Acetylcholine receptor subunit alpha-like

Overview
NameAcetylcholine receptor subunit alpha-like
Smed IDSMED30034555
Length (bp)1944
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acetylcholine receptor subunit alpha-like (SMED30034555) t-SNE clustered cells

Violin plots show distribution of expression levels for Acetylcholine receptor subunit alpha-like (SMED30034555) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Acetylcholine receptor subunit alpha-like (SMED30034555) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Acetylcholine receptor subunit alpha-like (SMED30034555) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034555

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30034555SMESG000023242.1 dd_Smed_v4_13494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034555SMESG000023242.1 dd_Smed_v4_13494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30034555SMESG000023242.1 dd_Smed_v4_13494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30034555SMESG000023242.1 dd_Smed_v6_13494_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30034555SMESG000023242.1 dd_Smed_v4_13494_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034555SMESG000023242.1 dd_Smed_v4_13494_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30034555SMESG000023242.1 dd_Smed_v4_13494_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: CHRNB3 (cholinergic receptor nicotinic beta 3 subunit [Source:HGNC Symbol;Acc:HGNC:1963])

HSP 1 Score: 225.713 bits (574), Expect = 3.360e-66
Identity = 115/317 (36.28%), Postives = 177/317 (55.84%), Query Frame = 1
Query:  394 KFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLT 1344
            K+ RPV     +I VY G+   Q+++VDEK +++T +V L+Q W +  L WNP++YG I SI +P   +WLPDIVLF NADG++E     K  +   G + W  PA ++S+C +DV +FP+D Q C + FGSWTY+   V L  I +                     N  +           ++  +GEW+++    +     D    Y +I +   +RR  +FY + LI P +GLS +  L FYLP   GEK+ LST +L ++ VF +++ E +P SS V P+I +YL+   + ++LS++ TVFV+N H RS+ T
Sbjct:   42 KWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINE---------------------NVDR----------KDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSST 327          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: CHRNA3 (cholinergic receptor nicotinic alpha 3 subunit [Source:HGNC Symbol;Acc:HGNC:1957])

HSP 1 Score: 225.328 bits (573), Expect = 1.340e-65
Identity = 120/337 (35.61%), Postives = 188/337 (55.79%), Query Frame = 1
Query:  385 DESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDY-------IRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMRT 1374
            D ++  RPV      + ++  V+  Q++ VDE  +I+  ++ L+QIW +  L WNP +YG  + + +P  K+W PDIVL+NNA G ++     K  L YTG + W  PAIF+S+C+IDV YFP+D Q C + FGSW+Y+K ++ L       VL                        I     L +Y +SGEW +++ P         DI+Y+        I + + IRR  +FY INLI P + +S +  L FYLP   GEK+ L   +L ++ VF +++ E++P +SLV P+I +YL+ T + ++LS++ TVFVLN H+R+  T    P +++T
Sbjct:   45 DYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDL-------VL------------------------IGSSMNLKDYWESGEWAIIKAPGY-----KHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTM-PSWVKT 344          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: CHRNA5 (cholinergic receptor nicotinic alpha 5 subunit [Source:HGNC Symbol;Acc:HGNC:1959])

HSP 1 Score: 224.557 bits (571), Expect = 1.560e-65
Identity = 115/329 (34.95%), Postives = 181/329 (55.02%), Query Frame = 1
Query:  385 DESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMR 1371
            D  ++ RPV+     I +  G+   Q+++VDEK +++T +V L+Q W +  L WNP++YG IK I +P + +W PDIVLF+NADG++E     K  + Y G + W  PA ++S+C IDV +FP+D Q C + FGSWTY+  QV        +++L  ++                           ++  +GEW+++          D    Y Y+ +   I+R  +FY + LI P +GLS +  L FYLP   GEKI L T +L ++ VF +++ E +P SS V P+I +YL+ T + ++LS+M TVF +N H RS+ T       +R
Sbjct:   57 DYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEGT-STKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQV--------DIILEDQDVDK-----------------------RDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGEKICLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPLVR 353          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: CHRNA6 (cholinergic receptor nicotinic alpha 6 subunit [Source:HGNC Symbol;Acc:HGNC:15963])

HSP 1 Score: 224.942 bits (572), Expect = 2.168e-65
Identity = 120/365 (32.88%), Postives = 199/365 (54.52%), Query Frame = 1
Query:  301 FTILSIFLNLSFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDY-------IRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMRT 1374
              + + F     G    +RL+  +   +  ++F RPV+     + V+  V   Q+ NVDE  +I+  ++ LR IW +  L W+P  Y  I+++ +P +K+W PDIVL+NNA G ++ +   K  L Y G+I W  PAIF+S+C +D+ +FP+D Q C L FGSWTY+K ++ L  I                         SK+        + ++ ++ EW++++     +     DI+Y+        I +   IRR  MFY INLI P + +S +  L FYLP   GEK+ L   +L ++ VF +++ E++P +SLV P++ +YL+ T + ++LS++ TVFVLN H+R+  T    PR+++T
Sbjct:   18 LCVFTPFFKGCVGCATEERLFHKL--FSHYNQFIRPVENVSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIG------------------------SKVD-------MNDFWENSEWEIID-----ASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVVPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTM-PRWVKT 343          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: CHRNA3 (cholinergic receptor nicotinic alpha 3 subunit [Source:HGNC Symbol;Acc:HGNC:1957])

HSP 1 Score: 224.172 bits (570), Expect = 4.160e-65
Identity = 120/337 (35.61%), Postives = 188/337 (55.79%), Query Frame = 1
Query:  385 DESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDY-------IRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMRT 1374
            D ++  RPV      + ++  V+  Q++ VDE  +I+  ++ L+QIW +  L WNP +YG  + + +P  K+W PDIVL+NNA G ++     K  L YTG + W  PAIF+S+C+IDV YFP+D Q C + FGSW+Y+K ++ L       VL                        I     L +Y +SGEW +++ P         DI+Y+        I + + IRR  +FY INLI P + +S +  L FYLP   GEK+ L   +L ++ VF +++ E++P +SLV P+I +YL+ T + ++LS++ TVFVLN H+R+  T    P +++T
Sbjct:   45 DYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDL-------VL------------------------IGSSMNLKDYWESGEWAIIKAPGY-----KHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTM-PSWVKT 344          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: unc-38 (Acetylcholine receptor subunit alpha-type unc-38 [Source:UniProtKB/Swiss-Prot;Acc:Q23022])

HSP 1 Score: 263.077 bits (671), Expect = 5.568e-80
Identity = 139/355 (39.15%), Postives = 213/355 (60.00%), Query Frame = 1
Query:  319 FLNLSFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVN----YSKLQRISDGAFLTNYHKSGEWDLMET---------PAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLT 1344
            F+ L+ G E+AKRLY D+ +  +  +  RP       + + L +   QI++V E  +I+T SV L+Q W ++ LSW+P NYG +  +Y+P+  +W+PDIVL+NNAD  Y      K TL+YTG + W+ PAIF+S C+IDVR+FP+DEQ C+L FGSWT++            E LLS +  +P S  +++ ++       +    DG  L++Y+ S EWD+M           P+    +   D+ Y      +++RRK +FY +NL+FP VG+S +  L FYLP  SGEK+ L   IL A+ +FF+LL E +P +S+  P+I +YL+ T ++++LSV+ TV  LN HFR+  T
Sbjct:   17 FIKLTEGNEDAKRLYDDLMVNYNRHR--RPSTSPNKPLTIKLKLRLSQIIDVHEIDQIMTCSVWLKQTWIDRKLSWDPVNYGGVNVLYVPYEMIWVPDIVLYNNADSNYNITISTKATLHYTGEVTWEPPAIFKSMCQIDVRWFPFDEQQCHLKFGSWTFS------------ENLLSVELNEP-SLRYEEEIDEKGIIDNVTVAEDGIDLSDYYPSVEWDIMSRVAKRRAKNYPSCCPQSAYIDVTY-----YLQLRRKPLFYTVNLVFPCVGISFLTILVFYLPSDSGEKVTLCISILVALTIFFLLLTEIIPATSITLPLIGKYLLFTMVMVTLSVVVTVISLNLHFRTPTT 351          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: unc-63 (Acetylcholine receptor subunit alpha-type unc-63 [Source:UniProtKB/Swiss-Prot;Acc:Q9N587])

HSP 1 Score: 244.588 bits (623), Expect = 4.218e-73
Identity = 145/368 (39.40%), Postives = 218/368 (59.24%), Query Frame = 1
Query:  301 FTILSIFLNLS---FGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHI-KQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPA-------ILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMR 1371
            F  + IFL LS       +A RL+ D+  IAD +K  RPV E+  ++ V   +   Q+++V EK +I+T +V L+  W +  L W+P  YG ++ +Y+P + +WLPD+VL+NNADG Y+     K  L Y G ++W  PAI++S C+IDV +FP+D Q C + FGSWTY   +V L+H  K LE  + +++ +      K+ V       +  G  L++Y+ S EWD++  P            +   DI Y+     + +RRK +FY +NLIFP VG+S + AL FYLP   GEKI L   IL ++ VFF+LL E +P +SLV P+I +YL+ T +L++LSV+ TV  LN H+RS  T    P++M+
Sbjct:    8 FAYILIFLLLSPPTHANRDANRLFEDL--IADYNKLVRPVSENGETLVVTFKLKLSQLLDVHEKNQIMTTNVWLQHSWMDYKLRWDPVEYGGVEVLYVPSDTIWLPDVVLYNNADGNYQVTIMTKAKLTYNGTVEWAPPAIYKSMCQIDVEFFPFDRQQCEMKFGSWTYGGLEVDLQHRDKHLEKEI-EEDVEGVDGPTKEIV-----WVVDRGIDLSDYYPSVEWDILNVPGKRHSKRYPCCESPFIDITYE-----IHLRRKTLFYTVNLIFPSVGISFLTALVFYLPSDGGEKISLCISILISLTVFFLLLVEIIPSTSLVIPLIGKYLLFTMVLVTLSVVVTVVTLNVHYRSPTTHTM-PKWMK 361          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: acr-8 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:Q23355])

HSP 1 Score: 228.409 bits (581), Expect = 9.097e-67
Identity = 120/317 (37.85%), Postives = 187/317 (58.99%), Query Frame = 1
Query:  403 RPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPA-----ILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSN 1338
            RP+K    S+ V  G + I+I++VDE  ++LT ++ L   W +  L W+P  +G I+ +++P +++W+PDI+L+NNADG+      +   +YY GL+ WK P+I++S C ID+ YFPYD Q C++ FG WTYN     L  ++QL V            EW   V   KLQ  +  + ++ + +S EWDLME  +     I +G    D   D I F ++IRRK +FY INL+ P    +I+ ++ FY+P     K+  S  IL  + VF+++L + VPP+SLV P+I +YL+ T  L+S+S+M +V  LNF+ R  
Sbjct:   41 RPIKNASESVKVKFGSSLIRIIDVDEVNQVLTTNLWLEMQWFDYRLMWDPGRWGKIRKLHVPVDQIWIPDILLYNNADGEPHITIMSDAIVYYNGLVVWKPPSIYKSFCSIDIEYFPYDTQTCWMKFGGWTYNG---FLLDVRQLPV-----------EEWTLVVTTRKLQVCAHASSISFFFRSLEWDLMELNSARHEKIYAGCCGQDFYID-ITFKIEIRRKTLFYTINLMIPCTMFAILTSIVFYVP-PIEHKMTFSISILVTLTVFYLILIDLVPPTSLVIPLIGKYLLFTMFLVSISIMLSVISLNFYRRDG 341          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: acr-8 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:Q23355])

HSP 1 Score: 228.409 bits (581), Expect = 9.097e-67
Identity = 120/317 (37.85%), Postives = 187/317 (58.99%), Query Frame = 1
Query:  403 RPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPA-----ILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSN 1338
            RP+K    S+ V  G + I+I++VDE  ++LT ++ L   W +  L W+P  +G I+ +++P +++W+PDI+L+NNADG+      +   +YY GL+ WK P+I++S C ID+ YFPYD Q C++ FG WTYN     L  ++QL V            EW   V   KLQ  +  + ++ + +S EWDLME  +     I +G    D   D I F ++IRRK +FY INL+ P    +I+ ++ FY+P     K+  S  IL  + VF+++L + VPP+SLV P+I +YL+ T  L+S+S+M +V  LNF+ R  
Sbjct:   41 RPIKNASESVKVKFGSSLIRIIDVDEVNQVLTTNLWLEMQWFDYRLMWDPGRWGKIRKLHVPVDQIWIPDILLYNNADGEPHITIMSDAIVYYNGLVVWKPPSIYKSFCSIDIEYFPYDTQTCWMKFGGWTYNG---FLLDVRQLPV-----------EEWTLVVTTRKLQVCAHASSISFFFRSLEWDLMELNSARHEKIYAGCCGQDFYID-ITFKIEIRRKTLFYTINLMIPCTMFAILTSIVFYVP-PIEHKMTFSISILVTLTVFYLILIDLVPPTSLVIPLIGKYLLFTMFLVSISIMLSVISLNFYRRDG 341          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: acr-2 (Acetylcholine receptor subunit beta-type acr-2 [Source:UniProtKB/Swiss-Prot;Acc:P48182])

