Filamin-A

Overview
NameFilamin-A
Smed IDSMED30034531
Length (bp)5807
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Filamin-A (SMED30034531) t-SNE clustered cells

Violin plots show distribution of expression levels for Filamin-A (SMED30034531) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Filamin-A (SMED30034531) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Filamin-A (SMED30034531) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034531

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30034531SMESG000017288.1 dd_Smed_v4_1745_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034531SMESG000017288.1 dd_Smed_v4_1745_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034531SMESG000017288.1 dd_Smed_v4_1745_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034531SMESG000017288.1 dd_Smed_v4_1745_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034531SMESG000017288.1 Contig38233uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034531SMESG000017288.1 Contig38233newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034531SMESG000017288.1 Contig18952uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034531SMESG000017288.1 Contig18952newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034531SMESG000017288.1 Contig29093uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034531SMESG000017288.1 Contig29093newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034531SMESG000017288.1 Contig45360uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034531SMESG000017288.1 Contig45360newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034531SMESG000017288.1 Contig6890uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034531SMESG000017288.1 Contig6890newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynx musculatureSMED30034531SMESG000017288.1 dd_Smed_v6_1745_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30034531SMESG000017288.1 dd_Smed_v6_1745_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Filamin-A vs. Ensembl Human
Match: FLNA (filamin A [Source:HGNC Symbol;Acc:HGNC:3754])

HSP 1 Score: 814.683 bits (2103), Expect = 0.000e+0
Identity = 495/1195 (41.42%), Postives = 692/1195 (57.91%), Query Frame = 3
Query: 1245 SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEG----PGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLR---PNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIK-AGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNA---------FHGVNFEINTKDGVPVDL-----------NAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGE-PVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDS 4742
            +SKV   G GLE+  A E   F +D   A SA + + +      P E  I   D+GDGT  + Y    PG YT+ + Y    +P  P  + V P     +D S V   GPG+  +GVF++   +F+VDA  ++Q G   VKA V +PSG  T   + +  +G Y V YTP EEG H ++VTY+G P+  SPF V    G +   V   GPG+ S   N+  +F V+  GAG G LGLA+EGP++A++ C DNKDG+C VEY P +AG Y ++V +    +  SPF V V D     KVK  GP     ++R   P  F +D S+AG APL+VKV  P   +   PV +      A GT  V YVP   GP  I V Y    +  SPFK  V+      KVK  G G+      + AS+P  F ++ KDAG    + V + +P G+P   HI+   +G YT  Y     G + I +   G  +P SPY V+++PTG+  KC +  AG   TIQ+ +E+VIT++TK AGKG++TCTV   +  +V             V V E+ DG   + Y   + G+Y++ V++GG+ +PN  F  TA    Q   +   RS Q       A              GVN  ++     P DL             +V  PSG + +  IT  DN    + + Y PSE G H++ +      I GSP QF+VD    G VTA+GPGL+ G  N+ A FT+ TKDAG GGLSL +EGPSK EI C DN DGT  VSY+P  PG+Y+I++K+ +Q + GSPFTA +TG+  ++ S + VG++++IP+ I  +DLS LTA +  PS  + PC++K++ NG +G+SF PKETGEHLV+V + G  +  SP  V +   E+GDA++V+VSG+GL +G   +  EF IDTRDAGYG L++SIEGPSK +I+ +D E+G C V Y PTEPGNY+IN+ +A ++VPGSPF+V V G+  V    + + R + A     VG +C+++LKI E++++D+   V +PSG T   +I +  N    I+FV  E G H VSV +K +H+ GSPFQFTVG +  GG+  V A GPGLE+    +  EF+I+TREAGAG +++A+EGPSKAE+ F++ +D GSC V Y V +PGDYE S+KFN EHI +SPF + V   S
Sbjct: 1160 ASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQ--DHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPA----VDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLV--EPVDVVD---NADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGL--NTTGVPASLPVEFTIDAKDAGEGL-LAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEV------------DVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVN-GLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTIT--DNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRV---KESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKD-GSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS 2321          

HSP 2 Score: 248.825 bits (634), Expect = 0.000e+0
Identity = 126/283 (44.52%), Postives = 180/283 (63.60%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGH--YKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAE--KSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++A V +PSG +E   V +I   +Y V+F PRE G +L+ V+ N   I GSPF+I VG   +  DPG+V A G GL   +    A+F VNTSNAG+G+L+V IDGPSKV M+C E  +GY  TY   APG+Y+I+I YGG +HI GSPF A V G +  +N +  E  S      +   C  Q+       ++  K++ +GLGL +A +   +SF VD S+AG  +LLVG+ GP  PCEE++VKHVG+  ++V Y++K+ G + ++V+WGD+ IPGSP+ V V
Sbjct: 2356 IDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVV 2638          

HSP 3 Score: 487.649 bits (1254), Expect = 6.105e-140
Identity = 488/1659 (29.42%), Postives = 723/1659 (43.58%), Query Frame = 3
Query:   33 DLYEVTYRP-QECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLND-GIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIE---VCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPAT-LAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGL-LCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQES----------PLITEEPILSEQIKTL--------KAGNPHNPMQKANP--------------GKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQP------SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGK-QTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKV--NEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXX--XXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQ------VEKVKVDGDGIIPQNGA-ILASMPAVFHVNTKD-AGVNP-DVIVGLFNPNGE-----PMPLHIEARP------NGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVA----------VGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVN---------VHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKD-VTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNG-EHIVNSPF 4718
            + Y V Y P Q+ P    +   VT GG+ IP SPF++  +   + SK    +  L   V + + Q F VK    G + +    +   +G  V   +   +  +     + P + G + +  + DG PV  +P  +    E     +  KV+   P ++     +P  F + +  K      + + V  P    +        DGT  V++VP E G ++I     D  I  +P     +P  D  +   K S P    A   + GQ    CS     + T         + +  +   P  V  +    G     +IP   G Y++       P+   P  + V+ +          P I  + +  E             + G PH   + ANP              G     YT  EE +  + +   + S  P S    P       S+V V+G G++     +   FT++++ A +  +G+ VEGP EA + C+DN DG+C V Y     G Y++NV Y    +P SP  VPV+       D S V  SGPGLSP  V  +    F VD S+    G   ++  VQ P G  +   ++DN + G   V Y P+ EGP+ I+V Y    +  SPF VK  P  +A  V ASGPGL++  V  +   +F +D   AG G L + I  P     + H  DN DGT  V Y P   G Y I +K+  ++I  SP+ V      +     V   G     ++      T+D   AGK  +   V  P     D  V   +      GTFD+ Y   + G  +I V++    +  SPF+   +   Q      +   ++       Q G    A    +  VN  D   + P D+++      GE      MP    A+P      +G  T  Y   + G H++ +  D   +P SP              A   G    + VNK +  T+ TK+AG+G ++  ++   + ++                 ++ DG  SV Y+P   G+Y + VKY  Q +P   F           R T   S++  +S+    +A    +  IN  +     L A VV PSG   E P         ++ I + P E G H + V   G+ +  SP    +     G   RV   G GL  G T E AEF I T+DAG GGLSL +EGPSK +I  ED  DGT +V+Y P  PGNY I IKF DQ + GSPF+  +TGE   K  +           VG+  ++ LKIP   +  +TA++T+PS       I +  N    + F P E G H V+V  KG  +PGSPF+  V     G A KV+  G GLE+  A    EF+I TR+AG G L I++EGPSKAEI  +D ++G C V Y+  EPG+Y ++V +  +++P SPF        VVP  +   +  +  V + Q     E  LK+++ A   + +N         VH+PSG  E C + +       ++F+ RE+G++ + V     HI GSPF+  VG    GG    V+A G GLE G      EF + T  AGAG +SV ++GPSK +M  QE  +     VTY    PG Y  SIK+ G  HI  SPF
Sbjct:  931 NTYTVKYTPVQQGP----VGVNVTYGGDPIPKSPFSVAVSPSLDLSKI--KVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPL----EAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDT--KGAGTGGLGLTVEGPCEAQLECLDNG--DGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKV--KCSGPGLERATAGEVGQFQVDCSSAGSAELT---------IEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSV-DVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVH----DVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKA---GVAPLQVKVQGPKGLVEPVDVVDNAD-GTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENE-----DGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGV-VNKPATFTVNTKDAGEGGLSLAIEGPSKAEI--------------SCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPF---------TARVTGDDSMR--MSHLKVGSA---ADIPINISETDLSLLTATVVPPSG--REEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPF--------VVPVASPSGDARRLTVSSLQ-----ESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPE--GYRVTYTPMAPGSYLISIKYGGPYHIGGSPF 2504          

HSP 4 Score: 342.813 bits (878), Expect = 5.478e-107
Identity = 336/1218 (27.59%), Postives = 538/1218 (44.17%), Query Frame = 3
Query: 1230 KPDQPSSKVIVYGKGLEKVA--AKEKAIFTIDSKDAPSAPIGVTVEGPG----EAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKD---CFAKFTVDASEVSQNGQGTVKALVQSPSGKQ--TNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAE-IQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVV---QPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKA-GKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTK---GEGRVTAFGPGLSSGTTNEVAEFTIITKDA-GPGGLSLIVEGPSKTEIKCE-------DNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQV----------AVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISI--EGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKD-----LKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGS-KDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVED 4736
            +P     K   YG G+E      K++A FT++++ A    + V VE P     EA +   ++ + T  V Y   V G + + VL+   HI +SP  V V   D    D S VTA GPGL P G   +    F  FT  A      G G V+ ++Q P G++      ++   +  Y   Y PT EG H ++VT+ G+PI  SP+ V      N     A G GL     +V E   F V   GAG G L + ++GP   E ++  D  DG    EY P+  G Y +++ +  ++I  SPF V+V  E   +KV++ GP ++   + +   F ++        L   V  P            + +    G+ DV Y P+E G   + V  N   I  SPF  ++    Q    ++VK  G G+  +   +  + PA F V+ K  G  P + V + +  G P+   ++   NG Y+C Y       H   V   G  +P SP+ V      +P K  +   G  KT ++ ++ +  T++  EAG+G ++  + K     VG  E     D I+     + +   +V Y P+  G Y + V +  Q+ P          S    +        ++   EL       VN +   K  + V  +   +     + +V I   D++ +   + Y P ++GP  + V   G PI  SPF   V       + +V+  G  +  G      EFT+ +K A G G ++  + GPS   + C+       DN      V ++P+  G Y + + +   P+ GSPF       P K S+V          + G+ +   +    +    L   +  P + ++ C+     +G   VS+ P E G++ +N+    T IPGSPFK +V      DA+KVK SG GLE+  A +  +F +D   AG   L I I  E    AE+  +D+ +G  T+ Y+P  PG Y + + Y G+ VP  P  + VE       +T  ++     ++   V         +D  AL       +K  V  PSG      ++D G+G  ++++   E G+H V V +    +  SPFQ     VT G     V   GPG++ G  +  N+F + TR AG G + +A+EGPS+A+M   +++D GSC+V Y   + G Y  ++ + G  +  SPF + V D
Sbjct:  276 RPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYV---DKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGA------GTGEVEVVIQDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQ-------AKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGL--EKTGVAVNKPAEFTVDAKHGGKAP-LRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGI-KCAPGVVGPAEADIDFDIIR-----NDNDTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSG--LTKGDAVRDVDII--DHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLGEKVDVGKDQ---EFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNS----VVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVA-PTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECL--DNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVV--PCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVE----PAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQV---PVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKD-GSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHD 1444          

