ATP-dependent Clp protease ATP-binding subunit clpX-like

Overview
NameATP-dependent Clp protease ATP-binding subunit clpX-like
Smed IDSMED30034536
Length (bp)2232
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent Clp protease ATP-binding subunit clpX-like (SMED30034536) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent Clp protease ATP-binding subunit clpX-like (SMED30034536) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034536

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30034536SMESG000032007.1 Contig3384_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Human
Match: CLPX (caseinolytic mitochondrial matrix peptidase chaperone subunit [Source:HGNC Symbol;Acc:HGNC:2088])

HSP 1 Score: 399.823 bits (1026), Expect = 2.239e-129
Identity = 246/555 (44.32%), Postives = 341/555 (61.44%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLID-----KDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVR 2022
            C KCG     +++  +  +++ C+KC + F ++      K II    +A    +V+ A  Q   P PK+I+ +LDK+V+GQ  AK++LSV VY+HY RI +N+   +++Q   ++ Q      S  P+  ++                     R  D     K      +    NA G         AS +   N     E+   E  +D  ++ + +L+KSNI++LGPTGSGKTLLAQTLAKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NYNV+K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+NILF+ASGAFNGL++II +RK+++  GF           +P++  K      + +    S   N+  D  E    KD LL+ VE RDLI +G+IPEFVGR P+V  LH+LDE  L+ ILT+P+NA+I Q++ LF++DKCEL +T+DAL+AIA  AL R+TGARGLRSI+E +LL P +EVP SDI+ V +  +V+     P  +R
Sbjct:  105 CPKCGDLCTHVETFVSSTRFVKCEKCHHFFVVLSEADSKKSIIKEPESAAE--AVKLAFQQKPPPPPKKIYNYLDKYVVGQSFAKKVLSVAVYNHYKRI-YNNIPANLRQQAEVEKQT-----SLTPRELEIR--------------------RREDEYRFTKLLQIAGISPHGNALG---------ASMQQQVNQQIPQEKRGGEV-LDSSHDDI-KLEKSNILLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKLLEGTIVNVPE-KNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGF----------GTPSNLGKGRRAAAAADLANRSGESNTHQDIEE----KDRLLRHVEARDLIEFGMIPEFVGRLPVVVPLHSLDEKTLVQILTEPRNAVIPQYQALFSMDKCELNVTEDALKAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDKEVVEGKKEPGYIR 604          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Human
Match: CLPX (caseinolytic mitochondrial matrix peptidase chaperone subunit [Source:HGNC Symbol;Acc:HGNC:2088])

HSP 1 Score: 58.5362 bits (140), Expect = 1.195e-8
Identity = 41/134 (30.60%), Postives = 74/134 (55.22%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLID-----KDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQ 759
            C KCG     +++  +  +++ C+KC + F ++      K II    +A    +V+ A  Q   P PK+I+ +LDK+V+GQ  AK++LSV VY+HY RI +N+   +++Q   ++ Q      S  P+  ++ +
Sbjct:  105 CPKCGDLCTHVETFVSSTRFVKCEKCHHFFVVLSEADSKKSIIKEPESA--AEAVKLAFQQKPPPPPKKIYNYLDKYVVGQSFAKKVLSVAVYNHYKRI-YNNIPANLRQQAEVEKQT-----SLTPRELEIRR 230          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Celegans
Match: D2030.2 (pep chromosome:WBcel235:I:7574195:7578563:1 gene:WBGene00008412.1 transcript:D2030.2a.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:D2030.2)

HSP 1 Score: 325.094 bits (832), Expect = 1.030e-101
Identity = 210/554 (37.91%), Postives = 305/554 (55.05%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYL-----FTLIDKDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFN--SKSKHVKQNNLIQFQNDGKIVST------VPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCK-TGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVI 1992
            C  C  PL+ + +     +Y+ CD C  L     F    K+ + +   A+  P           P P +I ++LDK V+GQ+KAK+ L+V VY HY R+  N  + +  + Q +  Q  + GK +S       +P+G      F +D      +  A+ E+R             NS+    + +       SP  +  TFR              + E   SV RL+KSN++++GP+G GKT L QTLA+ LDVP+A+CDCT++TQAGYVGED+ESVI KL Q +  NV+K Q+GIVFLDEVDKI     G   A RDV GEGVQ A+LKL+EG+VV +   K     + + + IDT++ILFIASGAF+ L+KI+ +R  K+  GF                        S N  I+  + NS     E  + +D+LL   +  DLIS+G++PE VGRFP++   H+ D+ ML+ ++T+P+N+L+ Q KL F +D  +L+ + +AL  +A  AL R+TGAR LRSILE  LL  ++ VPGSDI  V ++ + I
Sbjct:   75 CRHCSKPLKPLPTLTPSNRYIHCDSCNKLYFANYFEDSAKNGMFSKQFARKTP-----------PYPTQIAEYLDKFVVGQKKAKKTLAVGVYQHYRRLEHNIETGASSIYQTH-AQTSSSGKSLSNDGMDPKMPRGV-----FYQDELRLGQM--ASSELR-------------NSIMQQQSNNQPPSPAQSPRNAAPTFR-------------ALPEKEQSV-RLEKSNVLLVGPSGVGKTFLTQTLARVLDVPIALCDCTSMTQAGYVGEDVESVIQKLVQAAGGNVEKAQQGIVFLDEVDKIAAAHEGHSAAYRDVSGEGVQHALLKLVEGTVVNVKSGKKGMGSQQDQVQIDTTDILFIASGAFSNLDKIVGRRLDKKALGFGTS---------------------SGNVRISGDDSNS-----EVMRKRDELLSKADQGDLISFGMVPELVGRFPVLVPFHSFDKQMLVRVMTEPQNSLLAQLKLQFGIDNVDLSFSAEALEQVAQLALDRKTGARALRSILEAALLEAKFTVPGSDIESVHVSREAI 556          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Celegans
Match: D2030.2 (pep chromosome:WBcel235:I:7574276:7578564:1 gene:WBGene00008412.1 transcript:D2030.2a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:D2030.2)

HSP 1 Score: 325.094 bits (832), Expect = 1.030e-101
Identity = 210/554 (37.91%), Postives = 305/554 (55.05%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYL-----FTLIDKDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFN--SKSKHVKQNNLIQFQNDGKIVST------VPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCK-TGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVI 1992
            C  C  PL+ + +     +Y+ CD C  L     F    K+ + +   A+  P           P P +I ++LDK V+GQ+KAK+ L+V VY HY R+  N  + +  + Q +  Q  + GK +S       +P+G      F +D      +  A+ E+R             NS+    + +       SP  +  TFR              + E   SV RL+KSN++++GP+G GKT L QTLA+ LDVP+A+CDCT++TQAGYVGED+ESVI KL Q +  NV+K Q+GIVFLDEVDKI     G   A RDV GEGVQ A+LKL+EG+VV +   K     + + + IDT++ILFIASGAF+ L+KI+ +R  K+  GF                        S N  I+  + NS     E  + +D+LL   +  DLIS+G++PE VGRFP++   H+ D+ ML+ ++T+P+N+L+ Q KL F +D  +L+ + +AL  +A  AL R+TGAR LRSILE  LL  ++ VPGSDI  V ++ + I
Sbjct:   75 CRHCSKPLKPLPTLTPSNRYIHCDSCNKLYFANYFEDSAKNGMFSKQFARKTP-----------PYPTQIAEYLDKFVVGQKKAKKTLAVGVYQHYRRLEHNIETGASSIYQTH-AQTSSSGKSLSNDGMDPKMPRGV-----FYQDELRLGQM--ASSELR-------------NSIMQQQSNNQPPSPAQSPRNAAPTFR-------------ALPEKEQSV-RLEKSNVLLVGPSGVGKTFLTQTLARVLDVPIALCDCTSMTQAGYVGEDVESVIQKLVQAAGGNVEKAQQGIVFLDEVDKIAAAHEGHSAAYRDVSGEGVQHALLKLVEGTVVNVKSGKKGMGSQQDQVQIDTTDILFIASGAFSNLDKIVGRRLDKKALGFGTS---------------------SGNVRISGDDSNS-----EVMRKRDELLSKADQGDLISFGMVPELVGRFPVLVPFHSFDKQMLVRVMTEPQNSLLAQLKLQFGIDNVDLSFSAEALEQVAQLALDRKTGARALRSILEAALLEAKFTVPGSDIESVHVSREAI 556          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Celegans
Match: D2030.2 (pep chromosome:WBcel235:I:7574240:7578563:1 gene:WBGene00008412.1 transcript:D2030.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:D2030.2)

HSP 1 Score: 325.094 bits (832), Expect = 1.030e-101
Identity = 210/554 (37.91%), Postives = 305/554 (55.05%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYL-----FTLIDKDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFN--SKSKHVKQNNLIQFQNDGKIVST------VPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCK-TGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVI 1992
            C  C  PL+ + +     +Y+ CD C  L     F    K+ + +   A+  P           P P +I ++LDK V+GQ+KAK+ L+V VY HY R+  N  + +  + Q +  Q  + GK +S       +P+G      F +D      +  A+ E+R             NS+    + +       SP  +  TFR              + E   SV RL+KSN++++GP+G GKT L QTLA+ LDVP+A+CDCT++TQAGYVGED+ESVI KL Q +  NV+K Q+GIVFLDEVDKI     G   A RDV GEGVQ A+LKL+EG+VV +   K     + + + IDT++ILFIASGAF+ L+KI+ +R  K+  GF                        S N  I+  + NS     E  + +D+LL   +  DLIS+G++PE VGRFP++   H+ D+ ML+ ++T+P+N+L+ Q KL F +D  +L+ + +AL  +A  AL R+TGAR LRSILE  LL  ++ VPGSDI  V ++ + I
Sbjct:   75 CRHCSKPLKPLPTLTPSNRYIHCDSCNKLYFANYFEDSAKNGMFSKQFARKTP-----------PYPTQIAEYLDKFVVGQKKAKKTLAVGVYQHYRRLEHNIETGASSIYQTH-AQTSSSGKSLSNDGMDPKMPRGV-----FYQDELRLGQM--ASSELR-------------NSIMQQQSNNQPPSPAQSPRNAAPTFR-------------ALPEKEQSV-RLEKSNVLLVGPSGVGKTFLTQTLARVLDVPIALCDCTSMTQAGYVGEDVESVIQKLVQAAGGNVEKAQQGIVFLDEVDKIAAAHEGHSAAYRDVSGEGVQHALLKLVEGTVVNVKSGKKGMGSQQDQVQIDTTDILFIASGAFSNLDKIVGRRLDKKALGFGTS---------------------SGNVRISGDDSNS-----EVMRKRDELLSKADQGDLISFGMVPELVGRFPVLVPFHSFDKQMLVRVMTEPQNSLLAQLKLQFGIDNVDLSFSAEALEQVAQLALDRKTGARALRSILEAALLEAKFTVPGSDIESVHVSREAI 556          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Celegans
Match: D2030.2 (pep chromosome:WBcel235:I:7576363:7578563:1 gene:WBGene00008412.1 transcript:D2030.2b.4 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:D2030.2)

HSP 1 Score: 317.39 bits (812), Expect = 3.106e-100
Identity = 197/490 (40.20%), Postives = 283/490 (57.76%), Query Frame = 1
Query:  550 PTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFN--SKSKHVKQNNLIQFQNDGKIVST------VPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCK-TGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVI 1992
            P P +I ++LDK V+GQ+KAK+ L+V VY HY R+  N  + +  + Q +  Q  + GK +S       +P+G      F +D      +  A+ E+R             NS+    + +       SP  +  TFR        P KE          +RL+KSN++++GP+G GKT L QTLA+ LDVP+A+CDCT++TQAGYVGED+ESVI KL Q +  NV+K Q+GIVFLDEVDKI     G   A RDV GEGVQ A+LKL+EG+VV +   K     + + + IDT++ILFIASGAF+ L+KI+ +R  K+  GF                        S N  I+  + NS     E  + +D+LL   +  DLIS+G++PE VGRFP++   H+ D+ ML+ ++T+P+N+L+ Q KL F +D  +L+ + +AL  +A  AL R+TGAR LRSILE  LL  ++ VPGSDI  V ++ + I
Sbjct:   12 PYPTQIAEYLDKFVVGQKKAKKTLAVGVYQHYRRLEHNIETGASSIYQTH-AQTSSSGKSLSNDGMDPKMPRGV-----FYQDELRLGQM--ASSELR-------------NSIMQQQSNNQPPSPAQSPRNAAPTFRAL------PEKEQS--------VRLEKSNVLLVGPSGVGKTFLTQTLARVLDVPIALCDCTSMTQAGYVGEDVESVIQKLVQAAGGNVEKAQQGIVFLDEVDKIAAAHEGHSAAYRDVSGEGVQHALLKLVEGTVVNVKSGKKGMGSQQDQVQIDTTDILFIASGAFSNLDKIVGRRLDKKALGFGTS---------------------SGNVRISGDDSNS-----EVMRKRDELLSKADQGDLISFGMVPELVGRFPVLVPFHSFDKQMLVRVMTEPQNSLLAQLKLQFGIDNVDLSFSAEALEQVAQLALDRKTGARALRSILEAALLEAKFTVPGSDIESVHVSREAI 440          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Celegans
Match: D2030.2 (pep chromosome:WBcel235:I:7574274:7578563:1 gene:WBGene00008412.1 transcript:D2030.2b.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:D2030.2)

