LDKIWEELGEFYKNKSDIVISKINSNLNEIDGFPIYSTPSIFLYRKTNKI
PLRFENERNLNNFIEFIENDGKHSEITNDPDKKTVVDVENKRDEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR013766Thioredoxin_domain
IPR012336Thioredoxin-like_fold
Vocabulary: biological process
TermDefinition
GO:0045454cell redox homeostasis
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
Vocabulary: molecular function
TermDefinition
GO:0016853isomerase activity
GO:0003756protein disulfide isomerase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 360..474
e-value: 4.8E-22
score: 80.1
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 129..229
e-value: 2.9E-9
score: 39.1
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 19..123
e-value: 3.3E-10
score: 41.8
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 230..359
e-value: 5.3E-16
score: 61.1
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 14..123
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 315..469
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 131..240
IPR013766Thioredoxin domainPFAMPF00085Thioredoxincoord: 367..468
e-value: 2.5E-8
score: 33.8
IPR013766Thioredoxin domainPROSITEPS51352THIOREDOXIN_2coord: 344..472
score: 8.981
NoneNo IPR availablePFAMPF13848Thioredoxin_6coord: 169..339
e-value: 2.7E-15
score: 56.8
NoneNo IPR availablePANTHERPTHR18929PROTEIN DISULFIDE ISOMERASEcoord: 27..476
NoneNo IPR availablePANTHERPTHR18929:SF101PROTEIN DISULFIDE-ISOMERASEcoord: 27..476
NoneNo IPR availableCDDcd02981PDI_b_familycoord: 129..228
e-value: 5.95035E-4
score: 36.9318
NoneNo IPR availableCDDcd02961PDI_a_familycoord: 24..116
e-value: 1.74645E-5
score: 41.4422
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..21
score: 0.57
NoneNo IPR availableTMHMMTMhelixcoord: 7..24