HSP 5 Score: 68.5514 bits (166), Expect = 5.478e-107
Identity = 80/297 (26.94%), Postives = 113/297 (38.05%), Query Frame = 2
Query: 4820 SITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKK--AKFFVNTSNAGSGSLNVAIDGPSKVNMNCH--ETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPF--TAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMV 5689
            S  V      +  L+  VQ P G +EP  V    DG   V + P   G + + V    + +  SPF++ V     D   V ASG GL+   V      +F ++  +AG G L V I  P       H  +  DG Y   YV    G Y I I YGG+  I  SP+   AV  G+ S   V        ++I                   E +I                  VD   AG G +   +  P     +V V    +  F + Y   + G ++I VR+G + +P SPF V
Sbjct: 1470 SFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKV-LPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGD-EIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQI-----------------GEETVIT-----------------VDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQV 1730          

HSP 6 Score: 365.155 bits (936), Expect = 4.695e-101
Identity = 354/1211 (29.23%), Postives = 547/1211 (45.17%), Query Frame = 3
Query: 1251 KVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDN-KNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIE------GPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP---IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGL----YTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVE-QIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTR-SVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF----FVDTKGEGRVTAFGPGL-SSGTTNEV-AEFTI----ITKDAGPGGLSLIVEGPSK--TEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAV----------GNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGL--ANQGNEFTIDTRDAGYGSLNISIEGPSKA--EIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPC-ETQKMERVQEAVKATQVGGNCEINLKIDEMALKD--LKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIY--TREAGAGNISVAMEGPSKAEMKFQ--ESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            KV  +G GLE     + A F +++       +G +VEGP +A I+C D GDG+C V Y     G Y ++VL ++  I  SP +  +  +D  ++     V A GPGL   GV  +  A+FTVDA      G+  ++  VQ   G     L+ +  NG Y   Y P +   H   V++ G+ I +SPF V    G +   V   GPG+     K +E T F VD   AG G + + I+      GPA+A+I      N + T  V+YTP  AG Y I V F D+    SP  V+V       KVK++GP       +L +P HFT++   AGK  L+V+ S    G + R V I         T+ V Y P + GP  ++V Y   PI  SPF   V     + K+KV G G       +       F V +K AG    V   +  P+G  +P  +E    GL        +   + G +++ V  DG P+P SP+ ++++    P K        +       +  TI+TK AG G +  TV+       G  E Q++ LD        + DG  SV Y+P E G+Y + + +    IP   F       F   +   +   ++   + E+         F+++       +L  ++   +G   EV I  + +  H I   Y P   G + + +   G+P+   P +      VDT G   V  +GPG+   G   E   EF++    +T+  GP  +   V  PS   TE   +D  DG +KV Y P   G +++ + +   P+  SPF   +T E    S+V V             ++  ++   +    L   +  PS+ K+ C+  K  +G+  V + P E G + +NV   G  +PGSPFKV V   +V DA+KVK SG GL  G+  AN    F +DT  AG   L + ++GP      +D  DN +G  TV Y+P+  G Y I+V Y  + VP SPF V     KV+P  +  K++     +  T V  +  +   ID     +  L V +  P G  +   I+D  +G   + +V   +G + + + +    I  SP++  V +V  G +   T +G G+    I I  E  I   T+ AG G ++  +  P  +E+     E++D G+  + Y   QPG Y   ++F GEH+ NSPF +
Sbjct:  578 KVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADI--RDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDA---KHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHD---NTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLG-----EKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEP---GLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVE-------GPCEAQLECLD--------NGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVG-------QFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTIT--YIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSG---VQCYGPGIEGQGVFREATTEFSVDARALTQTGGP-HVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVT-EGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNK--DGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPV--HDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKV-----KVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYR--VRAVPTGDASKCTVTGAGIGP-TIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENED-GTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQV 1730          

HSP 7 Score: 353.214 bits (905), Expect = 2.179e-97
Identity = 357/1200 (29.75%), Postives = 537/1200 (44.75%), Query Frame = 3
Query: 1266 GKGLE--KVAAKEKAIFTIDSKDAPSAPIGVTVEGP-GEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPG---FNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIEG----PADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP---IKDAKLLRPNHFTIDCSEAGKAPLEVKV-SKPGS-GISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNP-DVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIAS----VHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQ-FFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIV--EGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEP-VKKSQV----------AVGNSSEIPLKIPSSDLST-----LTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKID--EMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFI--DINNEFAIYTREAGAGNISVAMEGPSKAEMK--FQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            G+GL+   V  KE A F + +K A S  + VTV+GP GE  +   D GDG  G  Y   VPG Y + + +   +I +SP  V V            V A GPGL  EG      A F V+A     +  GT+   V+ PS  Q     D+  +G   VRY P E G + ++V      I+ SPF+   +     F+   V A GPGL      VN+  +F VD    G   L + ++     P +A ++  DN +GT    Y P K   +   V +    I +SPF V V     P KVK  GP       K   P +FT+DC+EAG+  + + +   PG  G ++  +    +      TF V Y P   G   I V +       SP +  V       KVK +G G+      +    P  F VN K AG    DV             + I    +  YT +Y     G   ++V   G P+PKSP++V   P+ +  K  + +G  + + V K+   T+++K AG GQ      K+  + VG         ++  KV+    G+ +    V ++P+EEG Y VEV Y G  +P   F        + V  T    V+         +A     F I+TK      L   V  P     E  +   DN      + Y P+E G + + +      I GSPF+   V      +V   GPGL   T  EV +F +    AG   L++ +  E     E+  +D+ DGT  ++Y+P  PG Y + IK+  QP+    F + +  EP V  S V           V   +     + +  L+      + A +  PS       ++   +G   V +TP E G H V+V   G+ +P SPF+V V   E  D ++V+V G G++ G  N+ N+FT++TR AG G L +++EGPS+A++ C DN++G C+V+Y+P E G Y +NVTY G  VPGSPF V V        +  K++     +    V  N   + ++D  +  +  L+V V  P G  EP D+ D  +G   + +V    G + +SVL+ D  +  SPF+  V  +    +  V ASGPGL    +   +  EF I  ++AG G ++V +  P     K   Q++ D G+  V Y     G Y   IK+ G+ I  SP+ +
Sbjct:  487 GRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKV----GTECGNQKVRAWGPGL--EGGVVGKSADFVVEAI---GDDVGTLGFSVEGPS--QAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVEALVK--DNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDN-DTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGL--SRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKV-SGLGEKVDVGKDQEFTVKSKGAG-GQ-----GKVASKIVGPSGA-----AVPCKVEP---GLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPF------PLEAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPC----EAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPN--FPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVT--EGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHD----VTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKV--LPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHD-GTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRV 1634          

HSP 8 Score: 323.553 bits (828), Expect = 3.283e-88
Identity = 340/1241 (27.40%), Postives = 546/1241 (44.00%), Query Frame = 3
Query: 1230 KPDQPSSKVIVYGKGLEKVAAK--EKAIFTIDSKDAPSAPIGVTVEG--PGEAV--IDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLID-NLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVN--PDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVN----FEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF-FVDTKGEGRVTAFGPGL-SSGTTNEV-AEFTIITKDAGPGGLSLIV---EG-PSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI--TGEPVKKS--------QVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVK------------VSGKGLEKGLANQGNEFTIDTRDAGY--------------GSLNISIEGPSK--AEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPS-KAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAARAVS 4772
            +P   +SKV   G GL +   +  +   FT+++K A    + V   G   G+AV  +D +D+ D T  V Y     G   +NV Y    IP+SP  V V P    +LDLS +  SG G   + V KD   +FTV +      GQG V + +  PSG      ++  L     VVR+ P EEGP+++ VTY+G+P+  SPF ++A        V A GPGL         +F +D  GAG G LGL +EGP +A+++C DN DGTC V Y P + GDY+I++ F D  I  SPF   VV      KVK  GP ++ A       F +DCS AG A L +++       +  P  +  ++    GT  + Y+P   G   + +KY   P+   P K  V        V+  G GI  Q   +       F V+ +       P V   + NP+G     +++ R +G+Y  EY  ++ G H + V  DG+P+P SP+ V      +P +  +     ++   NK +  T+ET+ AG G +   V+       G  E        K+   ++ DG  SV Y+P E G Y + V YGG  +P G  F+   +        +T + + + S    S      N    F+++T       L  KV  P G +E  P+   DN      ++Y PS  GP+ + V      +  SPF+   + T    +V A GPGL ++G    +  EFTI  KDAG G L++ +   EG P KT I  +DNHDGT+ V+YVP   G Y I+IK+    I  SP+      TG+  K +         + +G  + I +   ++    +T  + TP   +V   + +  +G   + +T  + G++++ V   G  +P SPF+V       GD   V+               +G ++  A +     ++  D                 G +   +  PS   A+    DN++G  TV+Y P+E G + +++ Y   ++PGSP    V+    V C    +      +    V       +   +     L + +  PS     C   D  +G   + ++    G + + V + ++H+ GSPF   V       + D +     L+ G      +  I   E     ++  +  PS + E    +    G   +++   + G++   +K NG+H+ +SP  +++    I   +   VS
Sbjct:  867 EPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSP----SLDLSKIKVSGLGEKVD-VGKD--QEFTVKSK--GAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSE----AGLPAEV-YIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQ--GVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVE-------GPSEA-------KMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVP-GSPFKVPVHD-------VTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVE--PVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHI--QDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTAL---AGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVD---YVNC--GHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISC--TDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARV-------TGDDSMRMSHLKVGSA---ADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVS 2045          