HSP 1 Score: 226.098 bits (575), Expect = 1.530e-65
Identity = 128/324 (39.51%), Postives = 197/324 (60.80%), Query Frame = 1
Query:  403 RPVKEDQSS-IFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMR 1371
            RPVK   S  + V  GV  I ++NVDEK +IL  +V L   W +  L+WNP  YGNI ++++P +++WLPDIVLFNNADG YE  F +   + + G + W  PA+F+S+C IDV +FP+DEQ C L FGSWTYN E+V+L                     W     Y+ +Q +     L +Y  SG WD+++ P  L      D++ + + F V IRRK +FY + LI P V ++ ++ ++FYLPV SGEK+ L+  +L A+ VF +L+ + +PP+S + P++ +YL++ F+L   +V+ TV ++N +FRS L+ +  P ++R
Sbjct:   76 RPVKNVSSPPVVVDFGVAMILLINVDEKNQILQTNVWLTMKWNDFQLAWNPAEYGNISNLHVPSDRVWLPDIVLFNNADGNYEVSFKSNVFVDHHGDVTWVPPAMFKSSCRIDVEWFPFDEQCCTLVFGSWTYNSEEVRLH--------------------W-----YNNIQAVQ----LHDYSYSGIWDVIDVPGQLVHKP--DLKENKMVFNVVIRRKTLFYTVILIIPTVLMAFLSVMAFYLPVDSGEKVSLTISLLLALVVFLLLVSKILPPTSNI-PLMGKYLLLAFVLNITAVVGTVVIVNIYFRSALSHKM-PTWVR 366          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha1 (gene:FBgn0000036 transcript:FBtr0334916)

HSP 1 Score: 284.263 bits (726), Expect = 2.078e-87
Identity = 149/369 (40.38%), Postives = 222/369 (60.16%), Query Frame = 1
Query:  286 IKKVLFTILSIFLNLSF---GIEN--AKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGA--DDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMR 1371
            +  VLF   ++F+ L F   G+ N  AKRLY D+  +++ ++  RPV  +   + V +G+   Q+++V+ K +I+T +V + Q W +  L WNP++YG + ++++P   +WLPDIVL+NNADG YE     K  L++TG + WK PAI++S CEIDV YFP+DEQ C++ FGSWTY+   V LRH+KQ                       +    I  G  L +Y+ S EWD+M  PA+ +       +  Y  I F + +RRK +FY +NLI P VG+S ++ L FYLP  SGEKI L   IL ++ VFF+LL E +PP+SL  P++ +YL+ T +L++LSV+ T+ VLN +FRS +T    P   R
Sbjct:    1 MGSVLFA--AVFIALHFATGGLANPDAKRLYDDL--LSNYNRLIRPVGNNSDRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLPDIVLYNNADGNYEVTIMTKAILHHTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVDLRHLKQT----------------------ADSDNIEVGIDLQDYYISVEWDIMRVPAVRNEKFYSCCEEPYLDIVFNLTLRRKTLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNFRSPVTHRMAPWVQR 343          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha1 (gene:FBgn0000036 transcript:FBtr0084619)

HSP 1 Score: 284.263 bits (726), Expect = 2.078e-87
Identity = 149/369 (40.38%), Postives = 222/369 (60.16%), Query Frame = 1
Query:  286 IKKVLFTILSIFLNLSF---GIEN--AKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGA--DDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMR 1371
            +  VLF   ++F+ L F   G+ N  AKRLY D+  +++ ++  RPV  +   + V +G+   Q+++V+ K +I+T +V + Q W +  L WNP++YG + ++++P   +WLPDIVL+NNADG YE     K  L++TG + WK PAI++S CEIDV YFP+DEQ C++ FGSWTY+   V LRH+KQ                       +    I  G  L +Y+ S EWD+M  PA+ +       +  Y  I F + +RRK +FY +NLI P VG+S ++ L FYLP  SGEKI L   IL ++ VFF+LL E +PP+SL  P++ +YL+ T +L++LSV+ T+ VLN +FRS +T    P   R
Sbjct:    1 MGSVLFA--AVFIALHFATGGLANPDAKRLYDDL--LSNYNRLIRPVGNNSDRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLPDIVLYNNADGNYEVTIMTKAILHHTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVDLRHLKQT----------------------ADSDNIEVGIDLQDYYISVEWDIMRVPAVRNEKFYSCCEEPYLDIVFNLTLRRKTLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNFRSPVTHRMAPWVQR 343          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRbeta2 (gene:FBgn0004118 transcript:FBtr0084681)

HSP 1 Score: 281.952 bits (720), Expect = 4.326e-87
Identity = 141/340 (41.47%), Postives = 211/340 (62.06%), Query Frame = 1
Query:  346 NAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGA--DDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTP 1359
            + KRLY D+  +++ ++  RPV  +  ++ V+LG+   Q++ V+ K +++T ++ ++Q W +  L W+PE YG ++ +Y+P   +W+PDIVL+NN DG YE     K TL YTG + W+ PAI++S+CE++V YFPYDEQIC++ FGSWTYN  QV L+H+ Q+          PGS              +  G  LT ++ S EWD++E PA  +     D    +  I F + +RRK +FY +NLI P V L+ +  L FYLP  SGEK+ L   IL ++ VFF+LL E +PP+SL  P++ +YL+ T +L+SLSV +TV VLN HFRS  T   +P
Sbjct:   29 DTKRLYDDL--LSNYNRLIRPVVNNTETLTVWLGLKLSQLIEVNLKNQVMTTNLWVKQRWFDYKLRWDPEEYGGVEQLYVPSEHIWVPDIVLYNNWDGNYEVTLMTKATLKYTGEVFWEPPAIYKSSCEMNVEYFPYDEQICFMKFGSWTYNGAQVDLKHLDQI----------PGS------------NLVQVGIDLTEFYLSVEWDILEVPATKNEEYYPDTLEPFSDITFKLTMRRKTLFYTVNLIVPCVALTFLTVLVFYLPSDSGEKVTLCISILVSLTVFFLLLAEIIPPTSLAVPLLGKYLLFTMILVSLSVWTTVCVLNIHFRSPSTHNMSP 344          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha1 (gene:FBgn0000036 transcript:FBtr0330310)

HSP 1 Score: 284.263 bits (726), Expect = 4.665e-87
Identity = 149/369 (40.38%), Postives = 222/369 (60.16%), Query Frame = 1
Query:  286 IKKVLFTILSIFLNLSF---GIEN--AKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGA--DDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMR 1371
            +  VLF   ++F+ L F   G+ N  AKRLY D+  +++ ++  RPV  +   + V +G+   Q+++V+ K +I+T +V + Q W +  L WNP++YG + ++++P   +WLPDIVL+NNADG YE     K  L++TG + WK PAI++S CEIDV YFP+DEQ C++ FGSWTY+   V LRH+KQ                       +    I  G  L +Y+ S EWD+M  PA+ +       +  Y  I F + +RRK +FY +NLI P VG+S ++ L FYLP  SGEKI L   IL ++ VFF+LL E +PP+SL  P++ +YL+ T +L++LSV+ T+ VLN +FRS +T    P   R
Sbjct:    1 MGSVLFA--AVFIALHFATGGLANPDAKRLYDDL--LSNYNRLIRPVGNNSDRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLPDIVLYNNADGNYEVTIMTKAILHHTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVDLRHLKQT----------------------ADSDNIEVGIDLQDYYISVEWDIMRVPAVRNEKFYSCCEEPYLDIVFNLTLRRKTLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNFRSPVTHRMAPWVQR 343          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha4 (gene:FBgn0266347 transcript:FBtr0332872)

HSP 1 Score: 274.248 bits (700), Expect = 2.705e-84
Identity = 139/348 (39.94%), Postives = 211/348 (60.63%), Query Frame = 1
Query:  337 GIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGA--DDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMRT 1374
            G  +AKRLY D+  +++ +K  RPV      + V + +   Q+++V+ K +I+T ++ + Q W +  L W P+ YG +  +++P + +W PDIVL+NNADG +E     K T+Y  GL++WK PAI++S+CEIDV YFP+DEQ C L FGSWTY+  +V LRH+ +          Q GS              ++ G  L+ ++ S EWD++E PA+ +       D  Y  I F + +RRK +FY +N+I P +G+S +  L+FYLP  SGEK+ LS  IL ++ VFF+L+ E +PP+SLV P++ +YLI   +L+S+S+  TV VLN HFRS  T +  P   R 
Sbjct:    8 GNPDAKRLYDDL--LSNYNKLVRPVVNTTDVLKVCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNNADGNFEVTLATKATIYSEGLVEWKPPAIYKSSCEIDVEYFPFDEQTCVLKFGSWTYDGFKVDLRHMDE----------QQGS------------NVVAVGVDLSEFYMSVEWDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVEIIPPTSLVVPLLGKYLIFAMILVSISICVTVVVLNVHFRSPQTHKMAPWVKRV 331          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 223.402 bits (568), Expect = 1.901e-65
Identity = 116/324 (35.80%), Postives = 181/324 (55.86%), Query Frame = 1
Query:  403 RPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMRT 1374
            RP+     ++ V  G+   Q+++VDEK +++T +V L + W +  L WNPENYG I  I +P   +WLPDIVL+ NADG++E     K  + Y GLI W  PA ++S C +DV +FP+D Q C + FGSWTY+   V+L       VL++ +                 + R       +++  +GEW+++          D    Y YI +   ++R  +FY + LI P +GLS +  L FYLP   GEK+ LST +L ++ VF +++ E +P SS V P+I +YL+   + ++LS++ TVFV+N H RS+ T      ++RT
Sbjct:   47 RPILHANHTVKVRFGLKISQLVDVDEKNQLMTTNVWLYEEWLDYKLRWNPENYGGITFIRVPSESIWLPDIVLYENADGRFEGSIMTKAIVRYNGLITWTPPASYKSACTMDVTFFPFDRQNCSMKFGSWTYDGNMVEL-------VLVNHQ-----------------VDR-------SDFFDNGEWEILSATGHKGSRRDGHYSYPYITYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKVSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSATYHPMSPWVRT 339          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: chrnb2 (cholinergic receptor, nicotinic, beta 2 [Source:ZFIN;Acc:ZDB-GENE-070821-3])

HSP 1 Score: 223.787 bits (569), Expect = 1.025e-64
Identity = 131/358 (36.59%), Postives = 202/358 (56.42%), Query Frame = 1
Query:  298 LFTILSIFLNLSFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAIL----SGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTP 1359
            LF IL+I +   +G +  +RL   +   A  +K  RP       + V L V+  Q+++V E+++I+T +V L Q W++  L+W+PE +  +K + LP   +WLPD+VL+NNADG YE  F +   + Y G + W  PAI++S C+I+V++FP+D+Q C L+F SWTY++ +V L       VL +                        D A + ++  SGEWD++  P       S     DI YD+I     IRRK +FY INLI P V ++ +A L FYLP   GEK+ L   +L A+ VF +L+ + VPP+SL  P++ +YL+ T +L++ S++++V VLN H RS  T    P
Sbjct:    7 LFCILAI-VKSGYGADTEERLVEHLLNPAHYNKLIRPATNGSEVVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWQDYRLTWSPEEFDGMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSVFWLPPAIYKSACKIEVKHFPFDQQNCTLSFRSWTYDRTEVDL-------VLRA------------------------DVASMDDFTPSGEWDIIALPGRRNENPSDPTYVDITYDFI-----IRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMPP 327          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 223.402 bits (568), Expect = 1.183e-64
Identity = 124/355 (34.93%), Postives = 199/355 (56.06%), Query Frame = 1
Query:  301 FTILSIFLNLSFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDY-------IRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLT 1344
            F+ L   L+     E   RL++   I +  +++ RPV+     + V   V+  Q++ VDE  +I+  ++ LR IW +  L W+P+++G ++ I +P NK+W PDIVL+NNA G ++     K  L + G + W  PAIF+S+C+IDV YFP+D Q C + FGSWTY+K ++ L  I              GS     T+N            L ++ +SGEW +++ P         DI+Y+        I + + IRR  +FY IN+I P + +S +  L FYLP   GEK+ L   +L ++ VF +++ E++P +SLV P+I +YL+ T + ++LS++ TVFVLN H+R+  T
Sbjct:   48 FSPLCFLLSGVCCSEAEHRLFS--VIFSSYNQYIRPVENVSDPVVVQFEVSMSQLVKVDEVNQIMETNLWLRHIWNDYKLRWDPKDFGGVEFIRVPSNKIWKPDIVLYNNAVGDFQVDDKTKALLRFNGDVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLI--------------GS-----TIN------------LKDFWESGEWTIIDAPGY-----KHDIKYNCCEEIYTDITYSLYIRRLPLFYTINMIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKT 364          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: chrna7 (cholinergic receptor, nicotinic, alpha 7 (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-3])