HSP 1 Score: 317.39 bits (812), Expect = 3.106e-100
Identity = 197/490 (40.20%), Postives = 283/490 (57.76%), Query Frame = 1
Query:  550 PTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFN--SKSKHVKQNNLIQFQNDGKIVST------VPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCK-TGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVI 1992
            P P +I ++LDK V+GQ+KAK+ L+V VY HY R+  N  + +  + Q +  Q  + GK +S       +P+G      F +D      +  A+ E+R             NS+    + +       SP  +  TFR        P KE          +RL+KSN++++GP+G GKT L QTLA+ LDVP+A+CDCT++TQAGYVGED+ESVI KL Q +  NV+K Q+GIVFLDEVDKI     G   A RDV GEGVQ A+LKL+EG+VV +   K     + + + IDT++ILFIASGAF+ L+KI+ +R  K+  GF                        S N  I+  + NS     E  + +D+LL   +  DLIS+G++PE VGRFP++   H+ D+ ML+ ++T+P+N+L+ Q KL F +D  +L+ + +AL  +A  AL R+TGAR LRSILE  LL  ++ VPGSDI  V ++ + I
Sbjct:   12 PYPTQIAEYLDKFVVGQKKAKKTLAVGVYQHYRRLEHNIETGASSIYQTH-AQTSSSGKSLSNDGMDPKMPRGV-----FYQDELRLGQM--ASSELR-------------NSIMQQQSNNQPPSPAQSPRNAAPTFRAL------PEKEQS--------VRLEKSNVLLVGPSGVGKTFLTQTLARVLDVPIALCDCTSMTQAGYVGEDVESVIQKLVQAAGGNVEKAQQGIVFLDEVDKIAAAHEGHSAAYRDVSGEGVQHALLKLVEGTVVNVKSGKKGMGSQQDQVQIDTTDILFIASGAFSNLDKIVGRRLDKKALGFGTS---------------------SGNVRISGDDSNS-----EVMRKRDELLSKADQGDLISFGMVPELVGRFPVLVPFHSFDKQMLVRVMTEPQNSLLAQLKLQFGIDNVDLSFSAEALEQVAQLALDRKTGARALRSILEAALLEAKFTVPGSDIESVHVSREAI 440          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Fly
Match: CG4538 (gene:FBgn0038745 transcript:FBtr0344261)

HSP 1 Score: 345.895 bits (886), Expect = 1.695e-108
Identity = 179/345 (51.88%), Postives = 242/345 (70.14%), Query Frame = 1
Query: 1006 LRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDN------KTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVR 2022
            ++L+KSNII+LGPTGSGKTL+AQT+AKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NYNV++ Q GIVFLDEVDKI    G  H +RDVGGEGVQQ MLK+LEG+VV +P+    R++R E + +DT+NILF+ASGA+ GL+++I +R +++  GF + +      +  +   SP D D++E                           +D  L  V+ RDL+ +G+IPEFVGRFP++   H+L+ +ML+ ILT+P+NAL+ Q+K L  LD+ +LT T+DA+++IA  A+ R TGARGLRSI+E +LL+P + VPGSDI  V ITAD +  ++ P   R
Sbjct:  323 VKLEKSNIIMLGPTGSGKTLIAQTIAKCLDVPFAICDCTTLTQAGYVGEDIESVISKLLQDANYNVERAQTGIVFLDEVDKIGAVPGI-HQLRDVGGEGVQQGMLKMLEGTVVNVPERNSPRKLRGETVQVDTTNILFVASGAYTGLDRLIARRLNEKYLGFGMPSTSGSGRRAAQSAASPMDNDQEE---------------------------RDKCLTKVQARDLVEFGMIPEFVGRFPVIVPFHSLNVSMLVRILTEPRNALVPQYKALLGLDEVDLTFTEDAVKSIAQLAMERHTGARGLRSIMEQLLLDPMFIVPGSDIRGVHITADYVKGSATPEYSR 639          

HSP 2 Score: 63.5438 bits (153), Expect = 5.438e-10
Identity = 35/116 (30.17%), Postives = 60/116 (51.72%), Query Frame = 1
Query:  364 YIPCTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQN 711
            ++ C KCG     +++  +  +++ C KC Y F ++ +  ++T    K  P  +           ++I ++LDKHV+GQ  AK++L+V VY+HY RI           +NL Q QN
Sbjct:  134 FLSCPKCGSACTQVETFVSSTRFVKCAKCNYFFVVLSE--VETKQRTKDEPKNQRKPPPPP----QKIMEYLDKHVVGQDFAKKVLAVAVYNHYKRI----------HHNLPQLQN 233          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Fly
Match: CG4538 (gene:FBgn0038745 transcript:FBtr0083855)

HSP 1 Score: 345.51 bits (885), Expect = 2.212e-108
Identity = 179/345 (51.88%), Postives = 242/345 (70.14%), Query Frame = 1
Query: 1006 LRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDN------KTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVR 2022
            ++L+KSNII+LGPTGSGKTL+AQT+AKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NYNV++ Q GIVFLDEVDKI    G  H +RDVGGEGVQQ MLK+LEG+VV +P+    R++R E + +DT+NILF+ASGA+ GL+++I +R +++  GF + +      +  +   SP D D++E                           +D  L  V+ RDL+ +G+IPEFVGRFP++   H+L+ +ML+ ILT+P+NAL+ Q+K L  LD+ +LT T+DA+++IA  A+ R TGARGLRSI+E +LL+P + VPGSDI  V ITAD +  ++ P   R
Sbjct:  323 VKLEKSNIIMLGPTGSGKTLIAQTIAKCLDVPFAICDCTTLTQAGYVGEDIESVISKLLQDANYNVERAQTGIVFLDEVDKIGAVPGI-HQLRDVGGEGVQQGMLKMLEGTVVNVPERNSPRKLRGETVQVDTTNILFVASGAYTGLDRLIARRLNEKYLGFGMPSTSGSGRRAAQSAASPMDNDQEE---------------------------RDKCLTKVQARDLVEFGMIPEFVGRFPVIVPFHSLNVSMLVRILTEPRNALVPQYKALLGLDEVDLTFTEDAVKSIAQLAMERHTGARGLRSIMEQLLLDPMFIVPGSDIRGVHITADYVKGSATPEYSR 639          

HSP 2 Score: 63.1586 bits (152), Expect = 5.844e-10
Identity = 35/116 (30.17%), Postives = 60/116 (51.72%), Query Frame = 1
Query:  364 YIPCTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQN 711
            ++ C KCG     +++  +  +++ C KC Y F ++ +  ++T    K  P  +           ++I ++LDKHV+GQ  AK++L+V VY+HY RI           +NL Q QN
Sbjct:  134 FLSCPKCGSACTQVETFVSSTRFVKCAKCNYFFVVLSE--VETKQRTKDEPKNQRKPPPPP----QKIMEYLDKHVVGQDFAKKVLAVAVYNHYKRI----------HHNLPQLQN 233          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Fly
Match: CG4538 (gene:FBgn0038745 transcript:FBtr0344262)

HSP 1 Score: 345.51 bits (885), Expect = 2.212e-108
Identity = 179/345 (51.88%), Postives = 242/345 (70.14%), Query Frame = 1
Query: 1006 LRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDN------KTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVR 2022
            ++L+KSNII+LGPTGSGKTL+AQT+AKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NYNV++ Q GIVFLDEVDKI    G  H +RDVGGEGVQQ MLK+LEG+VV +P+    R++R E + +DT+NILF+ASGA+ GL+++I +R +++  GF + +      +  +   SP D D++E                           +D  L  V+ RDL+ +G+IPEFVGRFP++   H+L+ +ML+ ILT+P+NAL+ Q+K L  LD+ +LT T+DA+++IA  A+ R TGARGLRSI+E +LL+P + VPGSDI  V ITAD +  ++ P   R
Sbjct:  323 VKLEKSNIIMLGPTGSGKTLIAQTIAKCLDVPFAICDCTTLTQAGYVGEDIESVISKLLQDANYNVERAQTGIVFLDEVDKIGAVPGI-HQLRDVGGEGVQQGMLKMLEGTVVNVPERNSPRKLRGETVQVDTTNILFVASGAYTGLDRLIARRLNEKYLGFGMPSTSGSGRRAAQSAASPMDNDQEE---------------------------RDKCLTKVQARDLVEFGMIPEFVGRFPVIVPFHSLNVSMLVRILTEPRNALVPQYKALLGLDEVDLTFTEDAVKSIAQLAMERHTGARGLRSIMEQLLLDPMFIVPGSDIRGVHITADYVKGSATPEYSR 639          

HSP 2 Score: 63.1586 bits (152), Expect = 5.844e-10
Identity = 35/116 (30.17%), Postives = 60/116 (51.72%), Query Frame = 1
Query:  364 YIPCTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQN 711
            ++ C KCG     +++  +  +++ C KC Y F ++ +  ++T    K  P  +           ++I ++LDKHV+GQ  AK++L+V VY+HY RI           +NL Q QN
Sbjct:  134 FLSCPKCGSACTQVETFVSSTRFVKCAKCNYFFVVLSE--VETKQRTKDEPKNQRKPPPPP----QKIMEYLDKHVVGQDFAKKVLAVAVYNHYKRI----------HHNLPQLQN 233          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Zebrafish
Match: clpxa (caseinolytic mitochondrial matrix peptidase chaperone subunit a [Source:ZFIN;Acc:ZDB-GENE-040912-143])

HSP 1 Score: 399.438 bits (1025), Expect = 1.523e-129
Identity = 242/540 (44.81%), Postives = 337/540 (62.41%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTLA---AKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDL-----EQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMD--EDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDI 1962
            C KCG P   +++  +  +++ C+KC + F ++ +     +L+     +  +V+ A  Q   P PK+I  +LDK+V+GQ  AK++LSV VY+HY RI  N  +   +Q   ++ Q      S  P+  +L     E  F+K   I   I P                 + N+LG S                         N + P ++ G +  +  ++ ++L+KSNI++LGPTGSGKTLLAQTLAKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NY ++K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+NILF+ASGAFNGL++II +RK+++  GF           +P++  K    + +  A++A+     E D   E + KD LLK VE RDLI +G+IPEFVGR P+V  LH+LDE  L+ ILT+P+NA++ Q++ LF++DKCEL +T DALRAIA  AL R+TGARGLRSI+E +LL+P +EVP SDI
Sbjct:   94 CPKCGDPCTHVETFVSSTRFVKCEKCHHFFVVLSETDTKKSLSKDPESAAEAVKLAFQQKPPPPPKKIFAYLDKYVVGQDHAKKVLSVAVYNHYKRIYNNMPAGSRQQQVEVEKQ-----ASLTPRELELRRREDEYRFTKLLQIAG-ISP-----------------HGNALGASMQ--------------------QQLNQQTPPEKRGGEVLDSTHTDIKLEKSNIVLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYVIEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKLLEGTIVNVPE-KNTRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGF----------GTPSNMGK--GRRAAAAADLAN-TTGGEVDAVAEIEEKDRLLKHVEARDLIEFGMIPEFVGRLPVVVPLHSLDEETLVRILTEPRNAVVPQYQALFSMDKCELNMTPDALRAIARLALERKTGARGLRSIMEKLLLDPMFEVPHSDI 575          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Zebrafish
Match: clpxb (caseinolytic mitochondrial matrix peptidase chaperone subunit b [Source:ZFIN;Acc:ZDB-GENE-130404-1])

HSP 1 Score: 398.282 bits (1022), Expect = 3.166e-129
Identity = 246/555 (44.32%), Postives = 342/555 (61.62%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTL--AAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSP--NASNKTFRNTSFNNEQPAKESG-MDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVR 2022
            C KCG P   +++  +  +++ C+KC + F ++ +      L    +S   V+ A  Q   P PK+I+ +LDK V+GQ  AK++LSV VY+HY RI           NNL                   +Q+ S+     + + P   E+R  +      ++ +  L         +   +SP  NA   + +  +    Q  K  G + +  ++ ++L+KSNI++LGPTGSGKTLLAQTLAKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NY+V+K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+NILF+ASGAFNGL++II +RK+++  GF           +P++  K      + +    S    +E D   E + KD LL+ VE RDLI +G+IPEFVGR P+V  LH+LDE ML+ ILT+P+NA++ Q++ LF++DKCEL +T DALRAIA  AL R+TGARGLRSI+E +LL P +EVP SDII V +  DV+     P  +R
Sbjct:   95 CPKCGDPCTHVETFVSSTRFVKCEKCHHFFVVLSETDSKKGLNKETESSEHVKFALAQKPPPPPKKIYAYLDKFVVGQSYAKKVLSVAVYNHYKRIY----------NNL--------------PAAGRQQAESEK---QSSLSPRELEIRRRE-----DEYRFTKL--------LQIAGISPHGNALGASVQQQTNQQAQQDKRGGDVLDSAHTDIKLEKSNIVLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYSVEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKLLEGTIVNVPE-KNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGF----------GTPSNLGKGRRAAAAADLANTS---GTEMDAMAEIEEKDRLLRIVEARDLIEFGMIPEFVGRLPVVVPLHSLDEEMLVQILTEPRNAVVPQYQALFSMDKCELNVTSDALRAIARLALERKTGARGLRSIMEKLLLEPMFEVPQSDIIAVELNKDVVQGKCEPRYIR 594          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Zebrafish
Match: clpxa (caseinolytic mitochondrial matrix peptidase chaperone subunit a [Source:ZFIN;Acc:ZDB-GENE-040912-143])