HSP 9 Score: 298.901 bits (764), Expect = 1.301e-80
Identity = 421/1693 (24.87%), Postives = 674/1693 (39.81%), Query Frame = 3
Query:   42 EVTYRPQECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDED-----SKYIG-TLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPM-IEVCAPQTFKVLSPEK--------------VINPDLVDV--QVLNPENKIIPIHKEAAPDGTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKD--------------NTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPI--LSEQ----------IKTLKAGNPH-------NPMQKANPGK---------SNKPYTALEEAIKEMKESA----VESSKWPQS--KPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEK--TQFVVD---LDGAGHGSLGLAIEGPAD--AEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKC-AIKAGKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQN---QISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFV--------------------DTKGEGRVTAFGP-----GLSSGTTNEVAEF-TIITKDAGPGGLSLIVEGPSK--TEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPF--------TANITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDC--KDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGN---CEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV---GSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPS--KAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            +V Y PQE     A+H  V    EDI  SPF        +D      K  G  LE  K  V + +P  F V    G K+   V V D  G PVE  LVK     TY  +Y P K  +H    S  G  +  +P  V+V      N  K+   G+A   ++   P  F V   E               V+ P   D+   ++  +N           D   V + P+  G ++I     DQ    +P  VK  P  D  +   +    +   VE     + KP  FT+                    D + D D++    D+H                ++ P + GP  +  +   +PI  SP ++ V  S  +++  +  L E+          +K+  AG           P   A P K         S   +   EE   E++ +     V  S +P     P +P SKV  +G GL+  +A   A FTID+K A +  +G+TVEGP EA ++C+DNGDGTC V Y    PG Y IN+L+ + HIP SP    V P      D S V  SGPGL  E        +F VD S     G   +   + S +G      I +  +G + + Y P   G + + + Y G P+ + P  ++ +P  +   V   GPG+    V  +  T+F VD   L   G   +   +  P+    E    D  DG   VEYTP + G + + V ++   +  SPF V V +   P +V+  GP I+     +PN FT++   AG   L + V  P    S+  ++    +    G+  V Y+P E G   ++V Y    + GSPFK  V       KVK  G G+ P  G + A++P  F V+T  AGV P + V +  P G   P+ +    +G  T  Y     G + ISV      +P+SP+ VK +PT +  K  A   G + T +  +     TI+ K+AG+G +   +   E +              K  +Q++ DG  +V Y+P   G Y + +KYGG  IP   +   A  +    + T+T +      QI  E            ++TK      +   V  P G   +V +  N++      I Y   + G + + V   G  +  SPFQ                        T  +G    + P     G++      +  F  +I      G ++  V  PS    +    DN DGT  V Y P   G + + I++ +  I GSP           ++T      +   V   +   +    +    L+  +  PSK ++ C   +  +G   VS+ P   G++ + V      +PGSPF   V  ++    + +KV              +  I+  +     L  ++  PS  E  C  K   NG   + ++P E G ++++V   G++V  SP  V +        E     RV+ + +    G      E  +   +     L +++  PS      + ED  +G  R+ +   E G + +++   D+H+ GSPF   V   G V     + +T          +  + + ++   E    +++  +  PS    E +  E ++   C + +  ++ G +  S+K+ G+H+  SPF   V
Sbjct:  632 DVRYWPQEA-GEYAVH--VLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLE--KTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVE-ALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDN-----------DTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVE-----LGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDII----DHHD----------NTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKP-SKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVP----CFDASKVKCSGPGL--ERATAGEVGQFQVDCSSA---GSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGP----SEAKMSCMDNKD---GSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSP--GMVRANLPQSFQVDTSKAGVAP-LQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPK------------KTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQIGEETV--------ITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENED--GTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQ--DGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKV----------GSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS-----QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVD--INTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRV----KESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYC-IRFVPAEMGTHTVSVKYKGQHVPGSPFQFTV 2222          

HSP 10 Score: 276.559 bits (706), Expect = 9.033e-74
Identity = 329/1239 (26.55%), Postives = 514/1239 (41.49%), Query Frame = 3
Query: 1224 QSKPDQPSSKVIVYGKGLEKVAAKEKAI--FTIDSKDAPSA---PIGVTVEGPGEAVIDCV--DNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIEGPADA--EIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLL---RPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPE------------KCAIKAGKDKT-------IQVNKESVITIETKEA------GKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKC--EDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLK----------------IPSSD--LSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGN--EFTIDTRDAGYGSLNISIEGPS--KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVE-----GDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGA-GNISVAMEGPSKA-EMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            Q +P   +S V  YG G+E      +A   F++D++         +   V  P   + +    D GDG   V Y     GL++++V YD   +P SP  VPV     +  D S V   GPG+      K    KFTV   E    G G +   V+ PS  + +  +DN  +G   V Y P E G + +NVTY G  +  SPF V      +A  V  SGPGL     + N    F VD   AG   L + ++GP      +   DN DGT  V Y P + G Y ISV + DE++  SPF V+V+      KVK+ GP  +   +    P  FTID  +AG+  L V+++ P      +P     ++    GT+ V YVP+  G   I +KY    I  SP++   V      K  V G GI P    I      V  V+TK AG    V   +  P+G  + + +    +G +   Y     G + I V   G  +P SP+ V ++    P             +     G  +T       + VN   V ++   +        KG+IT  V    R   G+V Q  + D        + DG  +V Y P E G + ++++Y    IP         Y            + + + N+ A+       F +NTKD     L+  +  PS    +  I+  DN      + Y P   G + + V    + + GSPF   V      R++    G ++     ++E  +         L+  V  PS  E  C  +   +G   +S+VP+  G + + +K   Q +A SP        PV  SQ  +G++S + +                 I + D     L+  +  PSK+ +    + + +G   V++ P E G +++N+      +PGSPF V V  E      K  ++ +     +AN G+  + ++   +     +   +  PS    E +  + EN    ++++P E G + ++V Y G++VPGSPF   V      G   V      +ER +  V A       E ++   E     L + V  PS        ED  +G+  + +V +E G + VSV   + HI  SPF   V S + G ++ +T S   L++  + +N   +      GA G I   +  PS A E  +    D+   AV +   + G Y   +KFNG HI  SPF I V
Sbjct: 1248 QVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPV----TEGCDPSRVRVHGPGIQSGTTNKP--NKFTV---ETRGAGTGGLGLAVEGPSEAKMS-CMDN-KDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDP----EGKPKKT-HIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGP---TIQIGEETVITVDTKAAGKG-KVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEV----RMPSGKVAQPTITD--------NKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPAT-------FTVNTKDAGEGGLSLAIEGPS----KAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSL-------LTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPI-------PVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDIN--TEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGE---GRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPA-------EFSIWTREAGAGGLAIAVEGPS--KAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS-GDARRLTVSS--LQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRV 2412          

HSP 11 Score: 254.218 bits (648), Expect = 5.524e-67
Identity = 274/1055 (25.97%), Postives = 440/1055 (41.71%), Query Frame = 3
Query: 1224 QSKPDQPSSKVIVYGKGLE-KVAAKEKAIFTIDSKDAPSAPIGVTVEGP--GEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAK-FTVDASEVSQNG------------------QGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSP--FIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQP--AQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTI-QVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDT-KGEGRVTAFGPGLSSGT-TNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKC---EDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAV-------------GNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNV-YEKGTDIPGSPFKVNVKNEEV---------------------------------GDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSK--AEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNV 4145
            ++ P   +SK  V G G+   +   E+ + T+D+K A    +  TV  P   E  +D V+N DGT  + Y  P PG Y I V +   H+P SP  V     D  ++     +     L+P+  +     + +  +   V  NG                  +G +   V+ PSGK     I +  +G   VRY P+E G H++++ Y+ + I  SP  F V      N   VTA GPGL    VN+   F V+   AG G L LAIEGP+ AEI C DN+DGTC V Y PV  GDY I VK+N++ +  SPF   V  +           +   K+       I+ SE   + L   V  P     + P  +K++     G   + +VP+E G  L+ VK N   ++ SP    + Q       +V+V G G+    G      PA F ++T+DAG    + + +  P+   + ++ E   +G     Y   + G++ I++      +P SP++VK    G  ++   +  +  ++  V     ++++  E     +T  V        G+  + +++        E  +    + ++P E G + V VKY GQ +P   F     ++   + E     V+        + A     F I T++     L   V  PS    +  I+  D    +  + Y   E G +++ V      I  SPF   V +  G+ R         SG   N+ A F  ++ +   G +   V  PS    +C   E + D  + V ++P+  G Y I +KF    I GSPF   + GEP       +             GN +E  +   ++    L+  +  PSK+K+ C  ++   G   V++TP   G +L+++ Y     I GSPFK  V    +                                  DA+KV   G GL K    Q + FT+D   AG   L + + GP     EI  K   + + +V YL  + G Y + V +  +++PGSP+ V V
Sbjct: 1635 RAVPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQ---LAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDY---VNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMR-------MSHLKVGSAADIPINISETDLSLLTATVVPPSG--REEPCLLKRLRN---GHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGL--HEGHTFE--PAEFIIDTRDAGYG-GLSLSIEGPS--KVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVT----SPSGKTHEAEIV--------EGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPF----QFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPS----KAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFA-VSLNGAKGAIDAKVHSPSGALEECYVTEIDQD-KYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRV-GEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDC--QECPEG-YRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVV 2638          