HSP 1 Score: 221.861 bits (564), Expect = 2.725e-64
Identity = 120/346 (34.68%), Postives = 186/346 (53.76%), Query Frame = 1
Query:  301 FTILSIFLNLSFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGA--DDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFR 1332
            FT       +S   E+ +RLY D+  + D +   RPV  D  S+ VY  ++ +QIM+VDEK ++LT ++ L+  W + YL WN   Y  + ++  P +++W PDI+L+N+AD +++  F     +  +G   +  P IF+STC IDVR+FP+D Q C L FGSWTY    + L+ I                                  A +T Y  +GEWDL+E P   +    D     Y  + F V +RR+ ++Y +NL+ P V +S +A L F LP  SGEKI L   +L ++ VF +L+ E +P +S   P+I QY   T +++ LSV++TV+VL +H+ 
Sbjct:   10 FTTTCCLWRVSLQGEHQRRLYRDL--MKDYNPLERPVFNDTHSLTVYFSMSLMQIMDVDEKNQVLTTNIWLQLYWYDYYLQWNASEYPGVTNVRFPDSQIWKPDILLYNSADERFDATFHTNVLVNSSGACQYLPPGIFKSTCYIDVRWFPFDLQRCDLKFGSWTYGGWSLDLQMID---------------------------------ADITGYIANGEWDLVEVPGRRNERFYDCCKEPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYH 320          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: chrna6 (cholinergic receptor, nicotinic, alpha 6 [Source:ZFIN;Acc:ZDB-GENE-090312-91])

HSP 1 Score: 221.09 bits (562), Expect = 3.062e-64
Identity = 121/335 (36.12%), Postives = 189/335 (56.42%), Query Frame = 1
Query:  391 SKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDY-------IRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMRT 1374
            ++F RPV+     + V   V+  Q++ VDE  +I+  ++ LR IW +  L W+P  +  I+ I +P NK+W PDIVL+NNA G +  +   K  L + G I W  PAIF+S+C +D+ YFP+D Q C + FGSWTY+K ++ L       VL+  K            VN            L ++ +SGEW++++ P         DI+Y+        I +   IRR  +FY INLI P + +S +  L FYLP   GEK+ L   +L ++ VF +++ E++P +SLV P+I +YL+ T + ++LS++ TVFVLN H+R+ +T    P ++RT
Sbjct:   25 NQFIRPVENVSDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLKWSPAEFDGIEFIRVPSNKIWRPDIVLYNNAVGDFLVEDKTKALLKFDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAKIDL-------VLIGSK------------VN------------LKDFWESGEWEIIDAPGY-----KHDIKYNCCEEIYPDITYSFYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPMTHTM-PSWVRT 322          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:Xenbase;Acc:XB-GENE-5738397])

HSP 1 Score: 222.631 bits (566), Expect = 4.981e-65
Identity = 117/345 (33.91%), Postives = 192/345 (55.65%), Query Frame = 1
Query:  331 SFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDY-------IRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLT 1344
            S   E  ++L+    ++A  ++  RPV+     + V+  V   Q++NVDE  +IL  ++ LR IW +  L WNP+ Y  I+ + +P +K+W PDIVL+NNA G ++ +  +K  + Y GLI W  PAIF+S+C +D+ +FP+D Q C + FGSW+Y+K ++ L  I                         SK+        + ++ ++ EW++++           DI+Y+        I +   IRR  MFY INLI P + LS +  L FYLP   GEK+ L   +L ++ VF +++ E++P +SLV P++ +YL+ T + ++LS++ TVFVLN H+R+  T
Sbjct:   16 SLQCETEEKLFQ--KLLARYNQHIRPVENVSDPVMVHFEVAITQLVNVDEVNQILETNLWLRHIWNDYKLQWNPKEYDGIEFMRIPADKIWKPDIVLYNNAVGDFQVEGKSKALVKYNGLITWSPPAIFKSSCPMDITFFPFDHQNCSMKFGSWSYDKAKIDLAIIG------------------------SKVD-------MKDFWENSEWEIVDASGF-----KHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIMPCLFLSFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTT 322          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:Xenbase;Acc:XB-GENE-5738397])

HSP 1 Score: 222.246 bits (565), Expect = 6.284e-65
Identity = 117/345 (33.91%), Postives = 192/345 (55.65%), Query Frame = 1
Query:  331 SFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDY-------IRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLT 1344
            S   E  ++L+    ++A  ++  RPV+     + V+  V   Q++NVDE  +IL  ++ LR IW +  L WNP+ Y  I+ + +P +K+W PDIVL+NNA G ++ +  +K  + Y GLI W  PAIF+S+C +D+ +FP+D Q C + FGSW+Y+K ++ L  I                         SK+        + ++ ++ EW++++           DI+Y+        I +   IRR  MFY INLI P + LS +  L FYLP   GEK+ L   +L ++ VF +++ E++P +SLV P++ +YL+ T + ++LS++ TVFVLN H+R+  T
Sbjct:   15 SLQCETEEKLFQ--KLLARYNQHIRPVENVSDPVMVHFEVAITQLVNVDEVNQILETNLWLRHIWNDYKLQWNPKEYDGIEFMRIPADKIWKPDIVLYNNAVGDFQVEGKSKALVKYNGLITWSPPAIFKSSCPMDITFFPFDHQNCSMKFGSWSYDKAKIDLAIIG------------------------SKVD-------MKDFWENSEWEIVDASGF-----KHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIMPCLFLSFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTT 321          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:Xenbase;Acc:XB-GENE-5738397])

HSP 1 Score: 222.246 bits (565), Expect = 6.345e-65
Identity = 117/345 (33.91%), Postives = 192/345 (55.65%), Query Frame = 1
Query:  331 SFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDY-------IRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLT 1344
            S   E  ++L+  +  +A  ++  RPV+     + V+  V   Q++NVDE  +IL  ++ LR IW +  L WNP+ Y  I+ + +P +K+W PDIVL+NNA G ++ +  +K  + Y GLI W  PAIF+S+C +D+ +FP+D Q C + FGSW+Y+K ++ L  I                         SK+        + ++ ++ EW++++           DI+Y+        I +   IRR  MFY INLI P + LS +  L FYLP   GEK+ L   +L ++ VF +++ E++P +SLV P++ +YL+ T + ++LS++ TVFVLN H+R+  T
Sbjct:   10 SLQCETEEKLFQKL--LARYNQHIRPVENVSDPVMVHFEVAITQLVNVDEVNQILETNLWLRHIWNDYKLQWNPKEYDGIEFMRIPADKIWKPDIVLYNNAVGDFQVEGKSKALVKYNGLITWSPPAIFKSSCPMDITFFPFDHQNCSMKFGSWSYDKAKIDLAIIG------------------------SKVD-------MKDFWENSEWEIVDASGF-----KHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIMPCLFLSFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTT 316          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:Xenbase;Acc:XB-GENE-5738397])

HSP 1 Score: 222.246 bits (565), Expect = 6.390e-65
Identity = 117/345 (33.91%), Postives = 192/345 (55.65%), Query Frame = 1
Query:  331 SFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDY-------IRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLT 1344
            S   E  ++L+    ++A  ++  RPV+     + V+  V   Q++NVDE  +IL  ++ LR IW +  L WNP+ Y  I+ + +P +K+W PDIVL+NNA G ++ +  +K  + Y GLI W  PAIF+S+C +D+ +FP+D Q C + FGSW+Y+K ++ L  I                         SK+        + ++ ++ EW++++           DI+Y+        I +   IRR  MFY INLI P + LS +  L FYLP   GEK+ L   +L ++ VF +++ E++P +SLV P++ +YL+ T + ++LS++ TVFVLN H+R+  T
Sbjct:   21 SLQCETEEKLFQ--KLLARYNQHIRPVENVSDPVMVHFEVAITQLVNVDEVNQILETNLWLRHIWNDYKLQWNPKEYDGIEFMRIPADKIWKPDIVLYNNAVGDFQVEGKSKALVKYNGLITWSPPAIFKSSCPMDITFFPFDHQNCSMKFGSWSYDKAKIDLAIIG------------------------SKVD-------MKDFWENSEWEIVDASGF-----KHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIMPCLFLSFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTT 327          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:Xenbase;Acc:XB-GENE-5738397])

HSP 1 Score: 221.861 bits (564), Expect = 1.058e-64
Identity = 117/345 (33.91%), Postives = 192/345 (55.65%), Query Frame = 1
Query:  331 SFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDY-------IRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLT 1344
            S   E  ++L+    ++A  ++  RPV+     + V+  V   Q++NVDE  +IL  ++ LR IW +  L WNP+ Y  I+ + +P +K+W PDIVL+NNA G ++ +  +K  + Y GLI W  PAIF+S+C +D+ +FP+D Q C + FGSW+Y+K ++ L  I                         SK+        + ++ ++ EW++++           DI+Y+        I +   IRR  MFY INLI P + LS +  L FYLP   GEK+ L   +L ++ VF +++ E++P +SLV P++ +YL+ T + ++LS++ TVFVLN H+R+  T
Sbjct:   28 SLQCETEEKLFQ--KLLARYNQHIRPVENVSDPVMVHFEVAITQLVNVDEVNQILETNLWLRHIWNDYKLQWNPKEYDGIEFMRIPADKIWKPDIVLYNNAVGDFQVEGKSKALVKYNGLITWSPPAIFKSSCPMDITFFPFDHQNCSMKFGSWSYDKAKIDLAIIG------------------------SKVD-------MKDFWENSEWEIVDASGF-----KHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIMPCLFLSFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTT 334          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna5 (cholinergic receptor, nicotinic, alpha polypeptide 5 [Source:MGI Symbol;Acc:MGI:87889])

HSP 1 Score: 228.409 bits (581), Expect = 1.433e-67
Identity = 121/348 (34.77%), Postives = 191/348 (54.89%), Query Frame = 1
Query:  328 LSFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMR 1371
            LS   ++   L+ D+    D  K+ RPV+     I +  G+   Q+++VDEK +++T +V L+Q W +  L WNP++YG IK I +P + +W+PDIVLF+NADG++E     K  + Y G + W  PA ++S+C IDV +FP+D Q C + FGSWTY+  QV        +++L  ++                          T++  +GEW++M          D    Y  I +   I+R  +FY + LI P +GLS +  + FYLP   GEKI L T +L ++ VF +++ E +P SS V P+I +YL+ T + ++LS+M TVF +N H RS+ T      ++R
Sbjct:   11 LSSAAKHEDSLFRDL--FEDYEKWVRPVEHLSDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKIIRVPSDSLWIPDIVLFDNADGRFEGA-STKTVVRYNGTVTWTQPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQV--------DIILEDQDVDR-----------------------TDFFDNGEWEIMSAMGSKGNRTDSCCWYPCITYSFVIKRLPLFYTLFLIIPCIGLSFLTVVVFYLPSNEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPWVR 324          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna5 (cholinergic receptor, nicotinic, alpha polypeptide 5 [Source:MGI Symbol;Acc:MGI:87889])

HSP 1 Score: 228.024 bits (580), Expect = 4.947e-67
Identity = 121/348 (34.77%), Postives = 191/348 (54.89%), Query Frame = 1
Query:  328 LSFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMR 1371
            LS   ++   L+ D+    D  K+ RPV+     I +  G+   Q+++VDEK +++T +V L+Q W +  L WNP++YG IK I +P + +W+PDIVLF+NADG++E     K  + Y G + W  PA ++S+C IDV +FP+D Q C + FGSWTY+  QV        +++L  ++                          T++  +GEW++M          D    Y  I +   I+R  +FY + LI P +GLS +  + FYLP   GEKI L T +L ++ VF +++ E +P SS V P+I +YL+ T + ++LS+M TVF +N H RS+ T      ++R
Sbjct:   40 LSSAAKHEDSLFRDL--FEDYEKWVRPVEHLSDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKIIRVPSDSLWIPDIVLFDNADGRFEGA-STKTVVRYNGTVTWTQPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQV--------DIILEDQDVDR-----------------------TDFFDNGEWEIMSAMGSKGNRTDSCCWYPCITYSFVIKRLPLFYTLFLIIPCIGLSFLTVVVFYLPSNEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPWVR 353          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrnb3 (cholinergic receptor, nicotinic, beta polypeptide 3 [Source:MGI Symbol;Acc:MGI:106212])

HSP 1 Score: 227.639 bits (579), Expect = 5.024e-67
Identity = 113/314 (35.99%), Postives = 177/314 (56.37%), Query Frame = 1
Query:  403 RPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLT 1344
            RPV      I VY G+   Q+++VDEK +++T +V L+Q W ++ L WNPE+YG I SI +P   +WLPDIVLF NADG++E     K  +  +G + W  PA ++S+C +DV +FP+D+Q C + FGSWTY+   V L  I +                     N  +           ++  +GEW+++    +     +    Y ++ +   +RR  +FY + LI P +GLS +  L FYLP   GEK+ LST +L ++ VF +++ E +P SS V P+I +YL+   + ++LS++ TVFV+N H RS+ T
Sbjct:   51 RPVLNSSDIIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDQKLRWNPEDYGGINSIKVPSESLWLPDIVLFENADGRFEGSLMTKAIVKSSGTVSWTPPASYKSSCTMDVTFFPFDKQNCSMKFGSWTYDGTMVDLILINE---------------------NVDR----------KDFFDNGEWEILNAKGMKGNRREGFYSYPFVTYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSST 333          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrnb3 (cholinergic receptor, nicotinic, beta polypeptide 3 [Source:MGI Symbol;Acc:MGI:106212])