HSP 1 Score: 392.119 bits (1006), Expect = 7.226e-127
Identity = 237/535 (44.30%), Postives = 327/535 (61.12%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTLA---AKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMD--EDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDI 1962
            C KCG P   +++  +  +++ C+KC + F ++ +     +L+     +  +V+ A  Q   P PK+I  +LDK+V+GQ  AK++LSV VY+HY RI  N  +   +Q   ++ Q      S  P+  +L Q           I P                 + N+LG S                         N + P ++ G +  +  ++ ++L+KSNI++LGPTGSGKTLLAQTLAKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NY ++K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+NILF+ASGAFNGL++II +RK+++  GF   +   +  ++    D      G             E D   E + KD LLK VE RDLI +G+IPEFVGR P+V  LH+LDE  L+ ILT+P+NA++ Q++ LF++DKCEL +T DALRAIA  AL R+TGARGLRSI+E +LL+P +EVP SDI
Sbjct:   94 CPKCGDPCTHVETFVSSTRFVKCEKCHHFFVVLSETDTKKSLSKDPESAAEAVKLAFQQKPPPPPKKIFAYLDKYVVGQDHAKKVLSVAVYNHYKRIYNNMPAGSRQQQVEVEKQ-----ASLTPR--ELLQIAG--------ISP-----------------HGNALGASMQ--------------------QQLNQQTPPEKRGGEVLDSTHTDIKLEKSNIVLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYVIEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKLLEGTIVNVPE-KNTRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGFGTPSNMGKGRRAAAAADLANTTGG-------------EVDAVAEIEEKDRLLKHVEARDLIEFGMIPEFVGRLPVVVPLHSLDEETLVRILTEPRNAVVPQYQALFSMDKCELNMTPDALRAIARLALERKTGARGLRSIMEKLLLDPMFEVPHSDI 561          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Zebrafish
Match: spast (spastin [Source:NCBI gene;Acc:405851])

HSP 1 Score: 50.8322 bits (120), Expect = 5.905e-6
Identity = 33/100 (33.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query: 1006 LRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITC--KTGFYHAIRDVGGE 1299
            LR     +++ GP G+GKT+LA+ +A   +         TLT + YVGE  E ++  LF V+     + Q  I+F+DE+D + C  + G + A R +  E
Sbjct:  324 LRAPARGLLLFGPPGNGKTMLAKAVAMESNATFFNISAATLT-SKYVGEG-EKLVRALFAVAR----ELQPSIIFIDEIDSLLCERREGEHDASRRLKTE 417          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Xenopus
Match: clpx (caseinolytic mitochondrial matrix peptidase chaperone subunit [Source:NCBI gene;Acc:733875])

HSP 1 Score: 400.593 bits (1028), Expect = 3.199e-130
Identity = 245/557 (43.99%), Postives = 346/557 (62.12%), Query Frame = 1
Query:  367 IPCTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTLAAK---SVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSK-NAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVRK 2025
            + C KCG     +++  +  +++ C+KC + F ++ +     T++ +   +  +V+ A  Q   P PK+I+ +LDK+V+GQ  AK++LSV VY+HY RI +N+   +++Q   ++ Q      S  P+  ++                     R  D     K      +    NA G         AS +   N     E+   E  + + NN  ++L+KSNI++LGPTGSGKTLLAQTLAKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NYNV+K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+NILF+ASGAFNGL++II +RK+++  GF + +                  KG +  A     N +SE +  ++ + KD LL+ VE RDLI +G+IPEFVGR P+V  LH+LDE  L+ ILT+P+NA++ Q++ LF++DKCEL+I +DALRAIA  AL R+TGARGLRSI+E +LL P +EVP SDI+ V +  +V+     P  V+K
Sbjct:   69 LRCPKCGDLCTHVETFVSSTRFVKCEKCHHFFVVLSEADSKKTMSKEPETAAEAVKLAFQQKPPPPPKKIYNYLDKYVVGQSFAKKVLSVAVYNHYKRI-YNNIPTNLRQQAEVEKQ-----ASLTPRELEIR--------------------RREDEYRFTKLLQIAGISPHGNALG---------ASMQQQVNQQMPQERRGGE--VLDSNNDEIKLEKSNILLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKLLEGTIVNVPE-KNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGFGIASNL---------------GKGRRAAAAADLANASSESNVVQDIEEKDRLLRLVEARDLIEFGMIPEFVGRLPVVVPLHSLDEQTLVRILTEPRNAVVPQYQALFSMDKCELSINEDALRAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDQEVVEGKKDPRYVKK 571          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Xenopus
Match: clpx (caseinolytic mitochondrial matrix peptidase chaperone subunit [Source:NCBI gene;Acc:733875])

HSP 1 Score: 400.593 bits (1028), Expect = 4.519e-130
Identity = 245/557 (43.99%), Postives = 346/557 (62.12%), Query Frame = 1
Query:  367 IPCTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTLAAK---SVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSK-NAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVRK 2025
            + C KCG     +++  +  +++ C+KC + F ++ +     T++ +   +  +V+ A  Q   P PK+I+ +LDK+V+GQ  AK++LSV VY+HY RI +N+   +++Q   ++ Q      S  P+  ++                     R  D     K      +    NA G         AS +   N     E+   E  + + NN  ++L+KSNI++LGPTGSGKTLLAQTLAKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NYNV+K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+NILF+ASGAFNGL++II +RK+++  GF + +                  KG +  A     N +SE +  ++ + KD LL+ VE RDLI +G+IPEFVGR P+V  LH+LDE  L+ ILT+P+NA++ Q++ LF++DKCEL+I +DALRAIA  AL R+TGARGLRSI+E +LL P +EVP SDI+ V +  +V+     P  V+K
Sbjct:   87 LRCPKCGDLCTHVETFVSSTRFVKCEKCHHFFVVLSEADSKKTMSKEPETAAEAVKLAFQQKPPPPPKKIYNYLDKYVVGQSFAKKVLSVAVYNHYKRI-YNNIPTNLRQQAEVEKQ-----ASLTPRELEIR--------------------RREDEYRFTKLLQIAGISPHGNALG---------ASMQQQVNQQMPQERRGGE--VLDSNNDEIKLEKSNILLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKLLEGTIVNVPE-KNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGFGIASNL---------------GKGRRAAAAADLANASSESNVVQDIEEKDRLLRLVEARDLIEFGMIPEFVGRLPVVVPLHSLDEQTLVRILTEPRNAVVPQYQALFSMDKCELSINEDALRAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDQEVVEGKKDPRYVKK 589          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Xenopus
Match: clpx (caseinolytic mitochondrial matrix peptidase chaperone subunit [Source:NCBI gene;Acc:733875])

HSP 1 Score: 400.208 bits (1027), Expect = 5.393e-130
Identity = 245/557 (43.99%), Postives = 346/557 (62.12%), Query Frame = 1
Query:  367 IPCTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTLAAK---SVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSK-NAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVRK 2025
            + C KCG     +++  +  +++ C+KC + F ++ +     T++ +   +  +V+ A  Q   P PK+I+ +LDK+V+GQ  AK++LSV VY+HY RI +N+   +++Q   ++ Q      S  P+  ++                     R  D     K      +    NA G         AS +   N     E+   E  + + NN  ++L+KSNI++LGPTGSGKTLLAQTLAKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NYNV+K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+NILF+ASGAFNGL++II +RK+++  GF + +                  KG +  A     N +SE +  ++ + KD LL+ VE RDLI +G+IPEFVGR P+V  LH+LDE  L+ ILT+P+NA++ Q++ LF++DKCEL+I +DALRAIA  AL R+TGARGLRSI+E +LL P +EVP SDI+ V +  +V+     P  V+K
Sbjct:   80 LRCPKCGDLCTHVETFVSSTRFVKCEKCHHFFVVLSEADSKKTMSKEPETAAEAVKLAFQQKPPPPPKKIYNYLDKYVVGQSFAKKVLSVAVYNHYKRI-YNNIPTNLRQQAEVEKQ-----ASLTPRELEIR--------------------RREDEYRFTKLLQIAGISPHGNALG---------ASMQQQVNQQMPQERRGGE--VLDSNNDEIKLEKSNILLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKLLEGTIVNVPE-KNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGFGIASNL---------------GKGRRAAAAADLANASSESNVVQDIEEKDRLLRLVEARDLIEFGMIPEFVGRLPVVVPLHSLDEQTLVRILTEPRNAVVPQYQALFSMDKCELSINEDALRAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDQEVVEGKKDPRYVKK 582          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Xenopus
Match: clpx (caseinolytic mitochondrial matrix peptidase chaperone subunit [Source:NCBI gene;Acc:733875])

HSP 1 Score: 400.208 bits (1027), Expect = 6.770e-130
Identity = 245/557 (43.99%), Postives = 346/557 (62.12%), Query Frame = 1
Query:  367 IPCTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTLAAK---SVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSK-NAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVRK 2025
            + C KCG     +++  +  +++ C+KC + F ++ +     T++ +   +  +V+ A  Q   P PK+I+ +LDK+V+GQ  AK++LSV VY+HY RI +N+   +++Q   ++ Q      S  P+  ++                     R  D     K      +    NA G         AS +   N     E+   E  + + NN  ++L+KSNI++LGPTGSGKTLLAQTLAKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NYNV+K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+NILF+ASGAFNGL++II +RK+++  GF + +                  KG +  A     N +SE +  ++ + KD LL+ VE RDLI +G+IPEFVGR P+V  LH+LDE  L+ ILT+P+NA++ Q++ LF++DKCEL+I +DALRAIA  AL R+TGARGLRSI+E +LL P +EVP SDI+ V +  +V+     P  V+K
Sbjct:   88 LRCPKCGDLCTHVETFVSSTRFVKCEKCHHFFVVLSEADSKKTMSKEPETAAEAVKLAFQQKPPPPPKKIYNYLDKYVVGQSFAKKVLSVAVYNHYKRI-YNNIPTNLRQQAEVEKQ-----ASLTPRELEIR--------------------RREDEYRFTKLLQIAGISPHGNALG---------ASMQQQVNQQMPQERRGGE--VLDSNNDEIKLEKSNILLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKLLEGTIVNVPE-KNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGFGIASNL---------------GKGRRAAAAADLANASSESNVVQDIEEKDRLLRLVEARDLIEFGMIPEFVGRLPVVVPLHSLDEQTLVRILTEPRNAVVPQYQALFSMDKCELSINEDALRAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDQEVVEGKKDPRYVKK 590          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Xenopus
Match: clpx (caseinolytic mitochondrial matrix peptidase chaperone subunit [Source:NCBI gene;Acc:733875])

HSP 1 Score: 399.053 bits (1024), Expect = 2.602e-129
Identity = 244/556 (43.88%), Postives = 345/556 (62.05%), Query Frame = 1
Query:  367 IPCTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTLAAK---SVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSK-NAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVR 2022
            + C KCG     +++  +  +++ C+KC + F ++ +     T++ +   +  +V+ A  Q   P PK+I+ +LDK+V+GQ  AK++LSV VY+HY RI +N+   +++Q   ++ Q      S  P+  ++                     R  D     K      +    NA G         AS +   N     E+   E  + + NN  ++L+KSNI++LGPTGSGKTLLAQTLAKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NYNV+K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+NILF+ASGAFNGL++II +RK+++  GF + +                  KG +  A     N +SE +  ++ + KD LL+ VE RDLI +G+IPEFVGR P+V  LH+LDE  L+ ILT+P+NA++ Q++ LF++DKCEL+I +DALRAIA  AL R+TGARGLRSI+E +LL P +EVP SDI+ V +  +V+     P  V+
Sbjct:   94 LRCPKCGDLCTHVETFVSSTRFVKCEKCHHFFVVLSEADSKKTMSKEPETAAEAVKLAFQQKPPPPPKKIYNYLDKYVVGQSFAKKVLSVAVYNHYKRI-YNNIPTNLRQQAEVEKQ-----ASLTPRELEIR--------------------RREDEYRFTKLLQIAGISPHGNALG---------ASMQQQVNQQMPQERRGGE--VLDSNNDEIKLEKSNILLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKLLEGTIVNVPE-KNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGFGIASNL---------------GKGRRAAAAADLANASSESNVVQDIEEKDRLLRLVEARDLIEFGMIPEFVGRLPVVVPLHSLDEQTLVRILTEPRNAVVPQYQALFSMDKCELSINEDALRAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDQEVVEGKKDPRYVK 595          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Mouse
Match: Clpx (caseinolytic mitochondrial matrix peptidase chaperone subunit [Source:MGI Symbol;Acc:MGI:1346017])

HSP 1 Score: 398.282 bits (1022), Expect = 4.759e-129
Identity = 247/555 (44.50%), Postives = 336/555 (60.54%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLID-----KDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVR 2022
            C KCG     +++  +  +++ C+KC + F ++      K II    +A    +V+ A  Q   P PK+I+ +LDK+V+GQ  AK++LSV VY+HY RI  N  +      NL Q     K  S  P+  ++                     R  D     K      +    NA G         AS +   N     E+   E  +D   + + +L+KSNI++LGPTGSGKTLLAQTLAKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NYNV+K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+N+LF+ASGAFNGL++II +RK+++  GF           +P++  K      + +    S   N+  D  E    KD LL+ VE RDLI +G+IPEFVGR P+V  LH+LDE  L+ ILT+P+NA+I Q++ LF++DKCEL +T+DAL+AIA  AL R+TGARGLRSI+E +LL P +EVP SDI+ V +  +V+     P  +R
Sbjct:  106 CPKCGDLCTHVETFVSSTRFVKCEKCHHFFVVLSEADSKKSIIKEPESAAE--AVKLAFQQKPPPPPKKIYNYLDKYVVGQSFAKKVLSVAVYNHYKRIYNNIPA------NLRQQAEAEKQTSLTPRELEIR--------------------RREDEYRFTKLLQIAGISPHGNALG---------ASMQQQVNQQMPQEKRGGEV-LDSSQDDI-KLEKSNILLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKLLEGTIVNVPE-KNSRKLRGETVQVDTTNVLFVASGAFNGLDRIISRRKNEKYLGF----------GTPSNLGKGRRAAAAADLANRSGESNTHQDIEE----KDRLLRHVEARDLIEFGMIPEFVGRLPVVVPLHSLDEKTLVQILTEPRNAVIPQYQALFSMDKCELNVTEDALKAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDKEVVEGKKEPGYIR 605          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Mouse
Match: Clpx (caseinolytic mitochondrial matrix peptidase chaperone subunit [Source:MGI Symbol;Acc:MGI:1346017])