HSP 12 Score: 164.851 bits (416), Expect = 9.076e-40
Identity = 175/666 (26.28%), Postives = 276/666 (41.44%), Query Frame = 3
Query:  636 VTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLL-CEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEE-----------------------PILSEQIKTLKAGNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQP------------SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVY--PKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNG-QGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVK-AKPGFNAQ--LVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFND-EDISDSPF------------HXXXXXXXXXXXXXSK------------GPIKDAKLL------------RPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNV 2396
            ++FVPKE G H +      Q +  +P  V  + +++I +A   + S   L     EG   +P  F I   +T D    +  + LS +    + + ++ L  G     + P + G Y +     +  + GSP ++ V     + E                        P +S Q  T +  +P     +A   +       +     EM    V      Q  P  P            + KV   G GLE+  A   A F+I +++A +  + + VEGP +A I   D  DG+CGV Y V  PG Y ++V ++  HIP SP VVPV     D + L +S++  SG  ++    F             VS NG +G + A V SPSG      +  ++  KY VR+ P E G + I+V + G  I  SPF ++  +PG      LV+A G GL         +FVV+   AG G+L + I+GP+  ++ C +  +G   V YTP+  G Y IS+K+     I  SPF            H             +K            GP   +K++            + + FT+DCS+AG   L V V  P +   +  + +K V       + V Y+ ++ G   + VK+    I GSP++  V
Sbjct: 2001 ISFVPKETGEHLVHVKKNGQHVASSPIPV-VISQSEIGDASRVRVSGQGL----HEGHTFEPAEFII---DTRD--AGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFA------------VSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGY-RVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEE--ILVKHV---GSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVV 2638          

HSP 13 Score: 130.568 bits (327), Expect = 2.769e-29
Identity = 97/284 (34.15%), Postives = 134/284 (47.18%), Query Frame = 2
Query: 4853 PKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLK--QARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            P ++A V  PSGN+    VQ  GDG Y V+++P E G H V V  +  P+  SPF++PV     DP  V   G G+     +K  KF V T  AG+G L +A++GPS+  M+C + +DG     Y+    G Y +N+TYGG+  + GSPF   V                                    ++  K+ C G GL     R N   SF VD S+AG   L V + GP    E V V    +   TV+YV    G + I V +GD+++P SPF V V
Sbjct: 1291 PHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTE-GCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGH-QVPGSPFKVPVH---------------------------------DVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKV 1539          

HSP 14 Score: 124.405 bits (311), Expect = 1.654e-27
Identity = 87/298 (29.19%), Postives = 142/298 (47.65%), Query Frame = 2
Query: 4808 GGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            G    I +   + ++  L A+V  PSG  EP +++++ +G  G+ F P+E G HLV V+ N + +  SP  + +   +  D   V  SG+GL      + A+F ++T +AG G L+++I+GPSKV++N  + EDG    TY  T PGNYIINI +  + H+ GSPF+  V G              +V+   + +R     A   S       C  L LK   ++  +             +   +  P     E  +    N+ + + +V  E GTH + V++  + +PGSPF   V
Sbjct: 1958 GSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKF-ADQHVPGSPFSVKVTG------------EGRVKESITRRRRAPSVANVGSH------CD-LSLKIPEISIQD-------------MTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTV 2222          

HSP 15 Score: 110.923 bits (276), Expect = 1.995e-23
Identity = 81/300 (27.00%), Postives = 133/300 (44.33%), Query Frame = 2
Query: 4811 GLISITVRAEDGEIP------KLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMV 5689
            GL   ++R  D  IP      ++   V+ PSG +    +    DG   V+++P E G H + +  +   I GSP +  V +     G V A G GL+H +V+K A F VNT +AG G L++AI+GPSK  ++C + +DG    +Y+   PG+Y I + Y    H+ GSPFTA V G+ S                                         + +   ++ S     ++ S+    +L   +  P    E  ++K + N    + +V KE+G H++ V+   + +  SP  V
Sbjct: 1774 GLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNC--GHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQ-HVPGSPFTARVTGDDS-----------------------------------------MRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPV 2029          

HSP 16 Score: 100.138 bits (248), Expect = 3.968e-20
Identity = 78/300 (26.00%), Postives = 132/300 (44.00%), Query Frame = 2
Query: 4802 DAGGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHY-KADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            + G    ++++  +  I  + A V +PSG    A + +  +  Y ++F P E GTH V V+   + + GSPF+  VG   +     V A G GL  A     A+F + T  AG+G L +A++GPSK  ++  + +DG     YV   PG+Y +++ +    HI  SPF   V                                   S +  ++    L     ++N   SF V  + A  G +   +  P    EE  V  +  +++ V ++ +E+G ++I V++    IPGSPF + V
Sbjct: 2147 NVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKF-NEEHIPDSPFVVPV--------------------------------ASPSGDARRLTVSSLQESGLKVNQPASFAVSLNGA-KGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRV 2412          

HSP 17 Score: 95.5153 bits (236), Expect = 9.371e-19
Identity = 82/283 (28.98%), Postives = 125/283 (44.17%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQ-IGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            K+ + +  PSG   P  V+  +G     V+F PRE G + V V  +  P+ GSPF +        P  V A G GL        A+F ++T  AG+G L + ++GP +  + C +  DG    +YV T PG+Y INI +  + HI GSPF A                H     +AS                 K+ C G GL++A    V  F VD S AG   L + I        EV ++  G+   T+ Y+    G + + +++G + +P  P  + V+
Sbjct: 1003 KVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEA-VAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF-ADTHIPGSPFKA----------------HVVPCFDAS-----------------KVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVE 1250          

HSP 18 Score: 92.4337 bits (228), Expect = 8.774e-18
Identity = 86/333 (25.83%), Postives = 146/333 (43.84%), Query Frame = 3
Query: 3795 EHLVNVY----EKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLE--KGLANQGNEFTIDTRDAGYGSLNISIEGPS----KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEM-----ALKDLKVNVHTP---SGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVG-SVTPGGSKDVTASGPGLEKGFIDINN--EFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            EH V  Y     K    PG+P +  +      +  K +  G G+E    +  +  EFT++TR AG G + + +E P+    +A++   +++N   +V Y+P   G + + V +AG+++  SPF V V+  +          +V       +  GN        E+        +++V +  P    G  EP  +E  G+   R  +     G+H V V      I  SP+  TVG +  P   + V   G GL+   + +    +F +YT+ AG+G + V ++GP   E   Q+    G     Y    PG Y  +I + G++I  SPF + V
Sbjct:  254 EHSVMTYLSQFPKAKLKPGAPLRPKL------NPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQ------GDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVIQDPMGQKGTVEP-QLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPSACRAV---GRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKV 570          

HSP 19 Score: 91.6633 bits (226), Expect = 1.676e-17
Identity = 102/352 (28.98%), Postives = 139/352 (39.49%), Query Frame = 2
Query: 4856 KLEASVQTP---SGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSH--AIVDKKAKFFVNTSNAGSGSLNVAIDGPS-KVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVV----------------EG---NKSATNVNQE------------EQHSQVEIEASDK---RC-VSQYAEKSSSNVEKIIC----------------------------QGLGLKQA--RLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++E  +Q P    G +EP + +  GD  Y   + P   G H V V     PI  SP+ + VG    +P    A G GL      V + A F V T  AGSG L V + GP  +  +   +  DG Y F Y    PG YI+ IT+GG  +I  SPF   V                EG    KSA  V +             E  SQ +IE  DK    C V  + +++      ++C                            +G GL++    +N    F VDA   G   L V +        E +VK  GN  ++  YV ++   H  MV WG   IP SPF V+V
Sbjct:  415 EVEVVIQDPMGQKGTVEPQL-EARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQ-ACNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQ-NIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNV 763          

HSP 20 Score: 77.411 bits (189), Expect = 3.710e-13
Identity = 78/308 (25.32%), Postives = 137/308 (44.48%), Query Frame = 2
Query: 4817 ISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFR---IPVGHYKADPGMVHASGEGLSHAI-VDKKAKFFVNTSNAGSGSLNVAIDGP--SKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPF-TAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKII-CQGLGLKQAR-LNSVNSFFVDASQAGYGILLVGIAGPVR-PCEEVVVKHVGNNQ---FTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            +  T+ A+D     L   +  P G  +   +Q   DG Y V + P   G + + ++     I  SP+R   +P G    D      +G G+   I + ++    V+T  AG G +   +  P  S+V+++  E EDG ++  Y A  PG Y+I + +GG  H+  SPF    + G++ +    Q    SQ   + + +   +Q  +++ +    ++   GL +   R  + V  F +   +         I G VR P  +V    + +N+    TV Y   E+G H + +R+ +  IPGSP   +VD
Sbjct: 1566 VEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTG----DASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGE-HVPNSPFQVTALAGDQPSV---QPPLRSQ---QLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGE---------ITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVD 1853          

HSP 21 Score: 73.559 bits (179), Expect = 4.657e-12
Identity = 78/284 (27.46%), Postives = 116/284 (40.85%), Query Frame = 2
Query: 4871 VQTPSGNMEPAIVQQIGDGQ--YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGL--SHAIVDKKAKFFVNTSNAGSGSLNVAIDGP----SKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            V+ P+G+ E A V    D    + V + P   GTH V V    + I  SPF + V   + D   V A G GL  S  I +K   F + T+ AG+G + V I  P      V        D  Y  +Y  T  G + +++T+ G   I  SP+T  V                                +  + +  + + +GL  K  R+     F V    AG G L V + GP +  E V  K +G+  +  +Y     GT+I+ + WG ++I  SPF V V
Sbjct:  320 VEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVIQDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAG-VPIPRSPYTVTV-------------------------------GQACNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGP-KGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKV 570          