HSP 1 Score: 226.483 bits (576), Expect = 1.646e-66
Identity = 113/314 (35.99%), Postives = 177/314 (56.37%), Query Frame = 1
Query:  403 RPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLT 1344
            RPV      I VY G+   Q+++VDEK +++T +V L+Q W ++ L WNPE+YG I SI +P   +WLPDIVLF NADG++E     K  +  +G + W  PA ++S+C +DV +FP+D+Q C + FGSWTY+   V L  I +                     N  +           ++  +GEW+++    +     +    Y ++ +   +RR  +FY + LI P +GLS +  L FYLP   GEK+ LST +L ++ VF +++ E +P SS V P+I +YL+   + ++LS++ TVFV+N H RS+ T
Sbjct:   51 RPVLNSSDIIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDQKLRWNPEDYGGINSIKVPSESLWLPDIVLFENADGRFEGSLMTKAIVKSSGTVSWTPPASYKSSCTMDVTFFPFDKQNCSMKFGSWTYDGTMVDLILINE---------------------NVDR----------KDFFDNGEWEILNAKGMKGNRREGFYSYPFVTYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSST 333          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna6 (cholinergic receptor, nicotinic, alpha polypeptide 6 [Source:MGI Symbol;Acc:MGI:106213])

HSP 1 Score: 223.787 bits (569), Expect = 3.233e-65
Identity = 119/355 (33.52%), Postives = 199/355 (56.06%), Query Frame = 1
Query:  331 SFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDY-------IRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMRT 1374
            S G E+ ++L+  +   A  ++F RPV+     + V+  +   Q+ NVDE  +I+  ++ LR IWK+  L W+P  Y  I+++ +P + +W PDIVL+NNA G ++ +   K  L Y G+I W  PAIF+S+C +D+ +FP+D Q C L FGSWTY+K ++ L  I                         SK+        + ++ ++ EW++++     +     DI+Y+        I +   IRR  MFY INLI P + +S +  L FYLP   GEK+ L   +L ++ VF +++ E++P +SLV P++ +YL+ T + ++LS++ TVFVLN H+R+  T    P++++T
Sbjct:   28 STGCESEEQLFHRL--FAHYNRFIRPVENVSDPVTVHFELAITQLANVDEVNQIMETNLWLRHIWKDYRLRWDPTEYDGIETLRVPADNIWKPDIVLYNNAVGDFQVEGKTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIG------------------------SKVD-------MNDFWENSEWEIVD-----ASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPATHTM-PKWVKT 343          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|P09478|ACH1_DROME (Acetylcholine receptor subunit alpha-like 1 OS=Drosophila melanogaster OX=7227 GN=nAChRalpha1 PE=2 SV=2)

HSP 1 Score: 284.263 bits (726), Expect = 2.083e-86
Identity = 149/369 (40.38%), Postives = 222/369 (60.16%), Query Frame = 1
Query:  286 IKKVLFTILSIFLNLSF---GIEN--AKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGA--DDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMR 1371
            +  VLF   ++F+ L F   G+ N  AKRLY D+  +++ ++  RPV  +   + V +G+   Q+++V+ K +I+T +V + Q W +  L WNP++YG + ++++P   +WLPDIVL+NNADG YE     K  L++TG + WK PAI++S CEIDV YFP+DEQ C++ FGSWTY+   V LRH+KQ                       +    I  G  L +Y+ S EWD+M  PA+ +       +  Y  I F + +RRK +FY +NLI P VG+S ++ L FYLP  SGEKI L   IL ++ VFF+LL E +PP+SL  P++ +YL+ T +L++LSV+ T+ VLN +FRS +T    P   R
Sbjct:    1 MGSVLFA--AVFIALHFATGGLANPDAKRLYDDL--LSNYNRLIRPVGNNSDRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLPDIVLYNNADGNYEVTIMTKAILHHTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVDLRHLKQT----------------------ADSDNIEVGIDLQDYYISVEWDIMRVPAVRNEKFYSCCEEPYLDIVFNLTLRRKTLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNFRSPVTHRMAPWVQR 343          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|P25162|ACH4_DROME (Acetylcholine receptor subunit beta-like 2 OS=Drosophila melanogaster OX=7227 GN=nAChRbeta2 PE=2 SV=3)

HSP 1 Score: 281.952 bits (720), Expect = 4.337e-86
Identity = 141/340 (41.47%), Postives = 211/340 (62.06%), Query Frame = 1
Query:  346 NAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGA--DDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTP 1359
            + KRLY D+  +++ ++  RPV  +  ++ V+LG+   Q++ V+ K +++T ++ ++Q W +  L W+PE YG ++ +Y+P   +W+PDIVL+NN DG YE     K TL YTG + W+ PAI++S+CE++V YFPYDEQIC++ FGSWTYN  QV L+H+ Q+          PGS              +  G  LT ++ S EWD++E PA  +     D    +  I F + +RRK +FY +NLI P V L+ +  L FYLP  SGEK+ L   IL ++ VFF+LL E +PP+SL  P++ +YL+ T +L+SLSV +TV VLN HFRS  T   +P
Sbjct:   29 DTKRLYDDL--LSNYNRLIRPVVNNTETLTVWLGLKLSQLIEVNLKNQVMTTNLWVKQRWFDYKLRWDPEEYGGVEQLYVPSEHIWVPDIVLYNNWDGNYEVTLMTKATLKYTGEVFWEPPAIYKSSCEMNVEYFPYDEQICFMKFGSWTYNGAQVDLKHLDQI----------PGS------------NLVQVGIDLTEFYLSVEWDILEVPATKNEEYYPDTLEPFSDITFKLTMRRKTLFYTVNLIVPCVALTFLTVLVFYLPSDSGEKVTLCISILVSLTVFFLLLAEIIPPTSLAVPLLGKYLLFTMILVSLSVWTTVCVLNIHFRSPSTHNMSP 344          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|P17644|ACH2_DROME (Acetylcholine receptor subunit alpha-like 2 OS=Drosophila melanogaster OX=7227 GN=nAChRalpha2 PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 1.836e-81
Identity = 138/344 (40.12%), Postives = 206/344 (59.88%), Query Frame = 1
Query:  346 NAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPA------ILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTP 1359
            +AKRLY D+  +++ ++  RPV  +  ++ V LG+   Q+++++ K +ILT +V L   W++    W+P  YG +  +Y+P   +WLPDIVL+NNADG+Y      K  L+YTG + W  PAIF+S+CEIDVRYFP+D+Q C++ FGSWTY+ +Q+ L+HI       SQKN               K  ++  G  L  Y+ S EWD++  PA          A+     Y  I F + +RRK +FY +NLI P VG+S ++ L FYLP  SGEKI L   IL +  +FF+L+ E +P +SL  P++ +YL+ T LL+ LSV+ T+ +LN H+R   T +  P
Sbjct:   44 DAKRLYDDL--LSNYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHI-------SQKN--------------DKDNKVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAE----PYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRP 360          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|P91766|ACH1_MANSE (Acetylcholine receptor subunit alpha-like OS=Manduca sexta OX=7130 GN=ARA1 PE=2 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 2.388e-80
Identity = 141/367 (38.42%), Postives = 219/367 (59.67%), Query Frame = 1
Query:  277 MQTIKKVLFTILSIFLNLSFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGA--DDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMR 1371
            M+++ K     + +F     G  +AKRLY D+  +++ +K  RPV     ++ V + +   Q+++V+ K +I+T ++ + Q W +  LSW P  YG ++ +++P + +W PDIVL+NNADG +E     K TL YTG ++W+ PAI++S+CEIDV YFP+D+Q C + FGSWTY+  QV LRHI ++                 +  N  +L     G  L+ ++ S EWD++E PA+ +       D  Y  I F + +RRK +FY +NLI P +G+S +  L FYLP  SGEK+ LS  IL ++ VFF+LL E +PP+SLV P++ ++++ T +L + S+  TV VLN HFRS  T   +P   R
Sbjct:    1 MRSVTKYYLHGVVLFATGCAGNPDAKRLYDDL--LSNYNKLVRPVLNVSDALTVRIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLSWEPREYGGVEMLHVPSDHIWRPDIVLYNNADGNFEVTLATKATLNYTGRVEWRPPAIYKSSCEIDVEYFPFDQQTCVMKFGSWTYDGFQVDLRHIDEV-----------------RGTNVVEL-----GVDLSEFYTSVEWDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNLIIPCMGISFLTVLVFYLPSDSGEKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFTMILDTFSICVTVVVLNVHFRSPQTHTMSPWVRR 343          
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|P23414|ACH1_SCHGR (Acetylcholine receptor subunit alpha-L1 OS=Schistocerca gregaria OX=7010 PE=2 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 2.938e-79
Identity = 134/344 (38.95%), Postives = 203/344 (59.01%), Query Frame = 1
Query:  346 NAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPA------ILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTP 1359
            +AKRLY D+  +++ ++  RPV  +  ++ V LG+   Q+++++ K +ILT +V L   W++    W+P  YG +  +Y+P   +WLPDIVL+NNADG+Y      K  L++TG + W  PAIF+S+CEIDVRYFP+D+Q C++ FGSWTY+ +Q+ L+HI Q                      Y    ++  G  L  Y+ S EWD++  PA          A+     Y  I F + +RRK +FY +NLI P VG+S ++ L FYLP  SGEKI L   IL +  +FF+L+ E +P +SL  P++ +YL+ T +L+ LSV+ T+ VLN H+R   T +  P
Sbjct:   26 DAKRLYDDL--LSNYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFRWDPAEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAVLHHTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHINQ---------------------KYDD-NKVKVGIDLREYYPSVEWDILGVPAERHEKYYPCCAE----PYPDIFFNITLRRKTLFYTVNLIVPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMVLVGLSVVITIMVLNVHYRKPSTHKMAP 341          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: A0A088BCU7 (Nicotinic acetylcholine receptor alpha 4 subunit (Fragment) OS=Ixodes scapularis OX=6945 GN=nAChR-a4 PE=2 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 1.127e-87
Identity = 143/345 (41.45%), Postives = 211/345 (61.16%), Query Frame = 1
Query:  346 NAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGA--DDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMRT 1374
            +AKRL+ D+  ++D ++  RPV      + + +G+   Q+++++ K +++T ++ L Q W++  L WNPE YG +  I++P   +WLPDIVLFNNADG YE    NK T+Y TG + WK PA+++STCEIDV YFP+DEQ C + FGSWTY+  +V L+H+KQ          +PG A             +  G  ++ ++KS EWD++  PA  +    D  D  +  I F + +RRK +FY +NLI P VG+S +  L FYLP  SGEK+ L   IL ++ VFF+LL E +PP+SL  P++ +YL+ T +L++LS+  TV VLN HFRS  T    P   R 
Sbjct:    1 DAKRLHDDL--LSDYNRLIRPVGNHSHKVTIVVGLKLSQLIDINLKHQVMTTNIWLEQEWEDYKLRWNPEEYGGVDMIHVPAESLWLPDIVLFNNADGNYEVILMNKATVYSTGKVIWKPPALYKSTCEIDVEYFPFDEQNCLMKFGSWTYDGLEVDLQHVKQ----------RPGVA------------IVETGIDMSEFYKSVEWDILRVPAKYNNEFYDCCDEPFPDITFNITMRRKTLFYTVNLIIPCVGISFLTVLVFYLPSDSGEKVTLCISILVSLTVFFLLLAEIIPPTSLAVPLLGKYLLFTMILVTLSISVTVGVLNVHFRSPSTHRMAPWVRRV 321          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: A0A1S3J8X6 (acetylcholine receptor subunit alpha-like 1 OS=Lingula unguis OX=7574 GN=LOC106171191 PE=3 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 1.950e-87
Identity = 145/343 (42.27%), Postives = 214/343 (62.39%), Query Frame = 1
Query:  337 GIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGA--DDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTP 1359
            G  +AKRLY D+      +K  RPV ++ +++ V LG+   Q+++VDEK +I+T +V L   W++  L W+P++YGNI  +Y+P  ++W PD+VL+NNADG YE     K T+Y TG ++W+ PAI++S C I+V +FP+DEQ C + FGSWTY+  QV L+HI +L+    ++ F  G                  G  L +Y +S EWDL++ PA       +     + +I F V +RRK +FY +NLI P V +S +  L+FYLP  SGEKI L   IL ++ VFF+LL + +PP+SLV P+I +YL+ T +L+SLS++ TV VLN HFRS  T   +P
Sbjct:   31 GTVDAKRLYRDLLEKRGYNKLIRPVSDNNNNLTVKLGLRLTQLIDVDEKNQIMTTNVWLTHEWEDLSLRWDPKDYGNIDVLYVPAEQLWKPDVVLYNNADGNYEVTLLTKATVYPTGRVEWEPPAIYKSACPINVEFFPFDEQTCTMKFGSWTYDGLQVDLKHICELDG--HREEFSTGY-----------------GIDLKDYSRSVEWDLLDVPAKRKAKYYNSKPEPHPFITFNVTLRRKTLFYTVNLIIPCVAISFLTVLTFYLPSDSGEKITLCISILLSLTVFFLLLADLIPPTSLVVPLIGKYLLFTMILVSLSIIVTVVVLNVHFRSPSTHVMSP 354          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: A0A1I8GXF7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 3.037e-87
Identity = 144/347 (41.50%), Postives = 209/347 (60.23%), Query Frame = 1
Query:  346 NAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPA-----ILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMR 1371
            +AKRL+ D+   AD +K  RPV  +  ++ VYLG+   Q+++VDEK +I+T +V LR++W +  L+W+P+ Y  + ++Y+P   +WLPDIVL+NNADG YE     K  L  TG + W+ PAI++S+C+IDV +FP+D Q C + FGSWTY+  QV LRHI+Q                       S    +  G  L  +++S EWD++E PA     +     +    Y  I F + +RRK +FY +NLI P V +S +  + FYLP  SGEKI L   IL A+ VFF+LL E++PP+SLV P+I +YL+ T +L++LS++ TV VLN HFR   T    P   R
Sbjct:   26 DAKRLFDDLLSKADYNKLIRPVNNNSRTLTVYLGLKLSQLIDVDEKNQIMTTNVWLREVWYDSKLTWDPDAYHGVSTLYIPSEDIWLPDIVLYNNADGNYEVTLMTKAALQSTGKVLWEPPAIYKSSCQIDVEFFPFDSQNCTMKFGSWTYDGLQVDLRHIQQAN---------------------SSEPVVEFGIDLETFYESTEWDVLEVPAKRHEKVYPCCPE---PYPDITFAIILRRKTLFYTVNLIIPCVAISFLTVMVFYLPSDSGEKITLCISILLALTVFFLLLAETIPPTSLVVPLIGKYLLFTMILVTLSIIVTVIVLNVHFRGPATHRMAPWVRR 348          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: A0A1I8GTY3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 290.041 bits (741), Expect = 4.072e-87
Identity = 144/347 (41.50%), Postives = 209/347 (60.23%), Query Frame = 1
Query:  346 NAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPA-----ILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMR 1371
            +AKRL+ D+   AD +K  RPV  +  ++ VYLG+   Q+++VDEK +I+T +V LR++W +  L+W+P+ Y  + ++Y+P   +WLPDIVL+NNADG YE     K  L  TG + W+ PAI++S+C+IDV +FP+D Q C + FGSWTY+  QV LRHI+Q                       S    +  G  L  +++S EWD++E PA     +     +    Y  I F + +RRK +FY +NLI P V +S +  + FYLP  SGEKI L   IL A+ VFF+LL E++PP+SLV P+I +YL+ T +L++LS++ TV VLN HFR   T    P   R
Sbjct:   15 DAKRLFDDLLSKADYNKLIRPVNNNSRTLTVYLGLKLSQLIDVDEKNQIMTTNVWLREVWYDSKLTWDPDAYHGVSTLYIPSEDIWLPDIVLYNNADGNYEVTLMTKAALQSTGKVLWEPPAIYKSSCQIDVEFFPFDSQNCTMKFGSWTYDGLQVDLRHIQQAN---------------------SSEPVVEFGIDLETFYESTEWDVLEVPAKRHEKVYPCCPE---PYPDITFAIILRRKTLFYTVNLIIPCVAISFLTVMVFYLPSDSGEKITLCISILLALTVFFLLLAETIPPTSLVVPLIGKYLLFTMILVTLSIIVTVIVLNVHFRGPATHRMAPWVRR 337          
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: A0A1B0D961 (Uncharacterized protein OS=Phlebotomus papatasi OX=29031 PE=3 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 9.270e-87
Identity = 145/353 (41.08%), Postives = 220/353 (62.32%), Query Frame = 1
Query:  286 IKKVLFTILSIFLNLSFGIEN--AKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGA--DDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFR 1332
            +  VLFTI+ + L ++ G+ N  +KRLY D+  +++ ++  RPV  +   + V +G+   Q+++V+ K +I+T +V + Q W +  L WNP++YG + ++++P   +WLPDIVL+NNADG YE     K  L++TG + WK PAI++S CEIDV YFP+DEQ C++ FGSWTY+   V LRH++Q           P S              I  G  L +Y+ S EWD+M+ PA+ +       +  Y  I F + +RRK +FY +NLI P VG+S ++ L FYLP  SGEKI L   IL ++ VFF+LL E +PP+SL  P++ +YL+ T +L++LSV+ T+ VLN +FR
Sbjct:    1 MGSVLFTIVFVALQIATGLANPDSKRLYDDL--LSNYNRLIRPVGNNSDRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLPDIVLYNNADGNYEVTIMTKAILHHTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVDLRHLQQ----------APDS------------DNIDIGIDLQDYYISVEWDIMKVPAVRNEKFYSCCEEPYPDIIFNITLRRKTLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNFR 329          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrnb3b (neuronal acetylcholine receptor subunit non-alpha-2 [Source:NCBI gene;Acc:103031723])