HSP 1 Score: 363.614 bits (932), Expect = 8.730e-116
Identity = 192/339 (56.64%), Postives = 250/339 (73.75%), Query Frame = 1
Query: 1006 LRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVR 2022
            ++L+KSNI++LGPTGSGKTLLAQTLAKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NYNV+K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+N+LF+ASGAFNGL++II +RK+++  GF           +P++  K      + +    S   N+  D  E    KD LL+ VE RDLI +G+IPEFVGR P+V  LH+LDE  L+ ILT+P+NA+I Q++ LF++DKCEL +T+DAL+AIA  AL R+TGARGLRSI+E +LL P +EVP SDI+ V +  +V+     P  +R
Sbjct:  269 IKLEKSNILLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKLLEGTIVNVPE-KNSRKLRGETVQVDTTNVLFVASGAFNGLDRIISRRKNEKYLGF----------GTPSNLGKGRRAAAAADLANRSGESNTHQDIEE----KDRLLRHVEARDLIEFGMIPEFVGRLPVVVPLHSLDEKTLVQILTEPRNAVIPQYQALFSMDKCELNVTEDALKAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDKEVVEGKKEPGYIR 591          

HSP 2 Score: 60.077 bits (144), Expect = 8.061e-9
Identity = 38/110 (34.55%), Postives = 65/110 (59.09%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLID-----KDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQ 687
            C KCG     +++  +  +++ C+KC + F ++      K II    +A    +V+ A  Q   P PK+I+ +LDK+V+GQ  AK++LSV VY+HY RI +N+   +++Q
Sbjct:  106 CPKCGDLCTHVETFVSSTRFVKCEKCHHFFVVLSEADSKKSIIKEPESAAE--AVKLAFQQKPPPPPKKIYNYLDKYVVGQSFAKKVLSVAVYNHYKRI-YNNIPANLRQ 212          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Mouse
Match: Clpx (caseinolytic mitochondrial matrix peptidase chaperone subunit [Source:MGI Symbol;Acc:MGI:1346017])

HSP 1 Score: 163.31 bits (412), Expect = 6.208e-46
Identity = 109/244 (44.67%), Postives = 137/244 (56.15%), Query Frame = 1
Query:  565 IHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGG 1296
            I+ +LDK+V+GQ  AK++LSV VY+            H K           +I + +P   +L Q              A K+   + R+L         +    NA G         AS +   N     E+   E  +D   + + +L+KSNI++LGPTGSGKTLLAQTLAKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NYNV+K Q+GIVFLDEVDKI    G  H +RDVGG
Sbjct:    1 IYNYLDKYVVGQSFAKKVLSVAVYN------------HYK-----------RIYNNIPA--NLRQQ-----------AEAEKQTSLTPREL----LQIAGISPHGNALG---------ASMQQQVNQQMPQEKRGGEV-LDSSQDDI-KLEKSNILLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGG 192          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. UniProt/SwissProt
Match: sp|O76031|CLPX_HUMAN (ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Homo sapiens OX=9606 GN=CLPX PE=1 SV=2)

HSP 1 Score: 399.823 bits (1026), Expect = 1.075e-128
Identity = 246/555 (44.32%), Postives = 341/555 (61.44%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLID-----KDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVR 2022
            C KCG     +++  +  +++ C+KC + F ++      K II    +A    +V+ A  Q   P PK+I+ +LDK+V+GQ  AK++LSV VY+HY RI +N+   +++Q   ++ Q      S  P+  ++                     R  D     K      +    NA G         AS +   N     E+   E  +D  ++ + +L+KSNI++LGPTGSGKTLLAQTLAKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NYNV+K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+NILF+ASGAFNGL++II +RK+++  GF           +P++  K      + +    S   N+  D  E    KD LL+ VE RDLI +G+IPEFVGR P+V  LH+LDE  L+ ILT+P+NA+I Q++ LF++DKCEL +T+DAL+AIA  AL R+TGARGLRSI+E +LL P +EVP SDI+ V +  +V+     P  +R
Sbjct:  105 CPKCGDLCTHVETFVSSTRFVKCEKCHHFFVVLSEADSKKSIIKEPESAAE--AVKLAFQQKPPPPPKKIYNYLDKYVVGQSFAKKVLSVAVYNHYKRI-YNNIPANLRQQAEVEKQT-----SLTPRELEIR--------------------RREDEYRFTKLLQIAGISPHGNALG---------ASMQQQVNQQIPQEKRGGEV-LDSSHDDI-KLEKSNILLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKLLEGTIVNVPE-KNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGF----------GTPSNLGKGRRAAAAADLANRSGESNTHQDIEE----KDRLLRHVEARDLIEFGMIPEFVGRLPVVVPLHSLDEKTLVQILTEPRNAVIPQYQALFSMDKCELNVTEDALKAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDKEVVEGKKEPGYIR 604          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. UniProt/SwissProt
Match: sp|Q5R7N3|CLPX_PONAB (ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Pongo abelii OX=9601 GN=CLPX PE=2 SV=1)

HSP 1 Score: 399.438 bits (1025), Expect = 1.331e-128
Identity = 246/555 (44.32%), Postives = 341/555 (61.44%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLID-----KDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVR 2022
            C KCG     +++  +  +++ C+KC + F ++      K II    +A    +V+ A  Q   P PK+I+ +LDK+V+GQ  AK++LSV VY+HY RI +N+   +++Q   ++ Q      S  P+  ++                     R  D     K      +    NA G         AS +   N     E+   E  +D  ++ + +L+KSNI++LGPTGSGKTLLAQTLAKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NYNV+K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+NILF+ASGAFNGL++II +RK+++  GF           +P++  K      + +    S   N+  D  E    KD LL+ VE RDLI +G+IPEFVGR P+V  LH+LDE  L+ ILT+P+NA+I Q++ LF++DKCEL +T+DAL+AIA  AL R+TGARGLRSI+E +LL P +EVP SDI+ V +  +V+     P  +R
Sbjct:  105 CPKCGDLCTHVETFVSSTRFVKCEKCHHFFVVLSEADSKKSIIKEPESAAE--AVKLAFQQKPPPPPKKIYNYLDKYVVGQSFAKKVLSVAVYNHYKRI-YNNIPANLRQQAEVEKQT-----SLTPRELEIR--------------------RREDEYRFTKLLQIAGISPHGNALG---------ASMQQQVNQQIPQEKRGGEV-LDSSHDDI-KLEKSNILLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKLLEGTIVNVPE-KNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGF----------GTPSNLGKGRRAAAAADLANRSGESNTHQDIEE----KDRLLRHVEARDLIEFGMIPEFVGRLPVVVPLHSLDEKTLVQILTEPRNAVIPQYQALFSMDKCELNVTEDALKAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDKEVVEGKKEPGYIR 604          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. UniProt/SwissProt
Match: sp|Q9JHS4|CLPX_MOUSE (ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Mus musculus OX=10090 GN=Clpx PE=1 SV=2)

HSP 1 Score: 398.282 bits (1022), Expect = 3.329e-128
Identity = 247/555 (44.50%), Postives = 336/555 (60.54%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLID-----KDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVR 2022
            C KCG     +++  +  +++ C+KC + F ++      K II    +A    +V+ A  Q   P PK+I+ +LDK+V+GQ  AK++LSV VY+HY RI  N  +      NL Q     K  S  P+  ++                     R  D     K      +    NA G         AS +   N     E+   E  +D   + + +L+KSNI++LGPTGSGKTLLAQTLAKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NYNV+K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+N+LF+ASGAFNGL++II +RK+++  GF           +P++  K      + +    S   N+  D  E    KD LL+ VE RDLI +G+IPEFVGR P+V  LH+LDE  L+ ILT+P+NA+I Q++ LF++DKCEL +T+DAL+AIA  AL R+TGARGLRSI+E +LL P +EVP SDI+ V +  +V+     P  +R
Sbjct:  106 CPKCGDLCTHVETFVSSTRFVKCEKCHHFFVVLSEADSKKSIIKEPESAAE--AVKLAFQQKPPPPPKKIYNYLDKYVVGQSFAKKVLSVAVYNHYKRIYNNIPA------NLRQQAEAEKQTSLTPRELEIR--------------------RREDEYRFTKLLQIAGISPHGNALG---------ASMQQQVNQQMPQEKRGGEV-LDSSQDDI-KLEKSNILLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKLLEGTIVNVPE-KNSRKLRGETVQVDTTNVLFVASGAFNGLDRIISRRKNEKYLGF----------GTPSNLGKGRRAAAAADLANRSGESNTHQDIEE----KDRLLRHVEARDLIEFGMIPEFVGRLPVVVPLHSLDEKTLVQILTEPRNAVIPQYQALFSMDKCELNVTEDALKAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDKEVVEGKKEPGYIR 605          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. UniProt/SwissProt
Match: sp|Q5U2U0|CLPX_RAT (ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Rattus norvegicus OX=10116 GN=Clpx PE=2 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 1.129e-127
Identity = 245/555 (44.14%), Postives = 341/555 (61.44%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLID-----KDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVR 2022
            C KCG     +++  +  +++ C+KC + F ++      K II    +A    +V+ A  Q   P PK+I+ +LDK+V+GQ  AK++LSV VY+HY RI +N+   +++Q   ++ Q      S  P+  ++                     R  D     K      +    NA G         AS +   +     E+   E  +D  ++ + +L+KSNI++LGPTGSGKTLLAQTLAKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NYNV+K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+NILF+ASGAFNGL++II +RK+++  GF           +P++  K      + +    S   N+  D  E    KD LL+ VE RDLI +G+IPEFVGR P+V  LH+LDE  L+ ILT+P+NA+I Q++ LF++DKCEL +T+DAL+AIA  AL R+TGARGLRSI+E +LL P +EVP SDI+ V +  +V+     P  +R
Sbjct:  105 CPKCGDLCTHVETFVSSTRFVKCEKCHHFFVVLSEADSKKSIIKEPESAAE--AVKLAFQQKPPPPPKKIYNYLDKYVVGQSFAKKVLSVAVYNHYKRI-YNNIPANLRQQAEVEKQT-----SLTPRELEIR--------------------RREDEYRFTKLLQIAGISPHGNALG---------ASMQQQGSQQMPQEKRGGEV-LDSPHDDI-KLEKSNILLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKLLEGTIVNVPE-KNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGF----------GTPSNLGKGRRAAAAADLANRSGESNTHQDIEE----KDRLLRHVEARDLIEFGMIPEFVGRLPVVVPLHSLDEKTLVQILTEPRNAVIPQYQALFSMDKCELNVTEDALKAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDKEVVEGKKEPGYIR 604          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. UniProt/SwissProt
Match: sp|A5WC69|CLPX_PSYWF (ATP-dependent Clp protease ATP-binding subunit ClpX OS=Psychrobacter sp. (strain PRwf-1) OX=349106 GN=clpX PE=3 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 1.862e-92
Identity = 164/340 (48.24%), Postives = 226/340 (66.47%), Query Frame = 1
Query:  994 NNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPG-SDIIEVRITADVINKNSLP 2010
            +++++ L KSNI+++GPTGSGKTLLAQTLA+ LDVP A+ D TTLT+AGYVGED+E+++ KL Q ++Y+V+K ++GI+++DE+DKI+ K       RDV GEGVQQA+LKL+EG+V  IP   G +    E I +DTSNIL I  GAF+GL+K+I+QR  K   GF                          NAE+      S+DD     K   +L K VE  DLI +GLIPE +GR P++  L  LDE  L+ ILT+PKNA++ Q++ LF ++  EL+ T+  L+AIAHKA+ R+TGARGLRSI+EN LL+  YE+P  SD  +V +  DVIN+ + P
Sbjct:  118 DDAMVELSKSNILLIGPTGSGKTLLAQTLARMLDVPFAMADATTLTEAGYVGEDVENIVQKLLQAADYDVEKAEQGIIYVDEIDKISKKGENMSITRDVSGEGVQQALLKLIEGTVAAIPPHGGRKHPNQELIQVDTSNILIIVGGAFSGLDKVIQQRTEKTGIGF--------------------------NAEV-----KSKDD----GKQLSELFKQVEPEDLIKFGLIPELIGRLPVIATLEELDEEALMQILTEPKNAIVKQYQYLFEMEDAELSFTEAGLKAIAHKAMERKTGARGLRSIVENALLDTMYELPSMSDAKQVVVDEDVINEGAAP 422          