HSP 22 Score: 62.7734 bits (151), Expect = 7.915e-9
Identity = 62/261 (23.75%), Postives = 101/261 (38.70%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNC--HETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            DG   V + P   G + + V+ N++ + GSPF         D  M       +SH  V   A   +N S      L   +  PS     C      +G+   ++V    G +++++   G  H+  SP   V+               SQ EI                 +  ++   G GL +        F +D   AGYG L + I GP +   ++  + + +    V Y   E G +II +++ D+ +PGSPF V V
Sbjct: 1909 DGTCSVSYLPVLPGDYSILVKYNEQHVPGSPF---TARVTGDDSMR------MSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQ-HVASSPIPVVI---------------SQSEI----------------GDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSK--VDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKV 2126          

HSP 23 Score: 60.8474 bits (146), Expect = 3.592e-8
Identity = 73/306 (23.86%), Postives = 118/306 (38.56%), Query Frame = 2
Query: 4823 ITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVD--KKAKFFVNTSNAGSGSLNVAID------GPSKVNMN---CHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQA--RLNSVNSFFVDASQAGYGILLVGIAGPVR--PCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
             TV A+ G    L   VQ   G    A+V+  G+G Y   + PR+   H   V      I  SPFR+ VG   + P  V   G G++   +   +   F V+ + AG G +++ I       GP++ +++        D +   Y     G+Y I + +                        +Q    S + ++            + S +  K+  +G GL +    L     F V+A  AG G L V  +G  +     +V +    +N +TV Y   + G   + V +G   IP SPF V V
Sbjct:  695 FTVDAKHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGA-GSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTPRGAGSYTIMVLF-----------------------ADQATPTSPIRVKV-----------EPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAV 965          
BLAST of Filamin-A vs. Ensembl Human
Match: FLNA (filamin A [Source:HGNC Symbol;Acc:HGNC:3754])

HSP 1 Score: 814.683 bits (2103), Expect = 0.000e+0
Identity = 495/1195 (41.42%), Postives = 692/1195 (57.91%), Query Frame = 3
Query: 1245 SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEG----PGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLR---PNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIK-AGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNA---------FHGVNFEINTKDGVPVDL-----------NAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGE-PVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDS 4742
            +SKV   G GLE+  A E   F +D   A SA + + +      P E  I   D+GDGT  + Y    PG YT+ + Y    +P  P  + V P     +D S V   GPG+  +GVF++   +F+VDA  ++Q G   VKA V +PSG  T   + +  +G Y V YTP EEG H ++VTY+G P+  SPF V    G +   V   GPG+ S   N+  +F V+  GAG G LGLA+EGP++A++ C DNKDG+C VEY P +AG Y ++V +    +  SPF V V D     KVK  GP     ++R   P  F +D S+AG APL+VKV  P   +   PV +      A GT  V YVP   GP  I V Y    +  SPFK  V+      KVK  G G+      + AS+P  F ++ KDAG    + V + +P G+P   HI+   +G YT  Y     G + I +   G  +P SPY V+++PTG+  KC +  AG   TIQ+ +E+VIT++TK AGKG++TCTV   +  +V             V V E+ DG   + Y   + G+Y++ V++GG+ +PN  F  TA    Q   +   RS Q       A              GVN  ++     P DL             +V  PSG + +  IT  DN    + + Y PSE G H++ +      I GSP QF+VD    G VTA+GPGL+ G  N+ A FT+ TKDAG GGLSL +EGPSK EI C DN DGT  VSY+P  PG+Y+I++K+ +Q + GSPFTA +TG+  ++ S + VG++++IP+ I  +DLS LTA +  PS  + PC++K++ NG +G+SF PKETGEHLV+V + G  +  SP  V +   E+GDA++V+VSG+GL +G   +  EF IDTRDAGYG L++SIEGPSK +I+ +D E+G C V Y PTEPGNY+IN+ +A ++VPGSPF+V V G+  V    + + R + A     VG +C+++LKI E++++D+   V +PSG T   +I +  N    I+FV  E G H VSV +K +H+ GSPFQFTVG +  GG+  V A GPGLE+    +  EF+I+TREAGAG +++A+EGPSKAE+ F++ +D GSC V Y V +PGDYE S+KFN EHI +SPF + V   S
Sbjct: 1160 ASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQ--DHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPA----VDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLV--EPVDVVD---NADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGL--NTTGVPASLPVEFTIDAKDAGEGL-LAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEV------------DVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVN-GLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTIT--DNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRV---KESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKD-GSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS 2321          

HSP 2 Score: 248.825 bits (634), Expect = 0.000e+0
Identity = 126/283 (44.52%), Postives = 180/283 (63.60%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGH--YKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAE--KSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++A V +PSG +E   V +I   +Y V+F PRE G +L+ V+ N   I GSPF+I VG   +  DPG+V A G GL   +    A+F VNTSNAG+G+L+V IDGPSKV M+C E  +GY  TY   APG+Y+I+I YGG +HI GSPF A V G +  +N +  E  S      +   C  Q+       ++  K++ +GLGL +A +   +SF VD S+AG  +LLVG+ GP  PCEE++VKHVG+  ++V Y++K+ G + ++V+WGD+ IPGSP+ V V
Sbjct: 2356 IDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVV 2638          

HSP 3 Score: 487.649 bits (1254), Expect = 6.105e-140
Identity = 488/1659 (29.42%), Postives = 723/1659 (43.58%), Query Frame = 3
Query:   33 DLYEVTYRP-QECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLND-GIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIE---VCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPAT-LAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGL-LCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQES----------PLITEEPILSEQIKTL--------KAGNPHNPMQKANP--------------GKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQP------SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGK-QTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKV--NEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXX--XXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQ------VEKVKVDGDGIIPQNGA-ILASMPAVFHVNTKD-AGVNP-DVIVGLFNPNGE-----PMPLHIEARP------NGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVA----------VGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVN---------VHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKD-VTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNG-EHIVNSPF 4718
            + Y V Y P Q+ P    +   VT GG+ IP SPF++  +   + SK    +  L   V + + Q F VK    G + +    +   +G  V   +   +  +     + P + G + +  + DG PV  +P  +    E     +  KV+   P ++     +P  F + +  K      + + V  P    +        DGT  V++VP E G ++I     D  I  +P     +P  D  +   K S P    A   + GQ    CS     + T         + +  +   P  V  +    G     +IP   G Y++       P+   P  + V+ +          P I  + +  E             + G PH   + ANP              G     YT  EE +  + +   + S  P S    P       S+V V+G G++     +   FT++++ A +  +G+ VEGP EA + C+DN DG+C V Y     G Y++NV Y    +P SP  VPV+       D S V  SGPGLSP  V  +    F VD S+    G   ++  VQ P G  +   ++DN + G   V Y P+ EGP+ I+V Y    +  SPF VK  P  +A  V ASGPGL++  V  +   +F +D   AG G L + I  P     + H  DN DGT  V Y P   G Y I +K+  ++I  SP+ V      +     V   G     ++      T+D   AGK  +   V  P     D  V   +      GTFD+ Y   + G  +I V++    +  SPF+   +   Q      +   ++       Q G    A    +  VN  D   + P D+++      GE      MP    A+P      +G  T  Y   + G H++ +  D   +P SP              A   G    + VNK +  T+ TK+AG+G ++  ++   + ++                 ++ DG  SV Y+P   G+Y + VKY  Q +P   F           R T   S++  +S+    +A    +  IN  +     L A VV PSG   E P         ++ I + P E G H + V   G+ +  SP    +     G   RV   G GL  G T E AEF I T+DAG GGLSL +EGPSK +I  ED  DGT +V+Y P  PGNY I IKF DQ + GSPF+  +TGE   K  +           VG+  ++ LKIP   +  +TA++T+PS       I +  N    + F P E G H V+V  KG  +PGSPF+  V     G A KV+  G GLE+  A    EF+I TR+AG G L I++EGPSKAEI  +D ++G C V Y+  EPG+Y ++V +  +++P SPF        VVP  +   +  +  V + Q     E  LK+++ A   + +N         VH+PSG  E C + +       ++F+ RE+G++ + V     HI GSPF+  VG    GG    V+A G GLE G      EF + T  AGAG +SV ++GPSK +M  QE  +     VTY    PG Y  SIK+ G  HI  SPF
Sbjct:  931 NTYTVKYTPVQQGP----VGVNVTYGGDPIPKSPFSVAVSPSLDLSKI--KVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPL----EAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDT--KGAGTGGLGLTVEGPCEAQLECLDNG--DGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKV--KCSGPGLERATAGEVGQFQVDCSSAGSAELT---------IEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSV-DVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVH----DVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKA---GVAPLQVKVQGPKGLVEPVDVVDNAD-GTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENE-----DGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGV-VNKPATFTVNTKDAGEGGLSLAIEGPSKAEI--------------SCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPF---------TARVTGDDSMR--MSHLKVGSA---ADIPINISETDLSLLTATVVPPSG--REEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPF--------VVPVASPSGDARRLTVSSLQ-----ESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPE--GYRVTYTPMAPGSYLISIKYGGPYHIGGSPF 2504          