HSP 1 Score: 222.631 bits (566), Expect = 3.321e-65
Identity = 111/314 (35.35%), Postives = 177/314 (56.37%), Query Frame = 1
Query:  403 RPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLT 1344
            RP +   +++ V  G+   Q+++VDEK +++T +V L Q W +  L WNPE+YG I  I +P   +WLPDIVL+ NADG++E     K  + Y G + W  PA ++S C +DV +FP+D Q C + FGSWTY+   V +       VL+                NY   +R        ++  +GEW+++    +     D  + Y ++ +   ++R  +FY + LI P +GLS +  L FYLP   GEK+ LST +L ++ VF +++ E +P SS V P+I +YL+   + ++LS++ TVFV+N H RS+ T
Sbjct:   43 RPTQHSNNTVRVRFGLKISQLVDVDEKNQLMTTNVWLWQEWIDYKLRWNPEDYGGITFIRVPSESIWLPDIVLYENADGRFEGSLMTKAIIKYNGAVTWTPPASYKSACTMDVTFFPFDRQNCSMKFGSWTYDGTMVDM-------VLM----------------NYQVDRR--------DFFDNGEWEILSATGMKGNRRDGTLSYPFVTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKVSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSAT 325          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrnb3b (neuronal acetylcholine receptor subunit non-alpha-2 [Source:NCBI gene;Acc:103031723])

HSP 1 Score: 222.631 bits (566), Expect = 3.380e-65
Identity = 111/314 (35.35%), Postives = 177/314 (56.37%), Query Frame = 1
Query:  403 RPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLT 1344
            RP +   +++ V  G+   Q+++VDEK +++T +V L Q W +  L WNPE+YG I  I +P   +WLPDIVL+ NADG++E     K  + Y G + W  PA ++S C +DV +FP+D Q C + FGSWTY+   V +       VL+                NY   +R        ++  +GEW+++    +     D  + Y ++ +   ++R  +FY + LI P +GLS +  L FYLP   GEK+ LST +L ++ VF +++ E +P SS V P+I +YL+   + ++LS++ TVFV+N H RS+ T
Sbjct:   50 RPTQHSNNTVRVRFGLKISQLVDVDEKNQLMTTNVWLWQEWIDYKLRWNPEDYGGITFIRVPSESIWLPDIVLYENADGRFEGSLMTKAIIKYNGAVTWTPPASYKSACTMDVTFFPFDRQNCSMKFGSWTYDGTMVDM-------VLM----------------NYQVDRR--------DFFDNGEWEILSATGMKGNRRDGTLSYPFVTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKVSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSAT 332          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrnb3b (neuronal acetylcholine receptor subunit non-alpha-2 [Source:NCBI gene;Acc:103031723])

HSP 1 Score: 222.631 bits (566), Expect = 3.908e-65
Identity = 111/314 (35.35%), Postives = 177/314 (56.37%), Query Frame = 1
Query:  403 RPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLT 1344
            RP +   +++ V  G+   Q+++VDEK +++T +V L Q W +  L WNPE+YG I  I +P   +WLPDIVL+ NADG++E     K  + Y G + W  PA ++S C +DV +FP+D Q C + FGSWTY+   V +       VL+                NY   +R        ++  +GEW+++    +     D  + Y ++ +   ++R  +FY + LI P +GLS +  L FYLP   GEK+ LST +L ++ VF +++ E +P SS V P+I +YL+   + ++LS++ TVFV+N H RS+ T
Sbjct:   50 RPTQHSNNTVRVRFGLKISQLVDVDEKNQLMTTNVWLWQEWIDYKLRWNPEDYGGITFIRVPSESIWLPDIVLYENADGRFEGSLMTKAIIKYNGAVTWTPPASYKSACTMDVTFFPFDRQNCSMKFGSWTYDGTMVDM-------VLM----------------NYQVDRR--------DFFDNGEWEILSATGMKGNRRDGTLSYPFVTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKVSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSAT 332          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrnb3a (cholinergic receptor, nicotinic, beta polypeptide 3a [Source:ZFIN;Acc:ZDB-GENE-040108-1])

HSP 1 Score: 221.861 bits (564), Expect = 5.036e-65
Identity = 113/317 (35.65%), Postives = 176/317 (55.52%), Query Frame = 1
Query:  394 KFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLT 1344
            K+ RPV     +I V  G+   Q+++VDEK +++T +V L Q W +  L W+PE+YG I SI +P   +WLPDIVL+ NADG++E     K  + Y G I W  PA ++S+C +DV +FP+D Q C + FGSWTY+   V L  + Q    + +K+F                              +GEW++++         D    Y ++ +   ++R  +FY + LI P +GLS +  L FYLP   GEK+ LST +L ++ VF +++ E +P SS V P+I +YL+   + ++ S++ TVFV+N H RS+ T
Sbjct:   31 KWVRPVFHANDTIAVRFGLKISQLVDVDEKNQLMTTNVWLWQEWTDYKLRWDPEDYGGITSIRVPSENIWLPDIVLYENADGRFEGSLMTKAIVKYDGTITWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLALVDQ---HVDRKDF----------------------------FDNGEWEILDATGRRGSRRDGIYSYPFVTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSAT 316          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrna3 (neuronal acetylcholine receptor subunit alpha-3-like [Source:NCBI gene;Acc:103025148])

HSP 1 Score: 221.861 bits (564), Expect = 6.634e-65
Identity = 124/350 (35.43%), Postives = 198/350 (56.57%), Query Frame = 1
Query:  316 IFLNLSFG---IENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDY-------IRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRS 1335
            IF+  S G    E   RL++   I +  +++ RPV+     + V   V+  Q++ VDE  +I+  ++ LR IW +  L W+P+++G ++ I +P N++W PDIVL+NNA G ++     K  L Y G + W  PAIF+S+C+IDV YFP+D Q C + FGSWTY+K ++ L  I              GS     T+N            L ++ +SGEW +++ P         DI+Y+        I + + IRR  +FY IN+I P + +S +  L FYLP   GEK+ L   +L ++ VF +++ E++P +SLV P+I +YL+ T + ++LS++ TVFVLN H+R+
Sbjct:   11 IFICFSAGGWASEAEHRLFS--VIFSSYNQYIRPVENVSDPVIVQFEVSMSQLVKVDEVNQIMETNLWLRHIWNDYKLRWDPKDFGGVEFIRVPSNRIWKPDIVLYNNAVGDFQVDDKTKALLRYNGDVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLI--------------GS-----TIN------------LKDFWESGEWMIIDAPGY-----KHDIKYNCCEEIYTDITYSLYIRRLPLFYTINMIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRT 322          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 225.328 bits (573), Expect = 6.112e-67
Identity = 118/332 (35.54%), Postives = 183/332 (55.12%), Query Frame = 1
Query:  376 IIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMR 1371
            ++ D  K+ RPV +   ++ V  G+   Q+++VDEK +++T +V L+Q W +  L WNP++YG I SI +P + +WLPDIVL++NADG++E     K  + + G I W  PAI++S+C IDV +FP+D+Q C + FGSWTY+   V L        ++   +   G                        Y  +GEW+ +          D    Y YI +   IRR  +FY + LI P +GLS +    FYLP   GEKI L T +L ++ VF +++ E +P SS V P+I +YL+   + ++LS++ TVFV+N H RS+ T      ++R
Sbjct:   42 MLKDYQKWVRPVDKLSDTVEVKFGLGIAQLVDVDEKNQLMTTNVWLKQEWVDINLRWNPDDYGGINSIRVPASSIWLPDIVLYDNADGRFEGSIVTKAVVKHDGRIKWTPPAIYKSSCTIDVTFFPFDQQNCSMKFGSWTYDGTLVDL--------IMVNSDVDRG-----------------------EYFDNGEWEFLNATGNKGVRLDGHRFYPYITYSFVIRRLPLFYTLFLIVPCLGLSFLTVFVFYLPSDEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIITVFVINVHHRSSSTHHPMAPWVR 342          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 218.779 bits (556), Expect = 4.380e-64
Identity = 118/338 (34.91%), Postives = 188/338 (55.62%), Query Frame = 1
Query:  343 ENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDY-------IRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRS 1335
            E A RLY  +      + + RPV      + V   V+  Q++ +DE  +I+  ++ L+  W +    WNP  +  ++ I +P +K+W PDIVL+NNADG ++ +   K  L Y G + W  PAIF+S+C+IDV YFP+D Q C + FGSWTY+K ++ L       VL+  K            +N            L ++ +SGEW +++ P         DI+Y+        I + V +RR  +FY INLI P + +S +  L FYLP   GEK+ LS  +L ++ VF +++ E++P +SLV P+I +YL+ T + ++LS++ T+FVLN H+R+
Sbjct:    6 EAASRLYKTL--FTSYNPYIRPVFNVSDPVIVRFEVSMSQLVKLDEVNQIMATNLWLKHTWNDYKFQWNPGQFEGMEYIRVPSDKIWKPDIVLYNNADGDFQVEGKTKALLKYDGTVMWMPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDL-------VLVGTK------------IN------------LKDFWESGEWVIIDVPGY-----KHDIKYNCCEQIYPDITYSVYVRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLSISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITIFVLNVHYRT 305          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 204.527 bits (519), Expect = 2.876e-58
Identity = 115/306 (37.58%), Postives = 171/306 (55.88%), Query Frame = 1
Query:  460 QIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGA--DDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMR 1371
             + + DEK +++T +V L+Q W +  L W+P  Y N+ SI +P   +W+PDIVL+NNADG +      K  L++TG + WK PAI++S+C IDV +FP+D+Q C + FGSWTY+K ++ L                              + R  D   L +Y +SGEW ++      +    D     Y  I +   IRR  +FY INLI P + +S +  L FYLP   GEKI L   +L ++ VF +L+ E +P +SLV P+I +YL+ T + ++LS++ TVFVLN H RS  T    PR++R
Sbjct:    9 HLCDCDEKNQMMTTNVWLKQEWDDYKLQWDPAEYENVTSIRVPSELIWVPDIVLYNNADGDFAVTHMTKAHLFHTGRVRWKPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDL----------------------------VSMARDVD---LKDYWESGEWAIVHAVGTYNTKKYDCCPQVYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPATHAM-PRWVR 282          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: chrnb1l (cholinergic receptor, nicotinic, beta 1 (muscle) like [Source:ZFIN;Acc:ZDB-GENE-060811-1])

HSP 1 Score: 181.415 bits (459), Expect = 1.940e-50
Identity = 108/336 (32.14%), Postives = 180/336 (53.57%), Query Frame = 1
Query:  337 GIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLT 1344
            G+E  + L  D+ ++       RP +     + V LG+T  Q++++   +  +T+S  +   W++  LSW+P NY N++SI L   ++WLPDI L NN DG ++        + YTG + W  P+I++S+C + V+YFP+D Q C + F S+TY+  ++ L +                  E +Q + +  +         + +  SGEW +   P+     +  D  Y  I F + + RK +FY IN++ P + ++I A  +FYLP  +GEK+ L   +L A+ VF +LL + VP +SL  P+I  YL+ T ++++  V+ TV VLN HFRS  T
Sbjct:   20 GLEAEENLLKDLFVVQQYKTLVRPARTATGRVTVRLGMTLSQLISLPACQPDMTLSRLISLSWEDPRLSWDPRNYDNLRSIRLSPKRVWLPDIALSNNNDGNFDFGLYVHVLVDYTGAVRWVPPSIYRSSCGMQVKYFPFDWQNCSMVFQSFTYDTSEINLEY---------------ALDEHRQEIRHIIIDE-------STFPVSGEWQIKHKPS-RKNTNPRDPLYQDITFYLIMERKPLFYIINIVVPCILITICAVFTFYLPPDAGEKMGLCISVLLALTVFLLLLADKVPETSLGVPVIVNYLMFTMVIVTACVILTVIVLNLHFRSPAT 332          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: htr3a (5-hydroxytryptamine (serotonin) receptor 3A [Source:ZFIN;Acc:ZDB-GENE-071012-5])

HSP 1 Score: 155.992 bits (393), Expect = 1.910e-41
Identity = 95/322 (29.50%), Postives = 158/322 (49.07%), Query Frame = 1
Query:  403 RPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNAD-GKYETQFPNKPTLY--YTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTP 1359
            RPVK  +  I V + V    I+NVDEK ++LT  +  RQ W +++L W+P  Y  I+ I +P N +W+PDI++    D GK     P+   +Y  Y G +    P    S C +D+  FP+D Q C L F SW +    + L                     W+ T    +     D +   N+   GEW+L+  P  L      + ++  ++  V IRR+ +FY +NLI P   L +M A  FYLP  SGE++     +L   +VF +++ +++P + + TP+I  Y ++   L+ +S+M T+F++    + ++     P
Sbjct:   51 RPVKNWRQPIIVAIDVMLYAILNVDEKNQVLTAYIWYRQRWTDEFLQWDPVQYDGIEQISIPTNNIWVPDIMISEFVDVGKS----PDIGYVYLSYNGTVMNYKPLQVVSACSLDIYSFPFDVQNCTLTFTSWLHTSNDINL-------------------TLWRTTEEIKE-----DKSIFLNF---GEWELISVPNELLHPLYGENRFSELKIYVVIRRRPLFYVVNLIMPSAFLMVMDA-GFYLPPDSGERVSFKITLLLGYSVFLIVVQDTLPATPIGTPLIAVYFVVCMALLVISLMETIFIVRLVHKQDVQSHVPP 340          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO42054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J7])

HSP 1 Score: 202.216 bits (513), Expect = 4.231e-58
Identity = 110/316 (34.81%), Postives = 168/316 (53.16%), Query Frame = 1
Query:  403 RPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYT---GLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDY--IRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRS 1335
            RPV  D   + V   ++ IQI+ V+ K +++T+SV +RQ W N  L+WN   YG I+S+ L   K+W+PDI+L+NNAD  Y        T       G  +W SPA F STC I+VRYFP+D Q C L FGSWTY                                 N   +   SD A L+ Y  +GEW L+  PA L+       +Y +  +   ++I+RK ++Y  NLI P   ++ +  + F+LP +SGEK+ L   +L A+ VF +L+ E++P +S   P++ QY + T  + ++S+++T  +LNF  R+
Sbjct:   54 RPVFNDSDKVNVEFSLSLIQIIAVNSKSQLVTVSVWIRQKWTNPMLAWNTSKYGGIESVNLNPAKVWIPDIILYNNADETYAGGLEKYKTSVIASSDGTQEWNSPASFTSTCNINVRYFPFDSQNCSLKFGSWTY-------------------------------VGNRLTMTSTSDSADLSKYVNNGEWHLLAMPAKLNRVFYNCCKYPFYDVTLYLEIQRKPLYYVFNLIIPCALIATLTLIKFFLPPESGEKVGLGITVLLAMTVFLLLVAETLPSTSDHIPLLGQYFVATMFVTAISLVATCLILNFFHRN 338          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO47969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKU6])

HSP 1 Score: 196.438 bits (498), Expect = 2.074e-57
Identity = 118/340 (34.71%), Postives = 184/340 (54.12%), Query Frame = 1
Query:  352 KRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNAD----GKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPA-----ILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLT 1344
            +RL +D+  +   S+  RPV     ++ V+ G+  +QI+NV+ + +I+  +V +RQ W N+ L+W+P NY  ++++ L    +W+PDIVL+++AD    G +E ++     +   G   W SPA F+STC+IDV YFP+DEQ CY+ FGSWTY    V +           Q +  P        V  SK            Y KS EWDLM         I +   +       +   + IRRK +FY  NLI P + +  M  L F+LP +SGE+I LS  +L A+AVF  L+ E++P +S   P++ ++ I     I++S+M+T +VLN H R++ T
Sbjct:    2 QRLISDL--LQGYSRNARPVLNSNHTLKVFFGMEIVQIVNVENRNQIIQTNVWIRQRWDNELLTWHPSNYEGVQTVRLDAKSVWIPDIVLYDSADSVFSGGHE-KYKTHVIISKDGSSAWFSPASFRSTCKIDVTYFPFDEQTCYMKFGSWTYTIADVDI-----------QASPAP--------VKSSK------------YLKSAEWDLMSATTSRKSQIYACCPE---PISDVTIAMTIRRKPLFYAFNLITPCMIMLTMILLGFFLPPESGERITLSITVLLAMAVFLQLVAETLPRNSESIPLLGRFYITIMTEIAVSLMATCWVLNIHHRNSGT 304          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO33746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRB3])

HSP 1 Score: 194.897 bits (494), Expect = 1.048e-56
Identity = 117/351 (33.33%), Postives = 185/351 (52.71%), Query Frame = 1
Query:  355 RLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQ---------IWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPA--ILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMRT 1374
            RL  D+   A+ S+  RPVK  +S+I V+ G+ + Q++ +D K ++L  +V +RQ         +W N  L WN  +YG IKSI +    +WLPDIVL+NN       QF  K  L   G   W +P+I +S C ID+ +FP+D+Q C L+FGSWTY+  +V L +                               +S    L++Y  SGE++++  P   I+         Y  + F + IRRK++FY  NLI P   ++  A L+F LP  +GE++ L    L A+ VF +++ E+ P +S VTP+I ++ + + + I L++++T FVLN  + S    E  P ++RT
Sbjct:    3 RLVHDL--FANSSQEVRPVKNKESAIKVFFGIAYTQLVELDAKNQVLVSNVWIRQASNCIGLKCLWNNHLLRWNESHYGGIKSINIDPKLVWLPDIVLYNNGSMD---QFKTKVILSSDGTNTWYAPSILRSRCSIDITFFPFDDQRCTLHFGSWTYDGLRVDLTN-------------------------------MSASVDLSSYMPSGEFEMINAPVDRIIVRYSCCPEPYPNLVFTLHIRRKVLFYFNNLIVPCFLITAFALLTFVLPPNTGERVTLVITTLLAMTVFMLMIAENTPTTSDVTPLIGKFFVASMVEIGLALIATCFVLNI-YESTGPSEDVPNWIRT 316          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO42072 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2P1])

HSP 1 Score: 191.045 bits (484), Expect = 2.116e-55
Identity = 112/328 (34.15%), Postives = 183/328 (55.79%), Query Frame = 1
Query:  391 SKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYE---TQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDI----QYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVF-VLNFHFRSNLTDE 1350
            +K  RPV     ++ V LG+T  QI ++ EK + L  S+ +RQ+W+N+YL+W+P+ +G I +I +  +K+W+PDI L+NNAD   +    +F  +  L + G+  W +P +  S+C+IDV YFP+DEQ C L FGSWTY+ E++          L+S+                      S    ++ Y  SG+WDL+   A     + F +     Y  + F + IRRK +FY +NLI P   ++ +  LSF+LP +SGE+I L    L A+ VF +L+ + +PP+S V P+I+ Y  +T + + L++++T    L  +F + +T E
Sbjct:   13 NKHLRPVVNKSRALTVRLGLTLHQIASLVEKSQFLQTSLWVRQMWRNEYLTWDPKEFGGISTINVNVDKVWVPDIYLYNNADADGDGALNKFGTQIKLLFNGINIWLAPVLLTSSCKIDVTYFPFDEQHCSLKFGSWTYDGERLD---------LVSE----------------------SPSGDVSKYVPSGQWDLVSFTA--KRNEIFYVCCPQSYPDVTFTLNIRRKTIFYYMNLIMPCFLITGLTLLSFFLPPESGERITLVITNLLAMTVFMLLVADWLPPTSEVVPLISMYYTLTMMEVGLALVATCLDYLKCYFMNPVTTE 307          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO37425 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFX0])

HSP 1 Score: 188.734 bits (478), Expect = 8.879e-55
Identity = 100/315 (31.75%), Postives = 172/315 (54.60%), Query Frame = 1
Query:  403 RPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTL---YYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLME---TPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHF 1329
            RPV+     + V + +T   ++++DEK++ILT  V +RQ W N+ + W+P+ +G IK + L  + +W PDIVL+NN   +++ +  +  TL   YY G   W +P IF++ C+I V+ FP+D Q C L FGSW Y+  ++ L ++K                              ++G       ++GEWD++    T   LS     D+ Y  I F V++RR+ +FY  NLI P   ++++A  SFY+P++ GE+I     +L ++ VF +L+ ES+PP+S   P I  Y   + +L++L++++T   L  ++
Sbjct:   18 RPVENTSRPVNVTMDMTLSNVIDIDEKQQILTSCVWMRQEWINERMQWDPKLFGGIKDVTLHTSDIWQPDIVLYNNVFEEFDGRLDHVSTLVRVYYNGSTHWNAPFIFKTLCKIQVKNFPFDLQECTLKFGSWQYDSSEIDLHYVK------------------------------TEGKLDNTRVRNGEWDVIRVKITRNALSYPCCPDVVYPDITFIVQLRRRSLFYIFNLIIPNFLIALLAFFSFYIPIECGERISFVITVLLSMTVFLLLVAESIPPTSEALPAIALYYTSSMILVALALVATGITLKVNY 302          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: chrna3 (neuronal acetylcholine receptor subunit alpha-3 [Source:NCBI gene;Acc:101159658])

HSP 1 Score: 223.016 bits (567), Expect = 2.305e-64
Identity = 117/327 (35.78%), Postives = 188/327 (57.49%), Query Frame = 1
Query:  376 IIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDY-------IRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRS 1335
            I ++ +++ RPV+     + V   V+  Q++ VDE  +I+  ++ LR IW +  L WNP+ +G ++ I +P N++W PDIVL+NNA G ++     K  L + G + W  PAIF+S+C+IDV YFP+D Q C + FGSWTY+K ++ L  I              GS     T+N            L ++ +SGEW +++ P         DI+Y+        I + + IRR  +FY IN+I P + +S +  L FYLP   GEK+ L   +L ++ VF +++ E++P +SLV P+I +YL+ T + ++LS++ TVFVLN H+R+
Sbjct:   35 IFSNYNQYIRPVENVSDPVIVQFEVSMSQLVKVDEVNQIMETNLWLRHIWNDYKLKWNPKEFGGVEFIRVPSNRIWKPDIVLYNNAVGDFQVDDKTKALLRFNGDVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLI--------------GS-----TIN------------LKDFWESGEWTIIDAPGY-----KHDIKYNCCEEIYTDITYSLYIRRLPLFYTINMIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRT 325          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: chrnb3b (neuronal acetylcholine receptor subunit non-alpha-2 [Source:NCBI gene;Acc:101162690])

HSP 1 Score: 220.32 bits (560), Expect = 4.024e-64
Identity = 113/314 (35.99%), Postives = 175/314 (55.73%), Query Frame = 1
Query:  403 RPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLT 1344
            RP++    ++ V  G+   Q+++VDEK +++T +V LRQ W +  L WNP+ YG I SI +P   +WLPDIVL+ NADGK+E     K  + + G + W  PA ++S C +DV +FP+D Q C + FGSWTY+   V L       VL+                  S++ R        ++  +GEW+++          D    Y +I     ++R  +FY + LI P +GLS +  L FYLP   GEK+ LST +L ++ VF +++ E +P SS V P+I +YL+   + ++LS++ TVFV+N H RS+ T
Sbjct:   50 RPIQRPNDTVRVRFGLKISQLVDVDEKNQLMTTNVWLRQEWIDYKLRWNPDKYGGITSIRVPSENIWLPDIVLYENADGKFEGSLMTKAIVKFNGAVTWMPPASYKSACTMDVTFFPFDRQNCSMKFGSWTYDGNMVDL-------VLMD-----------------SQVDR-------KDFFDNGEWEILSATGAKGNRKDGLYFYPFITCSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSAT 332          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: ENSORLT00000038695.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101166204])

HSP 1 Score: 221.476 bits (563), Expect = 5.314e-64
Identity = 117/341 (34.31%), Postives = 188/341 (55.13%), Query Frame = 1
Query:  310 LSIFLNLSFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGA--DDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFH 1326
            L ++  +S    N +RLY+D+  ++  +   RPV  D  S+ V+ G++ +QIM+VDEK ++LT ++ LR  W + YL WN  +Y  + ++  P + +W PDI+L+N+AD +++  F     +  +G   +  P IF+STC IDVR+FP+D Q C L FGSWTY    + L+ ++                                 A ++ Y  +GEWDL+E P   +    +  D  Y  I F V +RR+ ++Y +NL+ P V +S +A L F LP  SGEKI L   +L ++ VF +L+ E +P +S   P+I +Y   T +++ LSV++TV VL +H
Sbjct:   37 LCLYSVVSHQGPNQRRLYSDL--MSTYNPLERPVYNDSQSLTVHFGLSLLQIMDVDEKNQVLTTNIWLRLYWNDHYLQWNSSDYPGVTNVRFPDHLIWKPDILLYNSADERFDATFHTNILVNSSGTCSYLPPGIFKSTCYIDVRWFPFDVQRCELKFGSWTYGGWSLDLKMLE---------------------------------ADVSGYIANGEWDLVEVPGQRNERFYECCDEPYLDITFTVVMRRRTLYYGLNLLLPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAEYFATTMVIVGLSVIATVLVLQYH 342          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: chrna2b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:101155076])

HSP 1 Score: 220.705 bits (561), Expect = 8.160e-64
Identity = 124/336 (36.90%), Postives = 190/336 (56.55%), Query Frame = 1
Query:  391 SKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQ--------YDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMRT 1374
            +K+ RPV      + V  G++  Q+++VDEK +++T +V L+Q W +  L W P +Y N+ SI +P   +W+PDIVL+NNADG++      K  L++TG + W  PAI++S+C IDV +FP+D+Q C + FGSWTY+K ++                                L+RI +   L NY +SGEW      AI++    ++ +        Y  I +   IRR  +FY INLI P + +S +  L FYLP   GEKI L   +L ++ VF +L+ E +P +SLV P+I +YL+ T + ++LS++ TVFVLN H RS  T +  PR++ T
Sbjct:   56 NKWSRPVPNISDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMTKAHLFHTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKI-------------------------------DLERIENTVDLNNYWESGEW------AIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKM-PRWVHT 353          
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: chrna2b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:101155076])

HSP 1 Score: 220.705 bits (561), Expect = 8.160e-64
Identity = 124/336 (36.90%), Postives = 190/336 (56.55%), Query Frame = 1
Query:  391 SKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQ--------YDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMRT 1374
            +K+ RPV      + V  G++  Q+++VDEK +++T +V L+Q W +  L W P +Y N+ SI +P   +W+PDIVL+NNADG++      K  L++TG + W  PAI++S+C IDV +FP+D+Q C + FGSWTY+K ++                                L+RI +   L NY +SGEW      AI++    ++ +        Y  I +   IRR  +FY INLI P + +S +  L FYLP   GEKI L   +L ++ VF +L+ E +P +SLV P+I +YL+ T + ++LS++ TVFVLN H RS  T +  PR++ T
Sbjct:   56 NKWSRPVPNISDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMTKAHLFHTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKI-------------------------------DLERIENTVDLNNYWESGEW------AIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKM-PRWVHT 353          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000023242.1 (SMESG000023242.1)

HSP 1 Score: 973.77 bits (2516), Expect = 0.000e+0
Identity = 540/540 (100.00%), Postives = 540/540 (100.00%), Query Frame = 1
Query:  277 MQTIKKVLFTILSIFLNLSFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMRTXXXXXXXXXXXXXXXXXXXYVKDLKKEFLKHRKRAESIRNSISSDSTTQFLRKNMDKCIDLFIHCERKSPKRAASYQSSIVSDLGGIEEISNSFESQIKEACCXXXXXXXXXXXXXXXXXXXXXYMLAAIVLDRLIXXXXXXXXXXXXXXXXXQCPTLFDKSPPMNEFYFNDSK 1896
            MQTIKKVLFTILSIFLNLSFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMRTFLLKFLPKILVLKPPPKFKYVKDLKKEFLKHRKRAESIRNSISSDSTTQFLRKNMDKCIDLFIHCERKSPKRAASYQSSIVSDLGGIEEISNSFESQIKEACCIISEITEEILTEIELNNIENEYMLAAIVLDRLILYVFCFLSLLVVLLTFLQCPTLFDKSPPMNEFYFNDSK
Sbjct:    1 MQTIKKVLFTILSIFLNLSFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMRTFLLKFLPKILVLKPPPKFKYVKDLKKEFLKHRKRAESIRNSISSDSTTQFLRKNMDKCIDLFIHCERKSPKRAASYQSSIVSDLGGIEEISNSFESQIKEACCIISEITEEILTEIELNNIENEYMLAAIVLDRLILYVFCFLSLLVVLLTFLQCPTLFDKSPPMNEFYFNDSK 540          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000023242.1 (SMESG000023242.1)

HSP 1 Score: 941.799 bits (2433), Expect = 0.000e+0
Identity = 530/540 (98.15%), Postives = 530/540 (98.15%), Query Frame = 1
Query:  277 MQTIKKVLFTILSIFLNLSFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMRTXXXXXXXXXXXXXXXXXXXYVKDLKKEFLKHRKRAESIRNSISSDSTTQFLRKNMDKCIDLFIHCERKSPKRAASYQSSIVSDLGGIEEISNSFESQIKEACCXXXXXXXXXXXXXXXXXXXXXYMLAAIVLDRLIXXXXXXXXXXXXXXXXXQCPTLFDKSPPMNEFYFNDSK 1896
            MQTIKKVLFTILSIFLNLSFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMRTFLLKFLPKILVLKPPPKFKYVKDLKKEFLKHRKRAESIRNSISSDSTTQFLRKNMDK          KSPKRAASYQSSIVSDLGGIEEISNSFESQIKEACCIISEITEEILTEIELNNIENEYMLAAIVLDRLILYVFCFLSLLVVLLTFLQCPTLFDKSPPMNEFYFNDSK
Sbjct:    1 MQTIKKVLFTILSIFLNLSFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTPRFMRTFLLKFLPKILVLKPPPKFKYVKDLKKEFLKHRKRAESIRNSISSDSTTQFLRKNMDK----------KSPKRAASYQSSIVSDLGGIEEISNSFESQIKEACCIISEITEEILTEIELNNIENEYMLAAIVLDRLILYVFCFLSLLVVLLTFLQCPTLFDKSPPMNEFYFNDSK 530          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000014741.1 (SMESG000014741.1)

HSP 1 Score: 252.677 bits (644), Expect = 1.025e-75
Identity = 137/357 (38.38%), Postives = 217/357 (60.78%), Query Frame = 1
Query:  283 TIKKVLFTILSIFLNLSFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEF 1353
            T K  L  +  + + ++   ++A RLY  +   ++ S + RPV  +   + VYLG+   Q+  V+ +K+ +T +V L Q W +  L WNP  YG +  +Y+P +K+WLPDIVLFNN DGKYE     K T+++ G + W  PAI++S+C+I+V +FPYD Q C+L F SWTY   +V L+H+ Q  V+                 N + +  I     LTN+++S E+D++E  A  S           + F + +RRK +FY +NL+ P + +  ++ L+FYLP +SGEK+ LS  ILF++ +FF+LL E++P +SLV P+I +YL+ T +LISLS++ TV++LN HFRS+L+ + 
Sbjct:    2 TTKFFLIAVFYVLIPINHAYKDAIRLYKVLMDGSNYSNYIRPVNYNNDVLTVYLGLRLSQLSEVNMRKETVTTNVWLEQQWIDVNLRWNPNQYGGVTKLYIPSDKIWLPDIVLFNNIDGKYEISIKTKATVFHDGTVKWIPPAIYKSSCQINVEFFPYDIQECFLTFASWTYEGSKVNLKHMAQKNVI--------------DIPNATGMVNIDFAVDLTNFYESVEFDILELSAERSLVTYLQPS-PKVTFKILMRRKTLFYTVNLMMPCLAICFLSVLAFYLPSESGEKVYLSITILFSLTLFFLLLVETIPSTSLVIPLIGKYLLFTMILISLSIILTVYILNVHFRSSLSHDM 343          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000014741.1 (SMESG000014741.1)

HSP 1 Score: 252.677 bits (644), Expect = 3.463e-75
Identity = 137/356 (38.48%), Postives = 217/356 (60.96%), Query Frame = 1
Query:  283 TIKKVLFTILSIFLNLSFGIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDE 1350
            T K  L  +  + + ++   ++A RLY  +   ++ S + RPV  +   + VYLG+   Q+  V+ +K+ +T +V L Q W +  L WNP  YG +  +Y+P +K+WLPDIVLFNN DGKYE     K T+++ G + W  PAI++S+C+I+V +FPYD Q C+L F SWTY   +V L+H+ Q  V+                 N + +  I     LTN+++S E+D++E  A  S           + F + +RRK +FY +NL+ P + +  ++ L+FYLP +SGEK+ LS  ILF++ +FF+LL E++P +SLV P+I +YL+ T +LISLS++ TV++LN HFRS+L+ +
Sbjct:   50 TTKFFLIAVFYVLIPINHAYKDAIRLYKVLMDGSNYSNYIRPVNYNNDVLTVYLGLRLSQLSEVNMRKETVTTNVWLEQQWIDVNLRWNPNQYGGVTKLYIPSDKIWLPDIVLFNNIDGKYEISIKTKATVFHDGTVKWIPPAIYKSSCQINVEFFPYDIQECFLTFASWTYEGSKVNLKHMAQKNVI--------------DIPNATGMVNIDFAVDLTNFYESVEFDILELSAERSLVTYLQPS-PKVTFKILMRRKTLFYTVNLMMPCLAICFLSVLAFYLPSESGEKVYLSITILFSLTLFFLLLVETIPSTSLVIPLIGKYLLFTMILISLSIILTVYILNVHFRSSLSHD 390          
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000020665.1 (SMESG000020665.1)

HSP 1 Score: 233.032 bits (593), Expect = 4.400e-69
Identity = 128/349 (36.68%), Postives = 206/349 (59.03%), Query Frame = 1
Query:  337 GIENAKRLYTDIGIIADESKFWRPVKEDQSSIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKSIYLPHNKMWLPDIVLFNNADGKYE--TQFPNKPTLYYTGLIDWKSPAIFQSTCEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGSAEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDI------QYDYIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLILFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFHFRSNLTDEFTP 1359
            G ++A+RLY D+          RPVK   S++ +Y+ ++ +QI++VDEK +I+ +++ + Q W +    W+P +YGN+  + +P  ++W PD+VL+NNA G ++  +    K  + + G + WK P IF+S C I+V +FP+D+Q+C L  G+WT+N   + LRH  Q     SQ +F   +A+    ++            L+ Y  + EWDL+E    +S   + +        Y  I F V +RR+ +FY INLI P + +S +  L FYLP  SGEK+ LS  IL ++ VFF+L+ +  PP+S+V P+I +YL+ T +L++LSVM+TV VLN H+RS  T +  P
Sbjct:   16 GTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKN--QSQASFDNCNAKIDYAID------------LSQYVNNVEWDLLE----VSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKVSLSISILLSLTVFFLLIFDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAP 346          
The following BLAST results are available for this feature:
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNB33.360e-6636.28cholinergic receptor nicotinic beta 3 subunit [Sou... [more]
CHRNA31.340e-6535.61cholinergic receptor nicotinic alpha 3 subunit [So... [more]
CHRNA51.560e-6534.95cholinergic receptor nicotinic alpha 5 subunit [So... [more]
CHRNA62.168e-6532.88cholinergic receptor nicotinic alpha 6 subunit [So... [more]
CHRNA34.160e-6535.61cholinergic receptor nicotinic alpha 3 subunit [So... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-385.568e-8039.15Acetylcholine receptor subunit alpha-type unc-38 ... [more]
unc-634.218e-7339.40Acetylcholine receptor subunit alpha-type unc-63 ... [more]
acr-89.097e-6737.85AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-89.097e-6737.85AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-21.530e-6539.51Acetylcholine receptor subunit beta-type acr-2 [S... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nAChRalpha12.078e-8740.38gene:FBgn0000036 transcript:FBtr0334916[more]
nAChRalpha12.078e-8740.38gene:FBgn0000036 transcript:FBtr0084619[more]
nAChRbeta24.326e-8741.47gene:FBgn0004118 transcript:FBtr0084681[more]
nAChRalpha14.665e-8740.38gene:FBgn0000036 transcript:FBtr0330310[more]
nAChRalpha42.705e-8439.94gene:FBgn0266347 transcript:FBtr0332872[more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrnb3b1.901e-6535.80cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
chrnb21.025e-6436.59cholinergic receptor, nicotinic, beta 2 [Source:ZF... [more]
chrna31.183e-6434.93cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrna72.725e-6434.68cholinergic receptor, nicotinic, alpha 7 (neuronal... [more]
chrna63.062e-6436.12cholinergic receptor, nicotinic, alpha 6 [Source:Z... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncaph4.981e-6533.91non-SMC condensin I complex subunit H [Source:Xenb... [more]
ncaph6.284e-6533.91non-SMC condensin I complex subunit H [Source:Xenb... [more]
ncaph6.345e-6533.91non-SMC condensin I complex subunit H [Source:Xenb... [more]
ncaph6.390e-6533.91non-SMC condensin I complex subunit H [Source:Xenb... [more]
ncaph1.058e-6433.91non-SMC condensin I complex subunit H [Source:Xenb... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chrna51.433e-6734.77cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna54.947e-6734.77cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrnb35.024e-6735.99cholinergic receptor, nicotinic, beta polypeptide ... [more]
Chrnb31.646e-6635.99cholinergic receptor, nicotinic, beta polypeptide ... [more]
Chrna63.233e-6533.52cholinergic receptor, nicotinic, alpha polypeptide... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P09478|ACH1_DROME2.083e-8640.38Acetylcholine receptor subunit alpha-like 1 OS=Dro... [more]
sp|P25162|ACH4_DROME4.337e-8641.47Acetylcholine receptor subunit beta-like 2 OS=Dros... [more]
sp|P17644|ACH2_DROME1.836e-8140.12Acetylcholine receptor subunit alpha-like 2 OS=Dro... [more]
sp|P91766|ACH1_MANSE2.388e-8038.42Acetylcholine receptor subunit alpha-like OS=Mandu... [more]
sp|P23414|ACH1_SCHGR2.938e-7938.95Acetylcholine receptor subunit alpha-L1 OS=Schisto... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A088BCU71.127e-8741.45Nicotinic acetylcholine receptor alpha 4 subunit (... [more]
A0A1S3J8X61.950e-8742.27acetylcholine receptor subunit alpha-like 1 OS=Lin... [more]
A0A1I8GXF73.037e-8741.50Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GTY34.072e-8741.50Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1B0D9619.270e-8741.08Uncharacterized protein OS=Phlebotomus papatasi OX... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrnb3b3.321e-6535.35neuronal acetylcholine receptor subunit non-alpha-... [more]
chrnb3b3.380e-6535.35neuronal acetylcholine receptor subunit non-alpha-... [more]
chrnb3b3.908e-6535.35neuronal acetylcholine receptor subunit non-alpha-... [more]
chrnb3a5.036e-6535.65cholinergic receptor, nicotinic, beta polypeptide ... [more]
chrna36.634e-6535.43neuronal acetylcholine receptor subunit alpha-3-li... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrnb3b6.112e-6735.54cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
chrna34.380e-6434.91cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrna2a2.876e-5837.58cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
chrnb1l1.940e-5032.14cholinergic receptor, nicotinic, beta 1 (muscle) l... [more]
htr3a1.910e-4129.505-hydroxytryptamine (serotonin) receptor 3A [Sourc... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420544.231e-5834.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479692.074e-5734.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337461.048e-5633.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420722.116e-5534.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374258.879e-5531.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna32.305e-6435.78neuronal acetylcholine receptor subunit alpha-3 [S... [more]
chrnb3b4.024e-6435.99neuronal acetylcholine receptor subunit non-alpha-... [more]
ENSORLT00000038695.15.314e-6434.31neuronal acetylcholine receptor subunit alpha-7-li... [more]
chrna2b8.160e-6436.90neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrna2b8.160e-6436.90neuronal acetylcholine receptor subunit alpha-2 [S... [more]
back to top
BLAST of Acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023242.10.000e+0100.00SMESG000023242.1[more]
SMESG000023242.10.000e+098.15SMESG000023242.1[more]
SMESG000014741.11.025e-7538.38SMESG000014741.1[more]
SMESG000014741.13.463e-7538.48SMESG000014741.1[more]
SMESG000020665.14.400e-6936.68SMESG000020665.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034555 ID=SMED30034555|Name=Acetylcholine receptor subunit alpha-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1944bp
TTCAAATTTTTATTAGTGAAATTATTTTAATAGTATTTTGAAATTTAACA
TATTTTTACATATTATATTTCTATTTCCAAACTGACGGGCATGAAGTCCA
TAAATGAGCTCCCGACGTGAAAAATACGAGCAATATTACATCAAATTTAA
CAGATCAAAGTAAATTTCGTTTCTATGATATACAATGAGTGAATTAGTGA
AAGTTGATCGGAATTTGGCTACGCATCAGTGATTTTATAATCATTTCACA
CCTTTCACTTTTGTAAAACTTTATTAATGCAAACTATTAAAAAAGTTCTT
TTTACAATTCTTTCAATTTTTTTGAATTTAAGTTTCGGTATTGAAAATGC
TAAACGACTTTATACAGATATTGGCATCATTGCTGATGAATCAAAGTTCT
GGAGGCCTGTAAAAGAAGATCAAAGCAGTATTTTTGTCTACTTGGGGGTA
ACTTTTATTCAGATTATGAATGTGGACGAGAAAAAGAAAATCCTTACAAT
GAGTGTCCAGTTGCGACAAATTTGGAAGAATAAATATCTAAGTTGGAATC
CTGAAAATTACGGAAACATTAAATCCATTTACCTACCCCACAATAAAATG
TGGCTTCCGGATATTGTACTATTTAACAATGCTGATGGGAAATACGAAAC
ACAATTTCCCAATAAGCCCACCTTGTACTACACTGGGTTAATTGACTGGA
AAAGTCCTGCGATATTTCAAAGTACCTGTGAAATTGATGTCCGATATTTT
CCATATGACGAACAAATCTGCTACCTGAATTTCGGTTCTTGGACATACAA
TAAAGAACAGGTCAAGCTTAGGCATATAAAACAATTAGAAGTGCTCCTCA
GCCAAAAGAATTTCCAGCCGGGATCAGCTGAATGGAAACAAACAGTAAAT
TATTCGAAATTGCAACGAATTTCTGATGGGGCCTTTTTGACAAACTATCA
TAAAAGTGGAGAATGGGATTTAATGGAAACACCGGCCATTTTGTCAGGGG
CCGACGACTTCGATATTCAATACGATTACATTCGTTTCGGTGTAAAAATT
CGACGAAAAATTATGTTTTACAACATTAATCTTATTTTCCCAATGGTCGG
ATTGAGCATTATGGCAGCTCTCAGTTTTTATTTACCAGTAAAAAGTGGGG
AAAAAATAGATTTATCAACGTTGATTTTATTTGCGATTGCCGTGTTTTTC
GTCCTCCTCGGTGAATCTGTCCCTCCATCTTCGTTGGTAACTCCGATCAT
CAACCAGTATTTAATCATAACCTTTTTATTAATTTCTTTGTCGGTAATGA
GCACGGTGTTTGTCTTGAATTTCCATTTTCGCTCAAATTTGACAGACGAA
TTTACTCCAAGGTTCATGAGAACATTTCTCTTGAAATTCTTGCCGAAAAT
TTTGGTGTTAAAACCTCCACCTAAATTCAAATATGTGAAAGATTTGAAGA
AAGAATTTCTGAAGCATCGTAAAAGAGCAGAATCAATTAGAAATTCAATT
TCAAGTGATTCAACAACACAATTTCTACGTAAAAATATGGACAAATGTAT
TGATTTATTTATTCACTGTGAAAGAAAAAGTCCCAAGAGAGCTGCCAGTT
ATCAATCATCAATAGTTTCGGATTTGGGGGGCATCGAAGAGATTTCTAAT
TCTTTTGAATCTCAAATTAAAGAGGCGTGTTGCATAATATCAGAAATCAC
AGAGGAAATTTTGACAGAAATTGAACTGAATAATATTGAAAATGAATATA
TGCTTGCAGCAATTGTGCTAGATCGGCTGATTTTATATGTATTTTGTTTT
CTGAGTCTTTTAGTGGTTTTACTGACGTTTTTACAATGTCCAACTCTATT
TGACAAGTCACCCCCGATGAATGAATTTTATTTCAATGATTCGAAATTGA
ACCAATTGTTGCTGCAACAATTGTGATTTTTTGATTTTTTTAGG
back to top

protein sequence of SMED30034555-orf-1

>SMED30034555-orf-1 ID=SMED30034555-orf-1|Name=SMED30034555-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=550bp
MQTIKKVLFTILSIFLNLSFGIENAKRLYTDIGIIADESKFWRPVKEDQS
SIFVYLGVTFIQIMNVDEKKKILTMSVQLRQIWKNKYLSWNPENYGNIKS
IYLPHNKMWLPDIVLFNNADGKYETQFPNKPTLYYTGLIDWKSPAIFQST
CEIDVRYFPYDEQICYLNFGSWTYNKEQVKLRHIKQLEVLLSQKNFQPGS
AEWKQTVNYSKLQRISDGAFLTNYHKSGEWDLMETPAILSGADDFDIQYD
YIRFGVKIRRKIMFYNINLIFPMVGLSIMAALSFYLPVKSGEKIDLSTLI
LFAIAVFFVLLGESVPPSSLVTPIINQYLIITFLLISLSVMSTVFVLNFH
FRSNLTDEFTPRFMRTFLLKFLPKILVLKPPPKFKYVKDLKKEFLKHRKR
AESIRNSISSDSTTQFLRKNMDKCIDLFIHCERKSPKRAASYQSSIVSDL
GGIEEISNSFESQIKEACCIISEITEEILTEIELNNIENEYMLAAIVLDR
LILYVFCFLSLLVVLLTFLQCPTLFDKSPPMNEFYFNDSKLNQLLLQQL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0004889acetylcholine-activated cation-selective channel activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0022848acetylcholine-gated cation-selective channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR036719Neuro-gated_channel_TM_sf
IPR036734Neur_chan_lig-bd_sf
IPR002394Nicotinic_acetylcholine_rcpt
IPR006201Neur_channel
IPR027361Acetylcholine_rcpt_TM
IPR006202Neur_chan_lig-bd
IPR006029Neurotrans-gated_channel_TM
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0045211postsynaptic membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0005892acetylcholine-gated channel complex
GO:0030054cell junction
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0006812cation transport
GO:0007165signal transduction
GO:0007271synaptic transmission, cholinergic
GO:0017085response to insecticide
GO:0034220ion transmembrane transport
GO:0060078regulation of postsynaptic membrane potential
GO:0060079excitatory postsynaptic potential
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002394Nicotinic acetylcholine receptorPRINTSPR00254NICOTINICRcoord: 95..109
score: 33.93
coord: 131..149
score: 41.35
coord: 61..77
score: 36.86
coord: 113..125
score: 57.26
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 256..268
score: 34.32
coord: 74..90
score: 32.5
coord: 151..165
score: 50.53
coord: 107..118
score: 49.06
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 24..522
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 269..516
e-value: 6.6E-37
score: 127.8
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 266..380
e-value: 2.3E-29
score: 104.0
NoneNo IPR availablePANTHERPTHR18945:SF778ACETYLCHOLINE RECEPTOR SUBUNIT BETA-LIKE 2coord: 24..522
NoneNo IPR availableCDDcd19031LGIC_ECD_nAChR_proto_alpha-likecoord: 25..264
e-value: 7.45285E-75
score: 234.868
NoneNo IPR availableCDDcd19064LGIC_TM_nAChRcoord: 263..352
e-value: 5.3877E-31
score: 114.533
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.71
NoneNo IPR availableTMHMMTMhelixcoord: 262..284
NoneNo IPR availableTMHMMTMhelixcoord: 501..523
NoneNo IPR availableTMHMMTMhelixcoord: 325..347
NoneNo IPR availableTMHMMTMhelixcoord: 296..315
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 40..261
e-value: 2.6E-51
score: 174.1
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 151..165
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 263..526
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 26..261