HSP 2 Score: 56.9954 bits (136), Expect = 3.509e-7
Identity = 35/100 (35.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYLFT-LIDKDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSK 669
            C+ CG     +    A     +C++C  L T LI++  ++T     S        +   +PTPKEI + LD +VIGQ+ AK+ LSV VY+HY R+   +K
Sbjct:    9 CSFCGKKKDEVAQLIAADDANICNECVALCTDLIEEGDLNTV---DSEDGEVNTWLTKKLPTPKEIREHLDGYVIGQETAKKALSVAVYNHYKRLKVAAK 105          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. TrEMBL
Match: A0A4Z2DXT1 (ATP-dependent Clp protease ATP-binding subunit clpX-like isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_010512 PE=4 SV=1)

HSP 1 Score: 489.96 bits (1260), Expect = 2.540e-160
Identity = 282/592 (47.64%), Postives = 387/592 (65.37%), Query Frame = 1
Query:  364 YIPCTKCGGPLRTIK-STNAVFQYMVCDKCKYLFTLIDKDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFN----------------SKSKHVKQN----------NLIQFQNDGKIVSTVPKGFDLEQSFSKDY------YINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESG---MDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFN---YNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVR 2022
            YI C+KCGGPL+ I+ +T+ + ++M C+ C+ L+TLIDK  + T     +V   R   +    P PKEIH +LD+HVIGQ KAKQIL+VQVY+HY R+  N                S S   K N          +L +F   G    T P+  ++  S+  +       Y N   +P+  E+ +  R  S      NS  +S+ + GD     S +       +   N+++     G   + +D++ V++L+KSNI++LGPTGSGKTLLAQTLA+CLDVP AICDCTTLTQAGYVGEDIESVI KL Q +N+NV++ Q+GIVFLDEVDKI+ K G++H++RDVGGEGVQQ MLKLLEGS+V +PD K  R++R E + +DT+NILFIASGAFNGL+KII +RKHK+T GF VD  ++ K+ +       +    S + ++ +F     N E+   EEN  +D+LL++VE RDLI YG+IPEFVGRFPI+T LH+L++ ML+ ILT+P+NAL+ Q++LLF++D CEL +T DAL+AIA  AL +RTGARGLR+I+E++LL  RYEVPGSDI  V +T   +  +S P   R
Sbjct:  116 YIKCSKCGGPLKAIEPTTSYISRFMKCEACQQLYTLIDKSALKTF---SNVEENRPPPL----PIPKEIHSYLDRHVIGQDKAKQILAVQVYAHYNRLQHNRSMASSESSIFGGGMSSASNETKHNVNNHHSSGFASLSEF--SGTRSHTSPE--NMRPSYLPNLNNTPLNYQNGSTQPSVTELFNLLRKTS-----VNSSKNSSTSYGDSSGAGSLSFPFNMDNSQESNDDREKHRRGSRIIRDDSDHVVKLEKSNIVMLGPTGSGKTLLAQTLAQCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANFNVERAQQGIVFLDEVDKISTKAGYFHSVRDVGGEGVQQGMLKLLEGSIVNVPDGKSSRKLRGETVQVDTTNILFIASGAFNGLDKIIGRRKHKKTIGF-VDVASLNKSST------NDQLTSSASPDLTNFENLFQNFENSAHEENIERDNLLQEVEARDLIDYGIIPEFVGRFPIITVLHSLNDEMLVRILTEPRNALLKQYQLLFSIDGCELKVTPDALKAIARLALSQRTGARGLRAIMESLLLQARYEVPGSDISTVILTESAVLGHSSPEYYR 684          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. TrEMBL
Match: A0A068YCW1 (ATP dependent Clp Protease ATP binding subunit OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001010800 PE=4 SV=1)

HSP 1 Score: 477.248 bits (1227), Expect = 5.476e-156
Identity = 275/574 (47.91%), Postives = 361/574 (62.89%), Query Frame = 1
Query:  367 IPCTKCGGPLRTIK-STNAVFQYMVCDKCKYLFTLIDKDIIDTTL---AAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNS---LGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESG----------------MDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLV 2019
            I C+KCG PL  I+ ST+ + ++M C  C+ L+T IDK ++ + +   A  S P           P+PK+IH +LD++V+GQ  AK++LSVQVYSHY RI           +N +  + D    +T+ +G  L  + +    I  PI PA               F ++S   +G    A G   TEL    S+   R  S NN +PA ++G                 +   +  +RL+KSNII+LGPTGSGKTLLAQTLA+CLDVP AICDCTTLTQAGYVGEDIESVI KL Q +N+NV++ Q+GIVFLDEVDKI+ + G  H+IRDVGGEGVQQ MLK+LEGS+V++PD KG R+IR E + +DT+NILFIASGAF GL+K++ +RK K+  GF      V + Q+ T     ++        +A        D  EE    D LL  VE RDLI +G+IPEFVGRFPI+TA H L E+ML  ILT+P+NAL+ Q+KLLF +DKC LT+T+DALRAIA +A++ +TGARGLR+I+E VLL PRY+VPGS I EV I  DVI   + P  V
Sbjct:   80 ITCSKCGAPLHPIEPSTSHISRFMKCGSCQQLYTFIDKTVLKSFVKLDANASNPP----------PSPKQIHSYLDRYVVGQDHAKKVLSVQVYSHYNRI----------HHNRLNCEGDLTGSATLEQGAYLNSNPAVTDAIVRPISPAFTS------------FPFHSGKPVGRRIGASGPSVTELFHLLSDAGSRPGSTNNIRPA-DTGDPTQQAPETIAGSRRIYESHKSEPVRLEKSNIILLGPTGSGKTLLAQTLAQCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQNANFNVERAQQGIVFLDEVDKISSRAGLLHSIRDVGGEGVQQGMLKMLEGSLVSVPDGKGARKIRGESVLVDTTNILFIASGAFTGLDKLVARRKSKQRIGF----GDVGEEQTLTPTFSADSISAGAGTVVA--------DGDEEMLESDRLLAQVEARDLIEFGIIPEFVGRFPIITAFHALSEHMLTRILTEPRNALLLQYKLLFQIDKCTLTVTEDALRAIARQAMMMKTGARGLRAIMEKVLLQPRYDVPGSGISEVIIDEDVILSRTEPTYV 608          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. TrEMBL
Match: A0A0V0J568 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR116841 PE=4 SV=1)

HSP 1 Score: 473.396 bits (1217), Expect = 9.009e-154
Identity = 271/582 (46.56%), Postives = 363/582 (62.37%), Query Frame = 1
Query:  367 IPCTKCGGPLRTIK-STNAVFQYMVCDKCKYLFTLIDKDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKI-VSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLG--DSTNADGDKWTELSPNASNKTFRNTSF--------------NNEQPAKESGMDEDNNSVL---------RLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGF-EVDNKTVEKNQSP---TDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLV 2019
            I C+KCGGPLRTI+ ST+ + +++ C+ C+ L+T+ +K  + +     S+P           P PK+IH++L++HVIGQ+ AK+ILSVQVYSHY RI     S   + +   Q+     + +S+ P        F     I       +    SS          +  +G  D+TN    +   L   A     R  S               N+E     SG     + ++         +L+KSNII+LGPTGSGKTLLAQTLA+CLDVP AICDCTTLTQAGYVGEDIESVI KL Q +N++V++ Q+GIVFLDEVDKI+ + G  H+IRDVGGEGVQQ MLK+LEGS+V +PD+KG R++R E + +DT+NILFIASGAFNGL K+I +RK K+  GF E ++   E   +P   T P    ++   K         +  D  AEE +  D LL +VE  DLI +G+IPEFVGRFPI+TALH+LDE ML+ ILT+PKNAL++Q+K LF +DKCEL +T DALRAIA +A++ +TGARGLR+I+E +LL PRY+VPGS+I+ V I  DV+   S P  V
Sbjct:  116 ITCSKCGGPLRTIEPSTSHISRFLKCESCQQLYTVTEKSSLKSCSTTSSIPP----------PYPKQIHEYLNRHVIGQEHAKKILSVQVYSHYNRINHCGTSADAQGS---QYSTGATVDMSSSPSQSGPTLPFIPGMTIRPVTSHPSPGAPSSQTPRGPPPAPFPLVGKPDTTNPSVSELFRLLSGAGTAPGRPLSASSVYTPGSVPIAGGNSEDATPNSGGGNWGSRLIYNDGQLEPVKLEKSNIILLGPTGSGKTLLAQTLAQCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQNANFSVERAQQGIVFLDEVDKISSRAGLLHSIRDVGGEGVQQGMLKMLEGSIVNVPDAKGSRKLRGETVQVDTTNILFIASGAFNGLAKLIGRRKQKKRIGFLEEEDPGKETVGTPPQYTTP-APVSWLNVKTGSSGDSPVSRSDVSAEEMQEADRLLSEVEACDLIEFGIIPEFVGRFPIITALHSLDEGMLVRILTEPKNALLSQYKFLFRVDKCELNVTPDALRAIAQQAMITKTGARGLRAIMERILLQPRYDVPGSNIVSVIIDRDVVLGTSPPKYV 683          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. TrEMBL
Match: W6VBQ0 (ATP-dependent Clp protease ATP-binding subunit clpX-like protein OS=Echinococcus granulosus OX=6210 GN=EGR_00813 PE=4 SV=1)

HSP 1 Score: 470.7 bits (1210), Expect = 1.853e-153
Identity = 276/577 (47.83%), Postives = 364/577 (63.08%), Query Frame = 1
Query:  367 IPCTKCGGPLRTIK-STNAVFQYMVCDKCKYLFTLIDKDIIDTTL---AAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNS---LGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESG----------------MDEDNNSVLRLDKSNIIILGPTGSGK---TLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLV 2019
            I C+KCG PL  I+ ST+ + ++M C  C+ L+T IDK ++ + +   A  S P           P+PK+IH +LD++V+GQ  AK++LSVQVYSHY RI           +N +  + D    +T+ +G     + +    I  PI PA               F ++S   +G   +A G   TEL    S+   R  S NN +PA ++G                 +   +  +RL+KSNII+LGPTGSGK   TLLAQTLA+CLDVP AICDCTTLTQAGYVGEDIESVI KL Q +N+NV++ Q+GIVFLDEVDKI+ + G  H+IRDVGGEGVQQ MLK+LEGS+V++PD KG R+IR E + +DT+NILFIASGAF GL+K++ +RK K+  GF      VE+ Q+ T P    +  G+    +        +D  EE    D LL  VE RDLI +G+IPEFVGRFPI+TA H L E+ML  ILT+P+NAL+ Q+KLLF +DKC LT+T+DALRAIA +A++ +TGARGLR+I+E VLL PRY+VPGS I EV I  DVI   + P  V
Sbjct:   65 ITCSKCGAPLHPIEPSTSHISRFMKCGSCQQLYTFIDKTVLKSFVKLDANASNPP----------PSPKQIHSYLDRYVVGQDHAKKVLSVQVYSHYNRI----------HHNRLNCEGDLTGSATLEQGAYSNSNPAVTDAIVRPISPAFTS------------FPFHSGKPVGRRIDASGPSVTELFHLLSDAGSRPGSTNNIRPA-DTGDPTHQAPETIAGSRRIYESHKSEPVRLEKSNIILLGPTGSGKSWKTLLAQTLAQCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQNANFNVERAQQGIVFLDEVDKISSRAGLLHSIRDVGGEGVQQGMLKMLEGSLVSVPDGKGARKIRGESVLVDTTNILFIASGAFTGLDKLVARRKSKQRIGF----GDVEEEQTLT-PTFSADSIGAGAGTVV-------EDGDEEMLETDRLLAQVEARDLIEFGIIPEFVGRFPIITAFHALSEHMLTRILTEPRNALLLQYKLLFQIDKCTLTVTEDALRAIARQAMMMKTGARGLRAIMEKVLLQPRYDVPGSGISEVIIDEDVILGRTEPTYV 596          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. TrEMBL
Match: A0A068WBC1 (ATP dependent Clp Protease ATP binding subunit OS=Echinococcus granulosus OX=6210 GN=EgrG_001010800 PE=4 SV=1)

HSP 1 Score: 470.7 bits (1210), Expect = 2.086e-153
Identity = 276/577 (47.83%), Postives = 364/577 (63.08%), Query Frame = 1
Query:  367 IPCTKCGGPLRTIK-STNAVFQYMVCDKCKYLFTLIDKDIIDTTL---AAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNS---LGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESG----------------MDEDNNSVLRLDKSNIIILGPTGSGK---TLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLV 2019
            I C+KCG PL  I+ ST+ + ++M C  C+ L+T IDK ++ + +   A  S P           P+PK+IH +LD++V+GQ  AK++LSVQVYSHY RI           +N +  + D    +T+ +G     + +    I  PI PA               F ++S   +G   +A G   TEL    S+   R  S NN +PA ++G                 +   +  +RL+KSNII+LGPTGSGK   TLLAQTLA+CLDVP AICDCTTLTQAGYVGEDIESVI KL Q +N+NV++ Q+GIVFLDEVDKI+ + G  H+IRDVGGEGVQQ MLK+LEGS+V++PD KG R+IR E + +DT+NILFIASGAF GL+K++ +RK K+  GF      VE+ Q+ T P    +  G+    +        +D  EE    D LL  VE RDLI +G+IPEFVGRFPI+TA H L E+ML  ILT+P+NAL+ Q+KLLF +DKC LT+T+DALRAIA +A++ +TGARGLR+I+E VLL PRY+VPGS I EV I  DVI   + P  V
Sbjct:   80 ITCSKCGAPLHPIEPSTSHISRFMKCGSCQQLYTFIDKTVLKSFVKLDANASNPP----------PSPKQIHSYLDRYVVGQDHAKKVLSVQVYSHYNRI----------HHNRLNCEGDLTGSATLEQGAYSNSNPAVTDAIVRPISPAFTS------------FPFHSGKPVGRRIDASGPSVTELFHLLSDAGSRPGSTNNIRPA-DTGDPTHQAPETIAGSRRIYESHKSEPVRLEKSNIILLGPTGSGKSWKTLLAQTLAQCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQNANFNVERAQQGIVFLDEVDKISSRAGLLHSIRDVGGEGVQQGMLKMLEGSLVSVPDGKGARKIRGESVLVDTTNILFIASGAFTGLDKLVARRKSKQRIGF----GDVEEEQTLT-PTFSADSIGAGAGTVV-------EDGDEEMLETDRLLAQVEARDLIEFGIIPEFVGRFPIITAFHALSEHMLTRILTEPRNALLLQYKLLFQIDKCTLTVTEDALRAIARQAMMMKTGARGLRAIMEKVLLQPRYDVPGSGISEVIIDEDVILGRTEPTYV 611          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Cavefish
Match: clpxa (caseinolytic mitochondrial matrix peptidase chaperone subunit [Source:NCBI gene;Acc:103022826])

HSP 1 Score: 404.06 bits (1037), Expect = 1.846e-131
Identity = 243/549 (44.26%), Postives = 344/549 (62.66%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTLA---AKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLP 2010
            C KCG P   +++  +  +++ C+KC + F ++ +     +L+     +  +++ A  Q   P PK+I+ +LDK+V+GQ  AK++LSV VY+HY RI  N  +   +Q   ++ Q      S  P+  +L                     R  D     K      +    +A G         AS +   N     E+   E  + + N++ ++L+KSNI++LGPTGSGKTLLAQTLAKCLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NY ++K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+NILF+ASGAFNGL++II +RK+++  GF           +P++  K    + +  A++A+     E D   E + KD LLK VE RDLI +G+IPEFVGR P+V  LH+LDE+ L+ ILT+P+NA++ Q++ LF +DKC+LT+T DALRAIA  AL R+TGARGLRSI+E +LL+P +EVP SDI+ V I  +V++  + P
Sbjct:   94 CPKCGDPCTHVETFVSSTRFVKCEKCHHFFVVLSETDTKKSLSKDPESAAEAMKLAFQQKPPPPPKKIYAYLDKYVVGQAHAKKVLSVAVYNHYKRIYNNMPAGSRQQQVEVEKQG-----SLTPRELELR--------------------RREDEYRFTKLLQIAGISPHGSALG---------ASMQQQVNQQPPQERRGGE--VLDSNHTDIKLEKSNIVLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYVIEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKLLEGTIVNVPE-KNTRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGF----------GTPSNLGK--GRRAAAAADVANIT-GGEVDAVAEIEEKDRLLKLVEARDLIEFGMIPEFVGRLPVVVPLHSLDEDTLVRILTEPRNAVVPQYQALFGMDKCDLTVTPDALRAIARMALERKTGARGLRSIMEKLLLDPMFEVPHSDIVAVEINREVVHGKTEP 591          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Cavefish
Match: clpxb (ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial [Source:NCBI gene;Acc:103041261])

HSP 1 Score: 378.637 bits (971), Expect = 7.908e-122
Identity = 236/553 (42.68%), Postives = 332/553 (60.04%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTL---AAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVR 2022
            C KCG P   +++  +  +++ C+KC + F ++ +      L   A  +  +V+ A  Q   P PK+I+ +LDK+V+GQ            S+  ++L  +   H K           +I + +P G   +               A K+   + R+L         +    NA G         AS +         E+   E  + E  ++ ++L+KSNI++LGPTGSGKTLLAQTLA+CLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NY+V+K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+NILF+ASGAFNGL++II +RK+++  GF           +P++  K      + +   +S    SE D   E + KD LL+ VE RDLI +G+IPEFVGR P+V  LH+LDE  L+ ILT+P+NA++ Q++ LF++DKCEL +T DALRAIA  AL R+TGARGLRSI+E +LL P +EVP SDI+ V +  +V+   S P  +R
Sbjct:   98 CPKCGDPCTHVETFVSSTRFVKCEKCHHFFVVLSETDSKKGLNKEAESAAEAVKLAFAQKPPPPPKKIYAYLDKYVVGQ------------SYAKKVLAVAVYNHYK-----------RIYNNLPAGGRQQVE-------------AEKQSSLTPREL----LQIAGISPHGNALG---------ASVQQQAAQQAPQEKRGGE--VLESTHADIKLEKSNIVLLGPTGSGKTLLAQTLARCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYSVEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKLLEGTIVNVPE-KNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGF----------GTPSNLGKGRRAAAAADLANSS---GSEVDAVAEIEEKDRLLRHVEARDLIEFGMIPEFVGRLPVVVPLHSLDEETLVRILTEPRNAVVPQYQALFSMDKCELNVTPDALRAIARLALERKTGARGLRSIMEKLLLEPMFEVPHSDIMAVELNKEVVMGKSEPRYMR 584          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Cavefish
Match: ENSAMXT00000048847.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000032.1:2464534:2469574:1 gene:ENSAMXG00000032292.1 transcript:ENSAMXT00000048847.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.119 bits (479), Expect = 2.193e-53
Identity = 100/184 (54.35%), Postives = 128/184 (69.57%), Query Frame = 1
Query:  961 QPAKESGMDEDNNSVLR-------LDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGF 1491
            +PA  SGM+    + L+        ++S    L      K  L Q LAKCLDVP AICDCTTLTQAGYV EDIESVI KL Q +NY ++K QKGIVF DE DKI    G  H ++DVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+NILF+ASGAFNGL++II +RK+++  GF
Sbjct:  136 EPAASSGMERKRGAGLQPHRHENGEEQSCAAWLHQLW--KNFLVQILAKCLDVPFAICDCTTLTQAGYVREDIESVIDKLLQDANYVIEKAQKGIVFFDEEDKIGGMPGI-HKLKDVGGEGVQQGLLKLLEGTIVNVPE-KNTRKLRGEMVLVDTTNILFVASGAFNGLDRIISRRKNEKYLGF 315          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Cavefish
Match: ENSAMXT00000050837.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000032.1:2464546:2466583:1 gene:ENSAMXG00000032292.1 transcript:ENSAMXT00000050837.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 188.348 bits (477), Expect = 6.822e-53
Identity = 93/168 (55.36%), Postives = 125/168 (74.40%), Query Frame = 1
Query:  988 EDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGF 1491
            + N++ ++++KS +++LG T            KCLDVP AICDCTTLTQAGYV EDIESVI KL Q +NY ++K QKGIVF DE DKI    G  H ++DVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+NILF+ASGAFNGL++II +RK+++  GF
Sbjct:  153 DSNHTDMKMEKSKVVLLGST-----------TKCLDVPFAICDCTTLTQAGYVREDIESVIDKLLQDANYVIEKAQKGIVFFDEEDKIGGMPGI-HKLKDVGGEGVQQGLLKLLEGTIVNVPE-KNTRKLRGEMVLVDTTNILFVASGAFNGLDRIISRRKNEKYLGF 307          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Cavefish
Match: ENSAMXT00000032680.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000032.1:2464534:2467972:1 gene:ENSAMXG00000032292.1 transcript:ENSAMXT00000032680.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 188.348 bits (477), Expect = 7.513e-53
Identity = 93/168 (55.36%), Postives = 125/168 (74.40%), Query Frame = 1
Query:  988 EDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGF 1491
            + N++ ++++KS +++LG T            KCLDVP AICDCTTLTQAGYV EDIESVI KL Q +NY ++K QKGIVF DE DKI    G  H ++DVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+NILF+ASGAFNGL++II +RK+++  GF
Sbjct:  167 DSNHTDMKMEKSKVVLLGST-----------TKCLDVPFAICDCTTLTQAGYVREDIESVIDKLLQDANYVIEKAQKGIVFFDEEDKIGGMPGI-HKLKDVGGEGVQQGLLKLLEGTIVNVPE-KNTRKLRGEMVLVDTTNILFVASGAFNGLDRIISRRKNEKYLGF 321          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004069.1 (pep scaffold:Pmarinus_7.0:GL476538:342838:376733:-1 gene:ENSPMAG00000003708.1 transcript:ENSPMAT00000004069.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 398.667 bits (1023), Expect = 1.470e-129
Identity = 231/545 (42.39%), Postives = 322/545 (59.08%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYLF-TLIDKDIIDTTLAA-KSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEV---DNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVI 1992
            C KCG P   +++  +  +++ C+KC++ +  L D D      A+ +   + R +  Q   P PK+I +FLD HV+GQQ AK++LSV VY+HY R+           +NL       +         ++E     D+Y                            L + T +     +  +   +  T R  S           +D  + + + LDKSNI+++GPTG GKTLLAQTLA+CLDVP A+CDCT LTQAGYVGED+ESV+ KL Q + Y+VD+ Q+GIVFLDEVDKI    G  H +RDVGGEGVQQA+LK+LEG+VV +P+ K  RR+R E + +DT+NILF+ASGAFNGLEKI+  RK +++ GF +   D+       SP  P          +A  A        D   E   +D L++  E RDLI +G+IPEFVGRFP++  LH LD   L+ ILT+P+NALI Q++ LF++DKC+L + ++AL AIA  AL R+TGARGLRSI+EN+LL+  +EVP SDI+ VR+  DV+
Sbjct:  139 CPKCGDPCTLVETFVSSARFVKCEKCQHFYLVLTDPDWRRGLKASDEEEEAPRFSYTQRPPPPPKKISEFLDLHVVGQQHAKKVLSVAVYNHYKRV----------HSNLCSVSQQKQKQQDEASPAEVETGRQADFY------------------------KLTKLLEMTGSQKVASSPPTMGGAAGTVRRAS---------EALDRASAAGIHLDKSNILLIGPTGCGKTLLAQTLARCLDVPFAVCDCTGLTQAGYVGEDVESVVAKLLQDAEYSVDRAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQALLKMLEGTVVNVPE-KNSRRLRGETVQVDTTNILFMASGAFNGLEKIVSLRKDQKSLGFNLRSGDDGVHATLMSPRPP---------PSAASAVLLGGVASDALWEQHERDLLVRQAEARDLIEFGMIPEFVGRFPVLVPLHGLDTATLVRILTEPRNALIPQYRTLFSMDKCDLFVNEEALTAIARLALERKTGARGLRSIMENLLLDAMFEVPSSDIVAVRVDEDVV 629          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Sea Lamprey
Match: clpxb (caseinolytic mitochondrial matrix peptidase chaperone subunit b [Source:ZFIN;Acc:ZDB-GENE-130404-1])

HSP 1 Score: 231.876 bits (590), Expect = 5.557e-72
Identity = 109/158 (68.99%), Postives = 137/158 (86.71%), Query Frame = 1
Query: 1006 LRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKR 1479
            +RL+KSNI++LGPTGSGKTLLAQTLA+CLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NY+V+K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LK+LEG+VV +P+ +  R++R E + +DT+NILF+ASGAFNGL++II +RK+++
Sbjct:   39 IRLEKSNIVLLGPTGSGKTLLAQTLARCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYSVEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKMLEGTVVNVPE-RNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEK 194          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Sea Lamprey
Match: spast (spastin [Source:NCBI gene;Acc:405851])

HSP 1 Score: 50.0618 bits (118), Expect = 1.376e-6
Identity = 33/100 (33.00%), Postives = 52/100 (52.00%), Query Frame = 1
Query: 1006 LRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITC--KTGFYHAIRDVGGE 1299
            LR     +++ GP G+GKT+LA+ +A             +LT + YVGE  E ++  LF V+     + Q  I+F+DEVD + C  + G + A R +  E
Sbjct:  234 LRAPAKGLLLFGPPGNGKTMLAKAVASESSATFFNISAASLT-SKYVGEG-EKLVRALFSVAR----ELQPSIIFIDEVDSVLCERREGEHEASRRLKTE 327          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Yeast
Match: MCX1 (Non-proteolytic ATPase of the AAA family; stimulates incorporation of the pyridoxal phosphate cofactor into Hem1p (5-aminolevulinic acid synthase); localized to the mitochondrial matrix; ortholog of vertebrate CLPX, which promotes erythropoiesis [Source:SGD;Acc:S000000431])

HSP 1 Score: 245.743 bits (626), Expect = 3.056e-73
Identity = 180/493 (36.51%), Postives = 258/493 (52.33%), Query Frame = 1
Query:  544 NVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKH---VKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRR-----------IRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEV-RDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRI 1977
            N+PTPK + +FLD++++GQ+  K++LSV VY+HY RI  N K K     +Q  L++                                   +E  + DRD  +  F+ NS                   S   +RN         +E  +DED    L L KSN++++GP+GSGKTLLA TLAK L+VP+AI DCT LTQAGY+GED+E  I +L   + ++V + +KGI+ LDE+DK+  K       +DV GEGVQQ++LK++EG  V I   + V+             + E   +DTSNILF+  GAF GL+K I +R          D K ++K     +     N K  +      F +++  +  E +  K     D+    DL+S+GLIPE +GR PI+TAL  L  + L  IL +PKNAL+ Q++ +F      L +T  AL+ +A  AL   TGARGLR I+E +LLN  Y+ PGS+I  V I
Sbjct:   35 NIPTPKALKKFLDEYIVGQEIGKKVLSVAVYNHYLRI--NDKQKKGELQRQRELME-----------------------------------REKIADDRD--EPIFSGNS------------------ESKAGWRNLQRQFNLAGRE--VDED----LELSKSNVLVVGPSGSGKTLLATTLAKILNVPIAITDCTQLTQAGYIGEDVEVCIERLLVNAEFDVARAEKGIIVLDEIDKL-AKPAASIGTKDVSGEGVQQSLLKIIEGHKVEITVKRPVKHDIDGQKNQTTTKKDEVFVVDTSNILFMIMGAFVGLDKHIVKRIE--------DMKKIQKAGESVESS---NSKEVEKERAKKFRFSNTLEQVELDNGKKVCALDLTTPTDLVSFGLIPELIGRVPIITALQPLQRDDLFHILKEPKNALLDQYEYIFKQFGVRLCVTQKALKKVAQFALKEGTGARGLRGIMERLLLNVNYDCPGSNIAYVLI 452          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Nematostella
Match: EDO32411 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV57])

HSP 1 Score: 389.423 bits (999), Expect = 9.969e-128
Identity = 236/548 (43.07%), Postives = 336/548 (61.31%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLI-DKDI-----IDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINK 1998
            C KCG P   ++   +  +++ C+KC + F ++ D D       D+  +  + P       +   P P++I  +LD++VIGQ  AK++L+V VY+HY R+  N KS    QN             +VP                 PI P T+   ++ ++L        ++     A G +        S+ T R T       A    +D + +S+ RLDKSNI++LGPTGSGKTLLAQT+A+CLDVP AICDCT LTQAGYVGEDIESVI KL Q +  NV+K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LK+LEG+VV +P+ +  R++R + +++DTSNILF+ASGAFNGL+KII++RK  +  GF               P      K S ++ I  F+   + D  ++N  +D LL+ VE +DLI +G+IPEF+GR P+V +LH+LDE+ L+ ILT+P+N L+ Q++ LF +DK +L +  DAL+ IA +AL ++TGARGLR+ILEN+LL+P ++ PGSDI+ VRIT DV+ +
Sbjct:   13 CPKCGNPCSAVEGKFSSTRFVQCEKCSHFFLVLSDSDSKRHIRQDSKASLNNGPEKAAKTSRKPPPPPRKIFDYLDRYVIGQDYAKKVLAVAVYNHYKRLSVNIKSS--SQN-------------SVPAEV-------------KPI-PLTRPYPATPQELQLIMAQSQTINSPLGASGVQ--------SSSTVRET-------AGSEVLDAEQDSI-RLDKSNILLLGPTGSGKTLLAQTIARCLDVPFAICDCTALTQAGYVGEDIESVIAKLLQEAGGNVEKAQQGIVFLDEVDKIGAVPGV-HNLRDVGGEGVQQGLLKILEGTVVNVPE-RNSRKMRGDTVAVDTSNILFVASGAFNGLDKIIRRRKQDKVLGFGA-------------PAIHHLDKASHDSPIDIFSA-VKSDVRDDNAERDALLRSVEAKDLIDFGMIPEFIGRLPVVVSLHSLDEDTLVKILTEPRNVLVPQYQALFAMDKVDLQLESDALQLIAQQALEKKTGARGLRAILENLLLDPMFDAPGSDIVTVRITEDVVRR 499          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Medaka
Match: clpxb (caseinolytic mitochondrial matrix peptidase chaperone subunit [Source:NCBI gene;Acc:101173860])

HSP 1 Score: 403.29 bits (1035), Expect = 4.319e-131
Identity = 243/556 (43.71%), Postives = 339/556 (60.97%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTL---AAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSP--NASNKTFRNTSFNNEQPAKESGMDEDNNSV-LRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVR 2022
            C KCG P   +++  +  +++ C+KC + F ++ +      L   A  +  +V+ A  Q   P PK+I+ +LDK+V+GQ  AK++L+V VY+HY R                       I + +P G   +    K       + P   E+R  +      ++ +  L         +   +SP  NA   + +  +       K  G   D+    ++L+KSNII+LGPTGSGKTLLAQTLA+CLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NY+V+K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+NILF+ASGAFNGL++II +RK+++  GF           +P++  K      + +      N + E D   E + KD LLK VE RDLI +G+IPEFVGR P+V  LH+LDE+ L+ ILT+P+NA++ Q++ LF++DKCEL +T DALRAIA  AL R+TGARGLRSI+E +LL P +EVP SD+I V +  DV+   S P  +R
Sbjct:   96 CPKCGDPCTHVETFVSSTRFVKCEKCHHFFVVLSETDSKKGLNKEAESAAEAVKLAFAQKPPPPPKKIYAYLDKYVVGQSYAKKVLAVAVYNHYKR-----------------------IYNNIPAGNRQQVEVEK----QPSLTPRELEMRRRE-----DEYRFTKL--------LQIAGISPHGNALGASMQQQASQQAPQEKRGGEVLDSTHTDIKLEKSNIILLGPTGSGKTLLAQTLARCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYSVEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKLLEGTIVNVPE-KNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGF----------GTPSNMGKGRRAAAAADLA----NSSGETDTVAEIEEKDRLLKHVEARDLIEFGMIPEFVGRLPVVVPLHSLDEDTLVRILTEPRNAVVPQYQALFSMDKCELNVTQDALRAIARLALERKTGARGLRSIMEKLLLEPMFEVPQSDVIAVELDKDVVQGKSTPRYIR 595          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Medaka
Match: clpxb (caseinolytic mitochondrial matrix peptidase chaperone subunit [Source:NCBI gene;Acc:101173860])

HSP 1 Score: 403.29 bits (1035), Expect = 4.319e-131
Identity = 243/556 (43.71%), Postives = 339/556 (60.97%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTL---AAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSP--NASNKTFRNTSFNNEQPAKESGMDEDNNSV-LRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVR 2022
            C KCG P   +++  +  +++ C+KC + F ++ +      L   A  +  +V+ A  Q   P PK+I+ +LDK+V+GQ  AK++L+V VY+HY R                       I + +P G   +    K       + P   E+R  +      ++ +  L         +   +SP  NA   + +  +       K  G   D+    ++L+KSNII+LGPTGSGKTLLAQTLA+CLDVP AICDCTTLTQAGYVGEDIESVI KL Q +NY+V+K Q+GIVFLDEVDKI    G  H +RDVGGEGVQQ +LKLLEG++V +P+ K  R++R E + +DT+NILF+ASGAFNGL++II +RK+++  GF           +P++  K      + +      N + E D   E + KD LLK VE RDLI +G+IPEFVGR P+V  LH+LDE+ L+ ILT+P+NA++ Q++ LF++DKCEL +T DALRAIA  AL R+TGARGLRSI+E +LL P +EVP SD+I V +  DV+   S P  +R
Sbjct:   96 CPKCGDPCTHVETFVSSTRFVKCEKCHHFFVVLSETDSKKGLNKEAESAAEAVKLAFAQKPPPPPKKIYAYLDKYVVGQSYAKKVLAVAVYNHYKR-----------------------IYNNIPAGNRQQVEVEK----QPSLTPRELEMRRRE-----DEYRFTKL--------LQIAGISPHGNALGASMQQQASQQAPQEKRGGEVLDSTHTDIKLEKSNIILLGPTGSGKTLLAQTLARCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYSVEKAQQGIVFLDEVDKIGSVPGI-HQLRDVGGEGVQQGLLKLLEGTIVNVPE-KNSRKLRGETVQVDTTNILFVASGAFNGLDRIISRRKNEKYLGF----------GTPSNMGKGRRAAAAADLA----NSSGETDTVAEIEEKDRLLKHVEARDLIEFGMIPEFVGRLPVVVPLHSLDEDTLVRILTEPRNAVVPQYQALFSMDKCELNVTQDALRAIARLALERKTGARGLRSIMEKLLLEPMFEVPQSDVIAVELDKDVVQGKSTPRYIR 595          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Planmine SMEST
Match: SMESG000032007.1 (SMESG000032007.1)

HSP 1 Score: 1293.49 bits (3346), Expect = 0.000e+0
Identity = 659/659 (100.00%), Postives = 659/659 (100.00%), Query Frame = 1
Query:   82 MSIRLAGSTLRNCLKQLNLSYSQISKLKQQLDGKNQKFNNENKTMKVDIDKGNFIKFRKSFLTLKKEESHTLSQFQDCDMDTTXXXXXXXXXXXYIPCTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVRKIGSTGEIKTET 2058
            MSIRLAGSTLRNCLKQLNLSYSQISKLKQQLDGKNQKFNNENKTMKVDIDKGNFIKFRKSFLTLKKEESHTLSQFQDCDMDTTNKSSNSGSNGGYIPCTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKALLRRTGARGLRSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVRKIGSTGEIKTET
Sbjct:    1 MSIRLAGSTLRNCLKQLNLSYSQISKLKQQLDGKNQKFNNENKTMKVDIDKGNFIKFRKSFLTLKKEESHTLSQFQDCDMDTTNKSSNSGSNGGYIPCTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKALLRRTGARGLRSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVRKIGSTGEIKTET 659          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Planmine SMEST
Match: SMESG000077859.1 (SMESG000077859.1)

HSP 1 Score: 388.652 bits (997), Expect = 5.077e-126
Identity = 239/551 (43.38%), Postives = 324/551 (58.80%), Query Frame = 1
Query:  373 CTKCGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVRK 2025
            C KCG  LR I ++    Q  +CD C +   + +         ++   + RT      +PTP EIH+ LDK+VIGQ++AK+ILSVQ  SHY RI          +  L   Q +    S + K      ++ KD                   D       Y ++ +S N          P   +  F N    N++    +  +   N+ ++L+KSNII+ GPTG+GKTLLA+TLA  LD P AICDCT+LT  GYVG+D+ESV+GKL   +++NV++ Q+GI+FLDEVDKI  K+    + RDVGGEGVQQA LK+LEGS V +PDSK  R+ R E + +DTSNILFIASGAFNG+EKIIK+RK K T GF V                     G KN E   F     +    E + +D+LLK++E +DL+ +G IPEF+GRFP++ +LH+L+E+ L+ IL +PKNA+I+QFK LFNLD+C+L +T+D LRAI   AL +R GARGLRSILE +L + RYE+P SDI  V I AD + K   PV V +
Sbjct:   98 CPKCGESLR-INNSLPFDQGTICDYCGFTGKMNETSKSSNQFESQEATTTRT------LPTPSEIHRHLDKYVIGQERAKRILSVQCRSHYQRI----------ERFLAMNQTNSSDHSELFKVNRHNYAYKKD-------------------DTDSNALIYPNVINSANPFTSHTLPNYPKIESTKFYN---QNQESRTVNRFNTVVNNDIKLEKSNIILAGPTGTGKTLLAKTLADSLDKPFAICDCTSLTSTGYVGDDVESVVGKLLANADHNVERAQQGIIFLDEVDKICKKSLSGTSCRDVGGEGVQQAFLKMLEGSSVGVPDSKVARKTRMEIVQVDTSNILFIASGAFNGIEKIIKKRKQKDTIGFTV---------------------GLKNGEENRFESKVNNAVKNECEERDELLKEIESKDLVEFGFIPEFIGRFPVIVSLHSLNEDTLMRILVEPKNAIISQFKCLFNLDQCDLHLTEDGLRAICKLALEKRVGARGLRSILEEILTDIRYELPDSDICNVTINADAVYKKG-PVEVTR 587          
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Planmine SMEST
Match: SMESG000074422.1 (SMESG000074422.1)

HSP 1 Score: 354.369 bits (908), Expect = 9.422e-113
Identity = 240/566 (42.40%), Postives = 317/566 (56.01%), Query Frame = 1
Query:  367 IPCTKCGGPLRTIKSTNAVFQ---YMVCDKCKYLFTLIDKDIIDTTLAAKSVPSVRTAEIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHVKQNNL-------IQFQNDGKIV--STVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDRDLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESGMDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLTQAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAIRDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASGAFNGLEKIIKQRKHKRTTGFEVDNKTVEK-NQSPTDPDKKENFKGSKNAEIASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALHNLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKXXXXXXXXXXXXSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVRK 2025
            + C  CGGP   IK+ N V Q   Y  C  C Y++ +   +I D +          +      VP+PK IHQ+LD+ VIGQ+ AK+ILSVQVYSHY RI +N KS    +  L       +QF +  KI+  S + KG +   +      I NP       V  S    S K      L      +G  +++    ASNK                         L+L+KSNII+LG +GSGKTLLAQTLAKCLDVPLAI DCTTLT  G+ GED+ SV+ KLF  +N NV++ Q+GI+ LDEVDKI  K  F  +  D+GGE VQQ +LK++EGSVV IPD K    I    + +DT+NILFIASGAFNG++KII++R  KR+ G    +  +E+ NQ   D                                 D +L  +E +D+I +G +PEFVGRFPI+TAL N DENML  IL +P+N+++  F+    LD+C L ITDDALR IA  A+  + GARGL+SILE++L + RYE+PGSDI  V IT + +NK   PV V +
Sbjct:   98 LKCLICGGP---IKAFNLVIQNNNYFECKACGYIYQV--NEITDNSTKQSKFSKANSIN---RVPSPKTIHQYLDRDVIGQEHAKKILSVQVYSHYLRINYNFKSNFTDKFELAGENYSALQF-DTSKIIFKSNISKGNNECGNSMAFPLIGNP--KVYSNVPPSSIPFSQK------LTTDNEKNGKVFSKRHLTASNK-------------------------LKLEKSNIILLGASGSGKTLLAQTLAKCLDVPLAIFDCTTLTATGFFGEDVVSVVEKLFVEANCNVERAQQGIIVLDEVDKIN-KKYFLKSHLDIGGEEVQQGLLKIIEGSVVAIPDGK----IFGNVVEVDTTNILFIASGAFNGIDKIIEKRYLKRSLGL---SDCIERDNQDKID--------------------------------TDSILMKIEAKDIIDFGFLPEFVGRFPIITALKNPDENMLRKILVEPRNSVVKIFQYFLGLDQCNLEITDDALREIAKLAVSTKVGARGLKSILEDLLKDVRYEIPGSDICCVVITKNSVNKKE-PVQVTR 580          
The following BLAST results are available for this feature:
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CLPX2.239e-12944.32caseinolytic mitochondrial matrix peptidase chaper... [more]
CLPX1.195e-830.60caseinolytic mitochondrial matrix peptidase chaper... [more]
back to top
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
D2030.21.030e-10137.91pep chromosome:WBcel235:I:7574195:7578563:1 gene:W... [more]
D2030.21.030e-10137.91pep chromosome:WBcel235:I:7574276:7578564:1 gene:W... [more]
D2030.21.030e-10137.91pep chromosome:WBcel235:I:7574240:7578563:1 gene:W... [more]
D2030.23.106e-10040.20pep chromosome:WBcel235:I:7576363:7578563:1 gene:W... [more]
D2030.23.106e-10040.20pep chromosome:WBcel235:I:7574274:7578563:1 gene:W... [more]
back to top
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG45381.695e-10851.88gene:FBgn0038745 transcript:FBtr0344261[more]
CG45382.212e-10851.88gene:FBgn0038745 transcript:FBtr0083855[more]
CG45382.212e-10851.88gene:FBgn0038745 transcript:FBtr0344262[more]
back to top
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
clpxa1.523e-12944.81caseinolytic mitochondrial matrix peptidase chaper... [more]
clpxb3.166e-12944.32caseinolytic mitochondrial matrix peptidase chaper... [more]
clpxa7.226e-12744.30caseinolytic mitochondrial matrix peptidase chaper... [more]
spast5.905e-633.00spastin [Source:NCBI gene;Acc:405851][more]
back to top
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clpx3.199e-13043.99caseinolytic mitochondrial matrix peptidase chaper... [more]
clpx4.519e-13043.99caseinolytic mitochondrial matrix peptidase chaper... [more]
clpx5.393e-13043.99caseinolytic mitochondrial matrix peptidase chaper... [more]
clpx6.770e-13043.99caseinolytic mitochondrial matrix peptidase chaper... [more]
clpx2.602e-12943.88caseinolytic mitochondrial matrix peptidase chaper... [more]
back to top
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Clpx4.759e-12944.50caseinolytic mitochondrial matrix peptidase chaper... [more]
Clpx8.730e-11656.64caseinolytic mitochondrial matrix peptidase chaper... [more]
Clpx6.208e-4644.67caseinolytic mitochondrial matrix peptidase chaper... [more]
back to top
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O76031|CLPX_HUMAN1.075e-12844.32ATP-dependent Clp protease ATP-binding subunit clp... [more]
sp|Q5R7N3|CLPX_PONAB1.331e-12844.32ATP-dependent Clp protease ATP-binding subunit clp... [more]
sp|Q9JHS4|CLPX_MOUSE3.329e-12844.50ATP-dependent Clp protease ATP-binding subunit clp... [more]
sp|Q5U2U0|CLPX_RAT1.129e-12744.14ATP-dependent Clp protease ATP-binding subunit clp... [more]
sp|A5WC69|CLPX_PSYWF1.862e-9248.24ATP-dependent Clp protease ATP-binding subunit Clp... [more]
back to top
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DXT12.540e-16047.64ATP-dependent Clp protease ATP-binding subunit clp... [more]
A0A068YCW15.476e-15647.91ATP dependent Clp Protease ATP binding subunit OS=... [more]
A0A0V0J5689.009e-15446.56Uncharacterized protein OS=Schistocephalus solidus... [more]
W6VBQ01.853e-15347.83ATP-dependent Clp protease ATP-binding subunit clp... [more]
A0A068WBC12.086e-15347.83ATP dependent Clp Protease ATP binding subunit OS=... [more]
back to top
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clpxa1.846e-13144.26caseinolytic mitochondrial matrix peptidase chaper... [more]
clpxb7.908e-12242.68ATP-dependent Clp protease ATP-binding subunit clp... [more]
ENSAMXT00000048847.12.193e-5354.35pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050837.16.822e-5355.36pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000032680.17.513e-5355.36pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000004069.11.470e-12942.39pep scaffold:Pmarinus_7.0:GL476538:342838:376733:-... [more]
clpxb5.557e-7268.99caseinolytic mitochondrial matrix peptidase chaper... [more]
spast1.376e-633.00spastin [Source:NCBI gene;Acc:405851][more]
back to top
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MCX13.056e-7336.51Non-proteolytic ATPase of the AAA family; stimulat... [more]
back to top
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO324119.969e-12843.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
clpxb4.319e-13143.71caseinolytic mitochondrial matrix peptidase chaper... [more]
clpxb4.319e-13143.71caseinolytic mitochondrial matrix peptidase chaper... [more]
back to top
BLAST of ATP-dependent Clp protease ATP-binding subunit clpX-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000032007.10.000e+0100.00SMESG000032007.1[more]
SMESG000077859.15.077e-12643.38SMESG000077859.1[more]
SMESG000074422.19.422e-11342.40SMESG000074422.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034536 ID=SMED30034536|Name=ATP-dependent Clp protease ATP-binding subunit clpX-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2232bp
TTTGAAAATATTTCAAATAACTATAATTTATATAATCATAATATATAGTG
GTAATCAATGAATTATTAATACATTCATAAAATGAGTATCAGATTAGCAG
GTTCGACGCTCAGAAATTGTCTCAAACAACTGAATCTATCATACAGCCAA
ATTTCAAAACTTAAACAACAATTAGATGGGAAAAACCAAAAATTCAACAA
TGAAAATAAGACAATGAAAGTTGATATTGATAAAGGAAATTTTATAAAAT
TCCGAAAGTCATTTCTCACTCTAAAGAAAGAAGAAAGCCACACTTTATCT
CAATTCCAAGACTGTGACATGGATACGACGAATAAAAGTTCCAACTCCGG
GAGCAATGGAGGATATATTCCTTGTACAAAATGTGGTGGTCCTTTGAGAA
CAATTAAATCAACGAATGCAGTATTCCAATATATGGTCTGTGACAAATGC
AAATATTTGTTTACTCTAATTGACAAGGATATTATTGATACAACTCTTGC
CGCCAAAAGTGTCCCTTCTGTTAGAACTGCTGAAATACAATTTAATGTTC
CGACCCCTAAAGAAATCCATCAATTCCTTGATAAACATGTCATTGGGCAG
CAAAAGGCGAAACAGATCCTTTCGGTTCAGGTCTATTCGCATTACACGAG
GATTTTGTTCAACTCGAAATCCAAGCATGTTAAACAGAATAACTTAATTC
AGTTTCAAAATGACGGAAAAATTGTTTCTACGGTTCCTAAAGGATTTGAT
TTAGAACAGTCATTTTCAAAAGACTATTATATTAACAATCCAATCAAACC
GGCCACGAAAGAAGTTCGTTCCAGTGATCGAGACTTATCAGATAAAGATT
TCAATTATAATTCACTCGGAGATTCCACAAATGCTGACGGTGACAAGTGG
ACAGAGCTTTCACCAAACGCCTCAAACAAAACTTTTAGAAACACATCCTT
CAATAACGAACAGCCAGCCAAAGAATCTGGTATGGATGAAGACAATAATA
GTGTTTTAAGATTGGACAAAAGTAATATTATTATCCTAGGTCCAACAGGG
TCAGGTAAGACATTATTAGCTCAAACATTAGCCAAATGTTTGGATGTGCC
GCTAGCAATCTGTGATTGTACGACTTTAACTCAAGCCGGATATGTCGGGG
AAGATATAGAATCAGTTATAGGAAAACTTTTTCAAGTTTCCAATTACAAT
GTCGACAAAACTCAAAAGGGTATTGTATTTTTGGATGAAGTGGACAAAAT
TACTTGCAAAACGGGATTTTATCATGCCATCCGAGATGTAGGTGGTGAAG
GGGTACAACAAGCAATGTTGAAACTGTTAGAAGGATCAGTTGTGACAATT
CCAGATTCAAAAGGAGTCAGGCGAATTCGATCTGAACCGATTTCAATTGA
TACCTCAAATATTTTATTCATTGCCTCAGGAGCATTCAATGGTTTAGAAA
AAATAATTAAACAAAGAAAGCACAAACGAACAACAGGATTCGAAGTCGAC
AATAAAACTGTTGAAAAGAATCAATCACCTACGGACCCAGATAAAAAGGA
AAATTTTAAAGGATCAAAGAATGCAGAAATTGCTTCATTTAACTACAATT
CAGAAGACGATCCGGCCGAAGAAAATAAAATCAAAGATGATTTATTAAAA
GATGTTGAAGTTCGTGATTTAATCAGTTACGGATTGATCCCAGAATTTGT
TGGCCGCTTTCCCATTGTCACCGCGCTCCATAATCTCGACGAGAATATGT
TGATTACCATTCTTACGCAACCAAAGAATGCTTTGATAACTCAATTTAAG
CTATTATTCAATTTAGATAAATGTGAACTAACAATTACTGACGATGCTTT
AAGGGCTATCGCACACAAAGCTCTTTTAAGAAGGACAGGGGCTAGAGGAC
TTCGATCAATTTTGGAAAACGTTTTGCTAAATCCAAGATATGAAGTTCCC
GGATCAGACATTATTGAAGTGAGAATAACGGCGGATGTCATTAACAAGAA
TTCTTTGCCGGTACTTGTCCGGAAAATTGGGAGCACTGGAGAAATTAAAA
CAGAAACGTAATTCTCCAAATATTTCCATTGACAGACTTCATTTTTGTAG
CAAGCCAGCTTTTATAAAGAATTCCAAATATAACAACAAAATATTATAAC
AATTTGATATTTTCGTTAATAATTTTTGATTCATTTCAGCCTTACTGATA
CTCGATTACTCTTTACTTAATTTATTTCGCTA
back to top

protein sequence of SMED30034536-orf-1

>SMED30034536-orf-1 ID=SMED30034536-orf-1|Name=SMED30034536-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=660bp
MSIRLAGSTLRNCLKQLNLSYSQISKLKQQLDGKNQKFNNENKTMKVDID
KGNFIKFRKSFLTLKKEESHTLSQFQDCDMDTTNKSSNSGSNGGYIPCTK
CGGPLRTIKSTNAVFQYMVCDKCKYLFTLIDKDIIDTTLAAKSVPSVRTA
EIQFNVPTPKEIHQFLDKHVIGQQKAKQILSVQVYSHYTRILFNSKSKHV
KQNNLIQFQNDGKIVSTVPKGFDLEQSFSKDYYINNPIKPATKEVRSSDR
DLSDKDFNYNSLGDSTNADGDKWTELSPNASNKTFRNTSFNNEQPAKESG
MDEDNNSVLRLDKSNIIILGPTGSGKTLLAQTLAKCLDVPLAICDCTTLT
QAGYVGEDIESVIGKLFQVSNYNVDKTQKGIVFLDEVDKITCKTGFYHAI
RDVGGEGVQQAMLKLLEGSVVTIPDSKGVRRIRSEPISIDTSNILFIASG
AFNGLEKIIKQRKHKRTTGFEVDNKTVEKNQSPTDPDKKENFKGSKNAEI
ASFNYNSEDDPAEENKIKDDLLKDVEVRDLISYGLIPEFVGRFPIVTALH
NLDENMLITILTQPKNALITQFKLLFNLDKCELTITDDALRAIAHKALLR
RTGARGLRSILENVLLNPRYEVPGSDIIEVRITADVINKNSLPVLVRKIG
STGEIKTET*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR004487Clp_protease_ATP-bd_su_ClpX
IPR019489Clp_ATPase_C
IPR003593AAA+_ATPase
IPR027417P-loop_NTPase
IPR003959ATPase_AAA_core
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0008233peptidase activity
GO:0051082unfolded protein binding
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 24..44
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 264..550
e-value: 1.7E-86
score: 291.9
coord: 150..227
e-value: 2.8E-9
score: 38.7
NoneNo IPR availableGENE3DG3DSA:1.10.8.60coord: 551..652
e-value: 2.3E-32
score: 112.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 283..303
NoneNo IPR availablePANTHERPTHR11262:SF4ATP-DEPENDENT CLP PROTEASE ATP-BINDING SUBUNIT CLPX-LIKE, MITOCHONDRIALcoord: 98..648
NoneNo IPR availableCDDcd00009AAAcoord: 308..432
e-value: 1.77641E-14
score: 69.0971
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 312..621
e-value: 4.7E-8
score: 42.8
IPR019489Clp ATPase, C-terminalSMARTSM01086ClpB_D2_small_2coord: 552..645
e-value: 2.6E-22
score: 90.1
IPR019489Clp ATPase, C-terminalPFAMPF10431ClpB_D2-smallcoord: 552..623
e-value: 1.3E-11
score: 44.4
IPR003959ATPase, AAA-type, corePFAMPF07724AAA_2coord: 313..546
e-value: 4.2E-40
score: 137.6
IPR004487Clp protease, ATP-binding subunit ClpXPANTHERPTHR11262HSL AND CLP PROTEASEcoord: 98..648
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 156..637