HSP 4 Score: 342.813 bits (878), Expect = 5.478e-107
Identity = 336/1218 (27.59%), Postives = 538/1218 (44.17%), Query Frame = 3
Query: 1230 KPDQPSSKVIVYGKGLEKVA--AKEKAIFTIDSKDAPSAPIGVTVEGPG----EAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKD---CFAKFTVDASEVSQNGQGTVKALVQSPSGKQ--TNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAE-IQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVV---QPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKA-GKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTK---GEGRVTAFGPGLSSGTTNEVAEFTIITKDA-GPGGLSLIVEGPSKTEIKCE-------DNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQV----------AVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISI--EGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKD-----LKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGS-KDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVED 4736
            +P     K   YG G+E      K++A FT++++ A    + V VE P     EA +   ++ + T  V Y   V G + + VL+   HI +SP  V V   D    D S VTA GPGL P G   +    F  FT  A      G G V+ ++Q P G++      ++   +  Y   Y PT EG H ++VT+ G+PI  SP+ V      N     A G GL     +V E   F V   GAG G L + ++GP   E ++  D  DG    EY P+  G Y +++ +  ++I  SPF V+V  E   +KV++ GP ++   + +   F ++        L   V  P            + +    G+ DV Y P+E G   + V  N   I  SPF  ++    Q    ++VK  G G+  +   +  + PA F V+ K  G  P + V + +  G P+   ++   NG Y+C Y       H   V   G  +P SP+ V      +P K  +   G  KT ++ ++ +  T++  EAG+G ++  + K     VG  E     D I+     + +   +V Y P+  G Y + V +  Q+ P          S    +        ++   EL       VN +   K  + V  +   +     + +V I   D++ +   + Y P ++GP  + V   G PI  SPF   V       + +V+  G  +  G      EFT+ +K A G G ++  + GPS   + C+       DN      V ++P+  G Y + + +   P+ GSPF       P K S+V          + G+ +   +    +    L   +  P + ++ C+     +G   VS+ P E G++ +N+    T IPGSPFK +V      DA+KVK SG GLE+  A +  +F +D   AG   L I I  E    AE+  +D+ +G  T+ Y+P  PG Y + + Y G+ VP  P  + VE       +T  ++     ++   V         +D  AL       +K  V  PSG      ++D G+G  ++++   E G+H V V +    +  SPFQ     VT G     V   GPG++ G  +  N+F + TR AG G + +A+EGPS+A+M   +++D GSC+V Y   + G Y  ++ + G  +  SPF + V D
Sbjct:  276 RPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYV---DKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGA------GTGEVEVVIQDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQ-------AKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGL--EKTGVAVNKPAEFTVDAKHGGKAP-LRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGI-KCAPGVVGPAEADIDFDIIR-----NDNDTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSG--LTKGDAVRDVDII--DHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLGEKVDVGKDQ---EFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNS----VVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVA-PTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECL--DNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVV--PCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVE----PAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQV---PVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKD-GSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHD 1444          

HSP 5 Score: 68.5514 bits (166), Expect = 5.478e-107
Identity = 80/297 (26.94%), Postives = 113/297 (38.05%), Query Frame = 2
Query: 4820 SITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKK--AKFFVNTSNAGSGSLNVAIDGPSKVNMNCH--ETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPF--TAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMV 5689
            S  V      +  L+  VQ P G +EP  V    DG   V + P   G + + V    + +  SPF++ V     D   V ASG GL+   V      +F ++  +AG G L V I  P       H  +  DG Y   YV    G Y I I YGG+  I  SP+   AV  G+ S   V        ++I                   E +I                  VD   AG G +   +  P     +V V    +  F + Y   + G ++I VR+G + +P SPF V
Sbjct: 1470 SFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKV-LPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGD-EIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQI-----------------GEETVIT-----------------VDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQV 1730          

HSP 6 Score: 365.155 bits (936), Expect = 4.695e-101
Identity = 354/1211 (29.23%), Postives = 547/1211 (45.17%), Query Frame = 3
Query: 1251 KVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDN-KNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIE------GPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP---IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGL----YTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVE-QIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTR-SVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF----FVDTKGEGRVTAFGPGL-SSGTTNEV-AEFTI----ITKDAGPGGLSLIVEGPSK--TEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAV----------GNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGL--ANQGNEFTIDTRDAGYGSLNISIEGPSKA--EIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPC-ETQKMERVQEAVKATQVGGNCEINLKIDEMALKD--LKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIY--TREAGAGNISVAMEGPSKAEMKFQ--ESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            KV  +G GLE     + A F +++       +G +VEGP +A I+C D GDG+C V Y     G Y ++VL ++  I  SP +  +  +D  ++     V A GPGL   GV  +  A+FTVDA      G+  ++  VQ   G     L+ +  NG Y   Y P +   H   V++ G+ I +SPF V    G +   V   GPG+     K +E T F VD   AG G + + I+      GPA+A+I      N + T  V+YTP  AG Y I V F D+    SP  V+V       KVK++GP       +L +P HFT++   AGK  L+V+ S    G + R V I         T+ V Y P + GP  ++V Y   PI  SPF   V     + K+KV G G       +       F V +K AG    V   +  P+G  +P  +E    GL        +   + G +++ V  DG P+P SP+ ++++    P K        +       +  TI+TK AG G +  TV+       G  E Q++ LD        + DG  SV Y+P E G+Y + + +    IP   F       F   +   +   ++   + E+         F+++       +L  ++   +G   EV I  + +  H I   Y P   G + + +   G+P+   P +      VDT G   V  +GPG+   G   E   EF++    +T+  GP  +   V  PS   TE   +D  DG +KV Y P   G +++ + +   P+  SPF   +T E    S+V V             ++  ++   +    L   +  PS+ K+ C+  K  +G+  V + P E G + +NV   G  +PGSPFKV V   +V DA+KVK SG GL  G+  AN    F +DT  AG   L + ++GP      +D  DN +G  TV Y+P+  G Y I+V Y  + VP SPF V     KV+P  +  K++     +  T V  +  +   ID     +  L V +  P G  +   I+D  +G   + +V   +G + + + +    I  SP++  V +V  G +   T +G G+    I I  E  I   T+ AG G ++  +  P  +E+     E++D G+  + Y   QPG Y   ++F GEH+ NSPF +
Sbjct:  578 KVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADI--RDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDA---KHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHD---NTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLG-----EKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEP---GLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVE-------GPCEAQLECLD--------NGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVG-------QFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTIT--YIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSG---VQCYGPGIEGQGVFREATTEFSVDARALTQTGGP-HVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVT-EGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNK--DGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPV--HDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKV-----KVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYR--VRAVPTGDASKCTVTGAGIGP-TIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENED-GTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQV 1730          

HSP 7 Score: 353.214 bits (905), Expect = 2.179e-97
Identity = 357/1200 (29.75%), Postives = 537/1200 (44.75%), Query Frame = 3
Query: 1266 GKGLE--KVAAKEKAIFTIDSKDAPSAPIGVTVEGP-GEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPG---FNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIEG----PADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP---IKDAKLLRPNHFTIDCSEAGKAPLEVKV-SKPGS-GISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNP-DVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIAS----VHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQ-FFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIV--EGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEP-VKKSQV----------AVGNSSEIPLKIPSSDLST-----LTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKID--EMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFI--DINNEFAIYTREAGAGNISVAMEGPSKAEMK--FQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            G+GL+   V  KE A F + +K A S  + VTV+GP GE  +   D GDG  G  Y   VPG Y + + +   +I +SP  V V            V A GPGL  EG      A F V+A     +  GT+   V+ PS  Q     D+  +G   VRY P E G + ++V      I+ SPF+   +     F+   V A GPGL      VN+  +F VD    G   L + ++     P +A ++  DN +GT    Y P K   +   V +    I +SPF V V     P KVK  GP       K   P +FT+DC+EAG+  + + +   PG  G ++  +    +      TF V Y P   G   I V +       SP +  V       KVK +G G+      +    P  F VN K AG    DV             + I    +  YT +Y     G   ++V   G P+PKSP++V   P+ +  K  + +G  + + V K+   T+++K AG GQ      K+  + VG         ++  KV+    G+ +    V ++P+EEG Y VEV Y G  +P   F        + V  T    V+         +A     F I+TK      L   V  P     E  +   DN      + Y P+E G + + +      I GSPF+   V      +V   GPGL   T  EV +F +    AG   L++ +  E     E+  +D+ DGT  ++Y+P  PG Y + IK+  QP+    F + +  EP V  S V           V   +     + +  L+      + A +  PS       ++   +G   V +TP E G H V+V   G+ +P SPF+V V   E  D ++V+V G G++ G  N+ N+FT++TR AG G L +++EGPS+A++ C DN++G C+V+Y+P E G Y +NVTY G  VPGSPF V V        +  K++     +    V  N   + ++D  +  +  L+V V  P G  EP D+ D  +G   + +V    G + +SVL+ D  +  SPF+  V  +    +  V ASGPGL    +   +  EF I  ++AG G ++V +  P     K   Q++ D G+  V Y     G Y   IK+ G+ I  SP+ +
Sbjct:  487 GRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKV----GTECGNQKVRAWGPGL--EGGVVGKSADFVVEAI---GDDVGTLGFSVEGPS--QAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVEALVK--DNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDN-DTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGL--SRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKV-SGLGEKVDVGKDQEFTVKSKGAG-GQ-----GKVASKIVGPSGA-----AVPCKVEP---GLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPF------PLEAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPC----EAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPN--FPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVT--EGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHD----VTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKV--LPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHD-GTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRV 1634          

HSP 8 Score: 323.553 bits (828), Expect = 3.283e-88
Identity = 340/1241 (27.40%), Postives = 546/1241 (44.00%), Query Frame = 3
Query: 1230 KPDQPSSKVIVYGKGLEKVAAK--EKAIFTIDSKDAPSAPIGVTVEG--PGEAV--IDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLID-NLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVN--PDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVN----FEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF-FVDTKGEGRVTAFGPGL-SSGTTNEV-AEFTIITKDAGPGGLSLIV---EG-PSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI--TGEPVKKS--------QVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVK------------VSGKGLEKGLANQGNEFTIDTRDAGY--------------GSLNISIEGPSK--AEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPS-KAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAARAVS 4772
            +P   +SKV   G GL +   +  +   FT+++K A    + V   G   G+AV  +D +D+ D T  V Y     G   +NV Y    IP+SP  V V P    +LDLS +  SG G   + V KD   +FTV +      GQG V + +  PSG      ++  L     VVR+ P EEGP+++ VTY+G+P+  SPF ++A        V A GPGL         +F +D  GAG G LGL +EGP +A+++C DN DGTC V Y P + GDY+I++ F D  I  SPF   VV      KVK  GP ++ A       F +DCS AG A L +++       +  P  +  ++    GT  + Y+P   G   + +KY   P+   P K  V        V+  G GI  Q   +       F V+ +       P V   + NP+G     +++ R +G+Y  EY  ++ G H + V  DG+P+P SP+ V      +P +  +     ++   NK +  T+ET+ AG G +   V+       G  E        K+   ++ DG  SV Y+P E G Y + V YGG  +P G  F+   +        +T + + + S    S      N    F+++T       L  KV  P G +E  P+   DN      ++Y PS  GP+ + V      +  SPF+   + T    +V A GPGL ++G    +  EFTI  KDAG G L++ +   EG P KT I  +DNHDGT+ V+YVP   G Y I+IK+    I  SP+      TG+  K +         + +G  + I +   ++    +T  + TP   +V   + +  +G   + +T  + G++++ V   G  +P SPF+V       GD   V+               +G ++  A +     ++  D                 G +   +  PS   A+    DN++G  TV+Y P+E G + +++ Y   ++PGSP    V+    V C    +      +    V       +   +     L + +  PS     C   D  +G   + ++    G + + V + ++H+ GSPF   V       + D +     L+ G      +  I   E     ++  +  PS + E    +    G   +++   + G++   +K NG+H+ +SP  +++    I   +   VS
Sbjct:  867 EPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSP----SLDLSKIKVSGLGEKVD-VGKD--QEFTVKSK--GAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSE----AGLPAEV-YIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQ--GVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVE-------GPSEA-------KMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVP-GSPFKVPVHD-------VTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVE--PVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHI--QDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTAL---AGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVD---YVNC--GHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISC--TDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARV-------TGDDSMRMSHLKVGSA---ADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVS 2045          

HSP 9 Score: 298.901 bits (764), Expect = 1.301e-80
Identity = 421/1693 (24.87%), Postives = 674/1693 (39.81%), Query Frame = 3
Query:   42 EVTYRPQECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDED-----SKYIG-TLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPM-IEVCAPQTFKVLSPEK--------------VINPDLVDV--QVLNPENKIIPIHKEAAPDGTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKD--------------NTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPI--LSEQ----------IKTLKAGNPH-------NPMQKANPGK---------SNKPYTALEEAIKEMKESA----VESSKWPQS--KPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEK--TQFVVD---LDGAGHGSLGLAIEGPAD--AEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKC-AIKAGKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQN---QISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFV--------------------DTKGEGRVTAFGP-----GLSSGTTNEVAEF-TIITKDAGPGGLSLIVEGPSK--TEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPF--------TANITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDC--KDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGN---CEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV---GSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPS--KAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            +V Y PQE     A+H  V    EDI  SPF        +D      K  G  LE  K  V + +P  F V    G K+   V V D  G PVE  LVK     TY  +Y P K  +H    S  G  +  +P  V+V      N  K+   G+A   ++   P  F V   E               V+ P   D+   ++  +N           D   V + P+  G ++I     DQ    +P  VK  P  D  +   +    +   VE     + KP  FT+                    D + D D++    D+H                ++ P + GP  +  +   +PI  SP ++ V  S  +++  +  L E+          +K+  AG           P   A P K         S   +   EE   E++ +     V  S +P     P +P SKV  +G GL+  +A   A FTID+K A +  +G+TVEGP EA ++C+DNGDGTC V Y    PG Y IN+L+ + HIP SP    V P      D S V  SGPGL  E        +F VD S     G   +   + S +G      I +  +G + + Y P   G + + + Y G P+ + P  ++ +P  +   V   GPG+    V  +  T+F VD   L   G   +   +  P+    E    D  DG   VEYTP + G + + V ++   +  SPF V V +   P +V+  GP I+     +PN FT++   AG   L + V  P    S+  ++    +    G+  V Y+P E G   ++V Y    + GSPFK  V       KVK  G G+ P  G + A++P  F V+T  AGV P + V +  P G   P+ +    +G  T  Y     G + ISV      +P+SP+ VK +PT +  K  A   G + T +  +     TI+ K+AG+G +   +   E +              K  +Q++ DG  +V Y+P   G Y + +KYGG  IP   +   A  +    + T+T +      QI  E            ++TK      +   V  P G   +V +  N++      I Y   + G + + V   G  +  SPFQ                        T  +G    + P     G++      +  F  +I      G ++  V  PS    +    DN DGT  V Y P   G + + I++ +  I GSP           ++T      +   V   +   +    +    L+  +  PSK ++ C   +  +G   VS+ P   G++ + V      +PGSPF   V  ++    + +KV              +  I+  +     L  ++  PS  E  C  K   NG   + ++P E G ++++V   G++V  SP  V +        E     RV+ + +    G      E  +   +     L +++  PS      + ED  +G  R+ +   E G + +++   D+H+ GSPF   V   G V     + +T          +  + + ++   E    +++  +  PS    E +  E ++   C + +  ++ G +  S+K+ G+H+  SPF   V
Sbjct:  632 DVRYWPQEA-GEYAVH--VLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLE--KTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVE-ALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDN-----------DTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVE-----LGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDII----DHHD----------NTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKP-SKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVP----CFDASKVKCSGPGL--ERATAGEVGQFQVDCSSA---GSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGP----SEAKMSCMDNKD---GSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSP--GMVRANLPQSFQVDTSKAGVAP-LQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPK------------KTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQIGEETV--------ITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENED--GTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQ--DGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKV----------GSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS-----QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVD--INTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRV----KESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYC-IRFVPAEMGTHTVSVKYKGQHVPGSPFQFTV 2222          

HSP 10 Score: 276.559 bits (706), Expect = 9.033e-74
Identity = 329/1239 (26.55%), Postives = 514/1239 (41.49%), Query Frame = 3
Query: 1224 QSKPDQPSSKVIVYGKGLEKVAAKEKAI--FTIDSKDAPSA---PIGVTVEGPGEAVIDCV--DNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIEGPADA--EIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLL---RPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPE------------KCAIKAGKDKT-------IQVNKESVITIETKEA------GKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKC--EDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLK----------------IPSSD--LSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGN--EFTIDTRDAGYGSLNISIEGPS--KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVE-----GDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGA-GNISVAMEGPSKA-EMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            Q +P   +S V  YG G+E      +A   F++D++         +   V  P   + +    D GDG   V Y     GL++++V YD   +P SP  VPV     +  D S V   GPG+      K    KFTV   E    G G +   V+ PS  + +  +DN  +G   V Y P E G + +NVTY G  +  SPF V      +A  V  SGPGL     + N    F VD   AG   L + ++GP      +   DN DGT  V Y P + G Y ISV + DE++  SPF V+V+      KVK+ GP  +   +    P  FTID  +AG+  L V+++ P      +P     ++    GT+ V YVP+  G   I +KY    I  SP++   V      K  V G GI P    I      V  V+TK AG    V   +  P+G  + + +    +G +   Y     G + I V   G  +P SP+ V ++    P             +     G  +T       + VN   V ++   +        KG+IT  V    R   G+V Q  + D        + DG  +V Y P E G + ++++Y    IP         Y            + + + N+ A+       F +NTKD     L+  +  PS    +  I+  DN      + Y P   G + + V    + + GSPF   V      R++    G ++     ++E  +         L+  V  PS  E  C  +   +G   +S+VP+  G + + +K   Q +A SP        PV  SQ  +G++S + +                 I + D     L+  +  PSK+ +    + + +G   V++ P E G +++N+      +PGSPF V V  E      K  ++ +     +AN G+  + ++   +     +   +  PS    E +  + EN    ++++P E G + ++V Y G++VPGSPF   V      G   V      +ER +  V A       E ++   E     L + V  PS        ED  +G+  + +V +E G + VSV   + HI  SPF   V S + G ++ +T S   L++  + +N   +      GA G I   +  PS A E  +    D+   AV +   + G Y   +KFNG HI  SPF I V
Sbjct: 1248 QVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPV----TEGCDPSRVRVHGPGIQSGTTNKP--NKFTV---ETRGAGTGGLGLAVEGPSEAKMS-CMDN-KDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDP----EGKPKKT-HIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGP---TIQIGEETVITVDTKAAGKG-KVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEV----RMPSGKVAQPTITD--------NKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPAT-------FTVNTKDAGEGGLSLAIEGPS----KAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSL-------LTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPI-------PVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDIN--TEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGE---GRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPA-------EFSIWTREAGAGGLAIAVEGPS--KAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS-GDARRLTVSS--LQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRV 2412          

HSP 11 Score: 254.218 bits (648), Expect = 5.524e-67
Identity = 274/1055 (25.97%), Postives = 440/1055 (41.71%), Query Frame = 3
Query: 1224 QSKPDQPSSKVIVYGKGLE-KVAAKEKAIFTIDSKDAPSAPIGVTVEGP--GEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAK-FTVDASEVSQNG------------------QGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSP--FIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQP--AQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTI-QVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDT-KGEGRVTAFGPGLSSGT-TNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKC---EDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAV-------------GNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNV-YEKGTDIPGSPFKVNVKNEEV---------------------------------GDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSK--AEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNV 4145
            ++ P   +SK  V G G+   +   E+ + T+D+K A    +  TV  P   E  +D V+N DGT  + Y  P PG Y I V +   H+P SP  V     D  ++     +     L+P+  +     + +  +   V  NG                  +G +   V+ PSGK     I +  +G   VRY P+E G H++++ Y+ + I  SP  F V      N   VTA GPGL    VN+   F V+   AG G L LAIEGP+ AEI C DN+DGTC V Y PV  GDY I VK+N++ +  SPF   V  +           +   K+       I+ SE   + L   V  P     + P  +K++     G   + +VP+E G  L+ VK N   ++ SP    + Q       +V+V G G+    G      PA F ++T+DAG    + + +  P+   + ++ E   +G     Y   + G++ I++      +P SP++VK    G  ++   +  +  ++  V     ++++  E     +T  V        G+  + +++        E  +    + ++P E G + V VKY GQ +P   F     ++   + E     V+        + A     F I T++     L   V  PS    +  I+  D    +  + Y   E G +++ V      I  SPF   V +  G+ R         SG   N+ A F  ++ +   G +   V  PS    +C   E + D  + V ++P+  G Y I +KF    I GSPF   + GEP       +             GN +E  +   ++    L+  +  PSK+K+ C  ++   G   V++TP   G +L+++ Y     I GSPFK  V    +                                  DA+KV   G GL K    Q + FT+D   AG   L + + GP     EI  K   + + +V YL  + G Y + V +  +++PGSP+ V V
Sbjct: 1635 RAVPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQ---LAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDY---VNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMR-------MSHLKVGSAADIPINISETDLSLLTATVVPPSG--REEPCLLKRLRN---GHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGL--HEGHTFE--PAEFIIDTRDAGYG-GLSLSIEGPS--KVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVT----SPSGKTHEAEIV--------EGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPF----QFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPS----KAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFA-VSLNGAKGAIDAKVHSPSGALEECYVTEIDQD-KYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRV-GEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDC--QECPEG-YRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVV 2638          

HSP 12 Score: 164.851 bits (416), Expect = 9.076e-40
Identity = 175/666 (26.28%), Postives = 276/666 (41.44%), Query Frame = 3
Query:  636 VTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLL-CEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEE-----------------------PILSEQIKTLKAGNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQP------------SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVY--PKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNG-QGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVK-AKPGFNAQ--LVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFND-EDISDSPF------------HXXXXXXXXXXXXXSK------------GPIKDAKLL------------RPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNV 2396
            ++FVPKE G H +      Q +  +P  V  + +++I +A   + S   L     EG   +P  F I   +T D    +  + LS +    + + ++ L  G     + P + G Y +     +  + GSP ++ V     + E                        P +S Q  T +  +P     +A   +       +     EM    V      Q  P  P            + KV   G GLE+  A   A F+I +++A +  + + VEGP +A I   D  DG+CGV Y V  PG Y ++V ++  HIP SP VVPV     D + L +S++  SG  ++    F             VS NG +G + A V SPSG      +  ++  KY VR+ P E G + I+V + G  I  SPF ++  +PG      LV+A G GL         +FVV+   AG G+L + I+GP+  ++ C +  +G   V YTP+  G Y IS+K+     I  SPF            H             +K            GP   +K++            + + FT+DCS+AG   L V V  P +   +  + +K V       + V Y+ ++ G   + VK+    I GSP++  V
Sbjct: 2001 ISFVPKETGEHLVHVKKNGQHVASSPIPV-VISQSEIGDASRVRVSGQGL----HEGHTFEPAEFII---DTRD--AGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFA------------VSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGY-RVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEE--ILVKHV---GSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVV 2638          

HSP 13 Score: 130.568 bits (327), Expect = 2.769e-29
Identity = 97/284 (34.15%), Postives = 134/284 (47.18%), Query Frame = 2
Query: 4853 PKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLK--QARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            P ++A V  PSGN+    VQ  GDG Y V+++P E G H V V  +  P+  SPF++PV     DP  V   G G+     +K  KF V T  AG+G L +A++GPS+  M+C + +DG     Y+    G Y +N+TYGG+  + GSPF   V                                    ++  K+ C G GL     R N   SF VD S+AG   L V + GP    E V V    +   TV+YV    G + I V +GD+++P SPF V V
Sbjct: 1291 PHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTE-GCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGH-QVPGSPFKVPVH---------------------------------DVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKV 1539          

HSP 14 Score: 124.405 bits (311), Expect = 1.654e-27
Identity = 87/298 (29.19%), Postives = 142/298 (47.65%), Query Frame = 2
Query: 4808 GGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            G    I +   + ++  L A+V  PSG  EP +++++ +G  G+ F P+E G HLV V+ N + +  SP  + +   +  D   V  SG+GL      + A+F ++T +AG G L+++I+GPSKV++N  + EDG    TY  T PGNYIINI +  + H+ GSPF+  V G              +V+   + +R     A   S       C  L LK   ++  +             +   +  P     E  +    N+ + + +V  E GTH + V++  + +PGSPF   V
Sbjct: 1958 GSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKF-ADQHVPGSPFSVKVTG------------EGRVKESITRRRRAPSVANVGSH------CD-LSLKIPEISIQD-------------MTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTV 2222          

HSP 15 Score: 110.923 bits (276), Expect = 1.995e-23
Identity = 81/300 (27.00%), Postives = 133/300 (44.33%), Query Frame = 2
Query: 4811 GLISITVRAEDGEIP------KLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMV 5689
            GL   ++R  D  IP      ++   V+ PSG +    +    DG   V+++P E G H + +  +   I GSP +  V +     G V A G GL+H +V+K A F VNT +AG G L++AI+GPSK  ++C + +DG    +Y+   PG+Y I + Y    H+ GSPFTA V G+ S                                         + +   ++ S     ++ S+    +L   +  P    E  ++K + N    + +V KE+G H++ V+   + +  SP  V
Sbjct: 1774 GLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNC--GHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQ-HVPGSPFTARVTGDDS-----------------------------------------MRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPV 2029          

HSP 16 Score: 100.138 bits (248), Expect = 3.968e-20
Identity = 78/300 (26.00%), Postives = 132/300 (44.00%), Query Frame = 2
Query: 4802 DAGGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHY-KADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            + G    ++++  +  I  + A V +PSG    A + +  +  Y ++F P E GTH V V+   + + GSPF+  VG   +     V A G GL  A     A+F + T  AG+G L +A++GPSK  ++  + +DG     YV   PG+Y +++ +    HI  SPF   V                                   S +  ++    L     ++N   SF V  + A  G +   +  P    EE  V  +  +++ V ++ +E+G ++I V++    IPGSPF + V
Sbjct: 2147 NVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKF-NEEHIPDSPFVVPV--------------------------------ASPSGDARRLTVSSLQESGLKVNQPASFAVSLNGA-KGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRV 2412          

HSP 17 Score: 95.5153 bits (236), Expect = 9.371e-19
Identity = 82/283 (28.98%), Postives = 125/283 (44.17%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQ-IGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            K+ + +  PSG   P  V+  +G     V+F PRE G + V V  +  P+ GSPF +        P  V A G GL        A+F ++T  AG+G L + ++GP +  + C +  DG    +YV T PG+Y INI +  + HI GSPF A                H     +AS                 K+ C G GL++A    V  F VD S AG   L + I        EV ++  G+   T+ Y+    G + + +++G + +P  P  + V+
Sbjct: 1003 KVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEA-VAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF-ADTHIPGSPFKA----------------HVVPCFDAS-----------------KVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVE 1250          

HSP 18 Score: 92.4337 bits (228), Expect = 8.774e-18
Identity = 86/333 (25.83%), Postives = 146/333 (43.84%), Query Frame = 3
Query: 3795 EHLVNVY----EKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLE--KGLANQGNEFTIDTRDAGYGSLNISIEGPS----KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEM-----ALKDLKVNVHTP---SGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVG-SVTPGGSKDVTASGPGLEKGFIDINN--EFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            EH V  Y     K    PG+P +  +      +  K +  G G+E    +  +  EFT++TR AG G + + +E P+    +A++   +++N   +V Y+P   G + + V +AG+++  SPF V V+  +          +V       +  GN        E+        +++V +  P    G  EP  +E  G+   R  +     G+H V V      I  SP+  TVG +  P   + V   G GL+   + +    +F +YT+ AG+G + V ++GP   E   Q+    G     Y    PG Y  +I + G++I  SPF + V
Sbjct:  254 EHSVMTYLSQFPKAKLKPGAPLRPKL------NPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQ------GDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVIQDPMGQKGTVEP-QLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPSACRAV---GRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKV 570          

HSP 19 Score: 91.6633 bits (226), Expect = 1.676e-17
Identity = 102/352 (28.98%), Postives = 139/352 (39.49%), Query Frame = 2
Query: 4856 KLEASVQTP---SGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSH--AIVDKKAKFFVNTSNAGSGSLNVAIDGPS-KVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVV----------------EG---NKSATNVNQE------------EQHSQVEIEASDK---RC-VSQYAEKSSSNVEKIIC----------------------------QGLGLKQA--RLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++E  +Q P    G +EP + +  GD  Y   + P   G H V V     PI  SP+ + VG    +P    A G GL      V + A F V T  AGSG L V + GP  +  +   +  DG Y F Y    PG YI+ IT+GG  +I  SPF   V                EG    KSA  V +             E  SQ +IE  DK    C V  + +++      ++C                            +G GL++    +N    F VDA   G   L V +        E +VK  GN  ++  YV ++   H  MV WG   IP SPF V+V
Sbjct:  415 EVEVVIQDPMGQKGTVEPQL-EARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQ-ACNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQ-NIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNV 763          

HSP 20 Score: 77.411 bits (189), Expect = 3.710e-13
Identity = 78/308 (25.32%), Postives = 137/308 (44.48%), Query Frame = 2
Query: 4817 ISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFR---IPVGHYKADPGMVHASGEGLSHAI-VDKKAKFFVNTSNAGSGSLNVAIDGP--SKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPF-TAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKII-CQGLGLKQAR-LNSVNSFFVDASQAGYGILLVGIAGPVR-PCEEVVVKHVGNNQ---FTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            +  T+ A+D     L   +  P G  +   +Q   DG Y V + P   G + + ++     I  SP+R   +P G    D      +G G+   I + ++    V+T  AG G +   +  P  S+V+++  E EDG ++  Y A  PG Y+I + +GG  H+  SPF    + G++ +    Q    SQ   + + +   +Q  +++ +    ++   GL +   R  + V  F +   +         I G VR P  +V    + +N+    TV Y   E+G H + +R+ +  IPGSP   +VD
Sbjct: 1566 VEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTG----DASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGE-HVPNSPFQVTALAGDQPSV---QPPLRSQ---QLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGE---------ITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVD 1853          

HSP 21 Score: 73.559 bits (179), Expect = 4.657e-12
Identity = 78/284 (27.46%), Postives = 116/284 (40.85%), Query Frame = 2
Query: 4871 VQTPSGNMEPAIVQQIGDGQ--YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGL--SHAIVDKKAKFFVNTSNAGSGSLNVAIDGP----SKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            V+ P+G+ E A V    D    + V + P   GTH V V    + I  SPF + V   + D   V A G GL  S  I +K   F + T+ AG+G + V I  P      V        D  Y  +Y  T  G + +++T+ G   I  SP+T  V                                +  + +  + + +GL  K  R+     F V    AG G L V + GP +  E V  K +G+  +  +Y     GT+I+ + WG ++I  SPF V V
Sbjct:  320 VEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVIQDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAG-VPIPRSPYTVTV-------------------------------GQACNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGP-KGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKV 570          

HSP 22 Score: 62.7734 bits (151), