Protein transport protein Sec61 subunit gamma

Overview
NameProtein transport protein Sec61 subunit gamma
Smed IDSMED30034546
Length (bp)357
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein transport protein Sec61 subunit gamma (SMED30034546) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein transport protein Sec61 subunit gamma (SMED30034546) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein transport protein Sec61 subunit gamma (SMED30034546) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein transport protein Sec61 subunit gamma (SMED30034546) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034546

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30034546SMESG000062123.1 SMESG000063809.1 dd_Smed_v4_429_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034546SMESG000062123.1 SMESG000063809.1 dd_Smed_v4_429_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034546SMESG000062123.1 SMESG000063809.1 dd_Smed_v4_429_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034546SMESG000062123.1 SMESG000063809.1 dd_Smed_v4_429_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034546SMESG000062123.1 SMESG000063809.1 dd_Smed_v4_429_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30034546SMESG000062123.1 SMESG000063809.1 dd_Smed_v4_429_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034546SMESG000062123.1 SMESG000063809.1 dd_Smed_v4_429_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034546SMESG000062123.1 SMESG000063809.1 dd_Smed_v4_429_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034546SMESG000062123.1 SMESG000063809.1 dd_Smed_v4_429_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034546SMESG000062123.1 SMESG000063809.1 Contig34324newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034546SMESG000062123.1 SMESG000063809.1 Contig34324uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034546SMESG000062123.1 SMESG000063809.1 Contig8393newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034546SMESG000062123.1 SMESG000063809.1 Contig8393uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
body wall musculatureSMED30034546SMESG000062123.1 SMESG000063809.1 dd_Smed_v4_429_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30034546SMESG000062123.1 SMESG000063809.1 dd_Smed_v6_429_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30034546SMESG000062123.1 SMESG000063809.1 dd_Smed_v6_429_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30034546SMESG000062123.1 SMESG000063809.1 dd_Smed_v6_429_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Human
Match: SEC61G (SEC61 translocon gamma subunit [Source:HGNC Symbol;Acc:HGNC:18277])

HSP 1 Score: 85.8853 bits (211), Expect = 6.435e-23
Identity = 59/67 (88.06%), Postives = 64/67 (95.52%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM F+EP++QF KDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Human
Match: SEC61G (SEC61 translocon gamma subunit [Source:HGNC Symbol;Acc:HGNC:18277])

HSP 1 Score: 85.8853 bits (211), Expect = 6.435e-23
Identity = 59/67 (88.06%), Postives = 64/67 (95.52%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM F+EP++QF KDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Human
Match: SEC61G (SEC61 translocon gamma subunit [Source:HGNC Symbol;Acc:HGNC:18277])

HSP 1 Score: 85.8853 bits (211), Expect = 6.435e-23
Identity = 59/67 (88.06%), Postives = 64/67 (95.52%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM F+EP++QF KDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Human
Match: SEC61G (SEC61 translocon gamma subunit [Source:HGNC Symbol;Acc:HGNC:18277])

HSP 1 Score: 85.8853 bits (211), Expect = 6.435e-23
Identity = 59/67 (88.06%), Postives = 64/67 (95.52%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM F+EP++QF KDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Celegans
Match: emo-1 (Protein transport protein Sec61 subunit gamma [Source:UniProtKB/Swiss-Prot;Acc:Q19967])

HSP 1 Score: 78.9518 bits (193), Expect = 1.441e-20
Identity = 56/67 (83.58%), Postives = 61/67 (91.04%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQ    IEPA+QF+KDS RLV RCTKPDRKE++KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQFQALIEPARQFSKDSYRLVKRCTKPDRKEYQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Fly
Match: CG8860 (gene:FBgn0033691 transcript:FBtr0088011)

HSP 1 Score: 80.1073 bits (196), Expect = 5.448e-21
Identity = 57/67 (85.07%), Postives = 62/67 (92.54%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MD+V+ F EP + FAKDSIRLV RCTKPDRKEF+KIAIATA+GFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Fly
Match: Sec61gamma (gene:FBgn0031049 transcript:FBtr0340610)

HSP 1 Score: 79.337 bits (194), Expect = 1.169e-20
Identity = 56/67 (83.58%), Postives = 61/67 (91.04%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MD+V+ F EP + FAKDSIRLV RCTKPDRKEF+KIAIATA+GF IMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Fly
Match: Sec61gamma (gene:FBgn0031049 transcript:FBtr0344986)

HSP 1 Score: 79.337 bits (194), Expect = 1.169e-20
Identity = 56/67 (83.58%), Postives = 61/67 (91.04%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MD+V+ F EP + FAKDSIRLV RCTKPDRKEF+KIAIATA+GF IMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Fly
Match: Sec61gamma (gene:FBgn0031049 transcript:FBtr0074745)

HSP 1 Score: 79.337 bits (194), Expect = 1.169e-20
Identity = 56/67 (83.58%), Postives = 61/67 (91.04%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MD+V+ F EP + FAKDSIRLV RCTKPDRKEF+KIAIATA+GF IMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Fly
Match: CG13426 (gene:FBgn0034510 transcript:FBtr0086295)

HSP 1 Score: 51.6026 bits (122), Expect = 2.233e-9
Identity = 35/57 (61.40%), Postives = 45/57 (78.95%), Query Frame = 3
Query:  117 PAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIV 287
            P+K F K+S+R   RCTKPDR+EF++I+I   +GF IMG IGF VKL+HIPI NII+
Sbjct:   48 PSKDFYKNSLRFYKRCTKPDRREFQRISIGIGVGFLIMGLIGFVVKLMHIPIVNIIM 104          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Zebrafish
Match: sec61g (SEC61 translocon gamma subunit [Source:ZFIN;Acc:ZDB-GENE-040718-203])

HSP 1 Score: 85.8853 bits (211), Expect = 4.094e-23
Identity = 59/67 (88.06%), Postives = 64/67 (95.52%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM F+EP++QF KDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Zebrafish
Match: sec61g (SEC61 translocon gamma subunit [Source:ZFIN;Acc:ZDB-GENE-040718-203])

HSP 1 Score: 85.8853 bits (211), Expect = 4.094e-23
Identity = 59/67 (88.06%), Postives = 64/67 (95.52%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM F+EP++QF KDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Xenopus
Match: ccnq (cyclin Q [Source:Xenbase;Acc:XB-GENE-5922806])

HSP 1 Score: 85.8853 bits (211), Expect = 5.345e-23
Identity = 59/67 (88.06%), Postives = 64/67 (95.52%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM F+EP++QF KDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Xenopus
Match: ccnq (cyclin Q [Source:Xenbase;Acc:XB-GENE-5922806])

HSP 1 Score: 83.1889 bits (204), Expect = 6.053e-22
Identity = 58/66 (87.88%), Postives = 63/66 (95.45%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIV 287
            MDQVM F+EP++QF KDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIV
Sbjct:    1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIV 66          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Mouse
Match: Sec61g (SEC61, gamma subunit [Source:MGI Symbol;Acc:MGI:1202066])

HSP 1 Score: 85.8853 bits (211), Expect = 4.418e-23
Identity = 59/67 (88.06%), Postives = 64/67 (95.52%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM F+EP++QF KDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Mouse
Match: Sec61g (SEC61, gamma subunit [Source:MGI Symbol;Acc:MGI:1202066])

HSP 1 Score: 85.8853 bits (211), Expect = 4.418e-23
Identity = 59/67 (88.06%), Postives = 64/67 (95.52%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM F+EP++QF KDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Mouse
Match: Sec61g (SEC61, gamma subunit [Source:MGI Symbol;Acc:MGI:1202066])

HSP 1 Score: 85.8853 bits (211), Expect = 4.418e-23
Identity = 59/67 (88.06%), Postives = 64/67 (95.52%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM F+EP++QF KDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Mouse
Match: Sec61g (SEC61, gamma subunit [Source:MGI Symbol;Acc:MGI:1202066])

HSP 1 Score: 85.8853 bits (211), Expect = 4.418e-23
Identity = 59/67 (88.06%), Postives = 64/67 (95.52%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM F+EP++QF KDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Mouse
Match: Sec61g (SEC61, gamma subunit [Source:MGI Symbol;Acc:MGI:1202066])

HSP 1 Score: 86.2705 bits (212), Expect = 6.857e-23
Identity = 59/67 (88.06%), Postives = 64/67 (95.52%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM F+EP++QF KDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:   33 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVG 99          
BLAST of Protein transport protein Sec61 subunit gamma vs. UniProt/SwissProt
Match: sp|Q8I7D9|SC61G_CIOIN (Protein transport protein Sec61 subunit gamma OS=Ciona intestinalis OX=7719 GN=SEC61G PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.318e-22
Identity = 60/67 (89.55%), Postives = 64/67 (95.52%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM ++EP KQFAKDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMAWVEPGKQFAKDSIRLVKRCTKPDRKEFQKIAVATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. UniProt/SwissProt
Match: sp|Q7T207|SC61G_HARAN (Protein transport protein Sec61 subunit gamma OS=Harpagifer antarcticus OX=43256 GN=sec61g PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.539e-22
Identity = 58/67 (86.57%), Postives = 64/67 (95.52%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM F+EP++QF KDSIRLV RCTKPDRKEF+K+A+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKVAMATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. UniProt/SwissProt
Match: sp|Q66KU2|SC61G_XENLA (Protein transport protein Sec61 subunit gamma OS=Xenopus laevis OX=8355 GN=sec61g PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.832e-22
Identity = 59/67 (88.06%), Postives = 64/67 (95.52%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM F+EP++QF KDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. UniProt/SwissProt
Match: sp|P60060|SC61G_MOUSE (Protein transport protein Sec61 subunit gamma OS=Mus musculus OX=10090 GN=Sec61g PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.090e-22
Identity = 59/67 (88.06%), Postives = 64/67 (95.52%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM F+EP++QF KDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. UniProt/SwissProt
Match: sp|P60059|SC61G_HUMAN (Protein transport protein Sec61 subunit gamma OS=Homo sapiens OX=9606 GN=SEC61G PE=1 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.090e-22
Identity = 59/67 (88.06%), Postives = 64/67 (95.52%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM F+EP++QF KDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. TrEMBL
Match: H2YIU5 (Uncharacterized protein OS=Ciona savignyi OX=51511 PE=3 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 6.301e-21
Identity = 61/67 (91.04%), Postives = 65/67 (97.01%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM ++EPAKQFAKDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMGWVEPAKQFAKDSIRLVKRCTKPDRKEFQKIAVATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. TrEMBL
Match: A0A4D5R9Y4 (Protein transport protein Sec61 subunit gamma OS=Scolopendra viridis OX=118503 PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 6.953e-21
Identity = 62/67 (92.54%), Postives = 64/67 (95.52%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM FIEP KQFAKDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMAFIEPGKQFAKDSIRLVKRCTKPDRKEFQKIAVATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. TrEMBL
Match: A0A5N5TA98 (Protein transport protein Sec61 subunit gamma OS=Armadillidium nasatum OX=96803 GN=SEC61G PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.008e-20
Identity = 58/67 (86.57%), Postives = 65/67 (97.01%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQ+M+F+EPAKQF+KDSIRLV RCTKPDRKEF+KI++ATAIGF IMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQIMSFVEPAKQFSKDSIRLVKRCTKPDRKEFQKISLATAIGFGIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. TrEMBL
Match: E9GJF6 (Uncharacterized protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_224750 PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 2.580e-20
Identity = 59/67 (88.06%), Postives = 64/67 (95.52%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM F+EP +QFAKDS+RLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMTFVEPGRQFAKDSLRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. TrEMBL
Match: A9QQA4 (Protein transport protein SEC61 subunit gamma OS=Lycosa singoriensis OX=434756 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 2.941e-20
Identity = 61/67 (91.04%), Postives = 65/67 (97.01%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            MDQVM+FIEP +QFAKDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MDQVMSFIEPDRQFAKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVG 67          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Cavefish
Match: sec61g (SEC61 translocon gamma subunit [Source:ZFIN;Acc:ZDB-GENE-040718-203])

HSP 1 Score: 83.1889 bits (204), Expect = 3.192e-22
Identity = 58/66 (87.88%), Postives = 62/66 (93.94%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIV 287
            MDQVM F+EP +QF KDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIV
Sbjct:    1 MDQVMQFVEPGRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIV 66          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007395.1 (pep scaffold:Pmarinus_7.0:GL478320:45202:47283:-1 gene:ENSPMAG00000006677.1 transcript:ENSPMAT00000007395.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 2.357e-21
Identity = 57/63 (90.48%), Postives = 60/63 (95.24%), Query Frame = 3
Query:  102 MNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVG 290
            M F+EP +QFAKDSIRLV RCTKPDRKEF+KIAIATAIGFAIMGFIGFFVKLIHIPINNIIVG
Sbjct:    1 MTFVEPGRQFAKDSIRLVKRCTKPDRKEFQKIAIATAIGFAIMGFIGFFVKLIHIPINNIIVG 63          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Yeast
Match: SSS1 (Subunit of the Sec61p translocation complex (Sec61p-Sss1p-Sbh1p); this complex forms a channel for passage of secretory proteins through the endoplasmic reticulum membrane, and of the Ssh1p complex (Ssh1p-Sbh2p-Sss1p); interacts with Ost4p and Wbp1p [Source:SGD;Acc:S000002493])

HSP 1 Score: 41.5874 bits (96), Expect = 1.041e-6
Identity = 28/65 (43.08%), Postives = 41/65 (63.08%), Query Frame = 3
Query:   93 DQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIV 287
            +QV   +E   +F ++  + + +C KPD KE+ KI  A  IGF  +G IG+ +KLIHIPI  +IV
Sbjct:   16 NQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKIVKAVGIGFIAVGIIGYAIKLIHIPIRYVIV 80          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Nematostella
Match: EDO42242 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S289])

HSP 1 Score: 79.7221 bits (195), Expect = 2.929e-21
Identity = 57/66 (86.36%), Postives = 63/66 (95.45%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIV 287
            MDQ++N +EP KQFAKDS+RLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIV
Sbjct:    1 MDQIVNTLEPCKQFAKDSMRLVKRCTKPDRKEFQKIALATAIGFAIMGFIGFFVKLIHIPINNIIV 66          
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Medaka
Match: sec61g (SEC61 translocon gamma subunit [Source:NCBI gene;Acc:110017315])

HSP 1 Score: 83.1889 bits (204), Expect = 3.578e-22
Identity = 58/66 (87.88%), Postives = 63/66 (95.45%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIV 287
            MDQVM F+EP++QF KDSIRLV RCTKPDRKEF+KIA+ATAIGFAIMGFIGFFVKLIHIPINNIIV
Sbjct:    1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIV 66          
BLAST of Protein transport protein Sec61 subunit gamma vs. Planmine SMEST
Match: SMESG000062123.1 (SMESG000062123.1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.468e-24
Identity = 67/68 (98.53%), Postives = 68/68 (100.00%), Query Frame = 3
Query:   90 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKXXXXXXXXXXXXXXXXXXVKLIHIPINNIIVGM 293
            MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKIAIATAIGFAIMGFIGFFVKLIHIPINNIIVG+
Sbjct:    1 MDQVMNFIEPAKQFAKDSIRLVNRCTKPDRKEFKKIAIATAIGFAIMGFIGFFVKLIHIPINNIIVGI 68          
The following BLAST results are available for this feature:
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SEC61G6.435e-2388.06SEC61 translocon gamma subunit [Source:HGNC Symbol... [more]
SEC61G6.435e-2388.06SEC61 translocon gamma subunit [Source:HGNC Symbol... [more]
SEC61G6.435e-2388.06SEC61 translocon gamma subunit [Source:HGNC Symbol... [more]
SEC61G6.435e-2388.06SEC61 translocon gamma subunit [Source:HGNC Symbol... [more]
back to top
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
emo-11.441e-2083.58Protein transport protein Sec61 subunit gamma [So... [more]
back to top
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG88605.448e-2185.07gene:FBgn0033691 transcript:FBtr0088011[more]
Sec61gamma1.169e-2083.58gene:FBgn0031049 transcript:FBtr0340610[more]
Sec61gamma1.169e-2083.58gene:FBgn0031049 transcript:FBtr0344986[more]
Sec61gamma1.169e-2083.58gene:FBgn0031049 transcript:FBtr0074745[more]
CG134262.233e-961.40gene:FBgn0034510 transcript:FBtr0086295[more]
back to top
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sec61g4.094e-2388.06SEC61 translocon gamma subunit [Source:ZFIN;Acc:ZD... [more]
sec61g4.094e-2388.06SEC61 translocon gamma subunit [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ccnq5.345e-2388.06cyclin Q [Source:Xenbase;Acc:XB-GENE-5922806][more]
ccnq6.053e-2287.88cyclin Q [Source:Xenbase;Acc:XB-GENE-5922806][more]
back to top
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sec61g4.418e-2388.06SEC61, gamma subunit [Source:MGI Symbol;Acc:MGI:12... [more]
Sec61g4.418e-2388.06SEC61, gamma subunit [Source:MGI Symbol;Acc:MGI:12... [more]
Sec61g4.418e-2388.06SEC61, gamma subunit [Source:MGI Symbol;Acc:MGI:12... [more]
Sec61g4.418e-2388.06SEC61, gamma subunit [Source:MGI Symbol;Acc:MGI:12... [more]
Sec61g6.857e-2388.06SEC61, gamma subunit [Source:MGI Symbol;Acc:MGI:12... [more]
back to top
BLAST of Protein transport protein Sec61 subunit gamma vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8I7D9|SC61G_CIOIN1.318e-2289.55Protein transport protein Sec61 subunit gamma OS=C... [more]
sp|Q7T207|SC61G_HARAN2.539e-2286.57Protein transport protein Sec61 subunit gamma OS=H... [more]
sp|Q66KU2|SC61G_XENLA2.832e-2288.06Protein transport protein Sec61 subunit gamma OS=X... [more]
sp|P60060|SC61G_MOUSE3.090e-2288.06Protein transport protein Sec61 subunit gamma OS=M... [more]
sp|P60059|SC61G_HUMAN3.090e-2288.06Protein transport protein Sec61 subunit gamma OS=H... [more]
back to top
BLAST of Protein transport protein Sec61 subunit gamma vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2YIU56.301e-2191.04Uncharacterized protein OS=Ciona savignyi OX=51511... [more]
A0A4D5R9Y46.953e-2192.54Protein transport protein Sec61 subunit gamma OS=S... [more]
A0A5N5TA981.008e-2086.57Protein transport protein Sec61 subunit gamma OS=A... [more]
E9GJF62.580e-2088.06Uncharacterized protein OS=Daphnia pulex OX=6669 G... [more]
A9QQA42.941e-2091.04Protein transport protein SEC61 subunit gamma OS=L... [more]
back to top
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sec61g3.192e-2287.88SEC61 translocon gamma subunit [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000007395.12.357e-2190.48pep scaffold:Pmarinus_7.0:GL478320:45202:47283:-1 ... [more]
back to top
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SSS11.041e-643.08Subunit of the Sec61p translocation complex (Sec61... [more]
back to top
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO422422.929e-2186.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein transport protein Sec61 subunit gamma vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sec61g3.578e-2287.88SEC61 translocon gamma subunit [Source:NCBI gene;A... [more]
back to top
BLAST of Protein transport protein Sec61 subunit gamma vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000062123.11.468e-2498.53SMESG000062123.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034546 ID=SMED30034546|Name=Protein transport protein Sec61 subunit gamma|organism=Schmidtea mediterranea sexual|type=transcript|length=357bp
AATTATTAAGGTAAAATAATTCCTATAAAATNCGATTTGTTTTATTTACT
AAATAGCAGAAGATAATTGCCACATAATTGATATTAGGTATGGATCAAGT
TATGAATTTTATTGAGCCTGCAAAGCAGTTTGCTAAAGATTCAATCCGTC
TTGTAAACAGATGTACTAAACCAGATCGAAAAGAATTTAAGAAAATTGCA
ATTGCCACTGCTATTGGATTTGCAATTATGGGATTTATTGGATTTTTTGT
CAAATTAATACACATACCAATAAACAATATAATTGTTGGCATGTAATAAT
CCATGATATGATCATTGTATTTACAAATATAGACATTAAATGATGGGAAA
AAAAAAA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000035Category 3 cell
PLANA:0000240body wall musculature
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR008158Translocase_Sec61-g
IPR023391Prot_translocase_SecE_dom_sf
IPR001901Translocase_SecE/Sec61-g
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
GO:0006605protein targeting
GO:0006810transport
GO:0015031protein transport
GO:0045047protein targeting to ER
GO:0071806protein transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0008565protein transporter activity
GO:0015450P-P-bond-hydrolysis-driven protein transmembrane transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008158Protein translocase SEC61 complex, gamma subunitTIGRFAMTIGR00327TIGR00327coord: 8..66
e-value: 3.4E-17
score: 60.0
IPR001901Protein translocase complex, SecE/Sec61-gamma subunitPFAMPF00584SecEcoord: 12..65
e-value: 5.3E-16
score: 58.3
IPR001901Protein translocase complex, SecE/Sec61-gamma subunitPROSITEPS01067SECE_SEC61Gcoord: 14..42
IPR023391Protein translocase SecE domain superfamilyGENE3DG3DSA:1.20.5.820coord: 7..67
e-value: 1.4E-36
score: 125.9
IPR023391Protein translocase SecE domain superfamilySUPERFAMILYSSF103456Preprotein translocase SecE subunitcoord: 7..65
NoneNo IPR availablePANTHERPTHR12309SEC61 GAMMA SUBUNITcoord: 1..67
NoneNo IPR availableTMHMMTMhelixcoord: 36..58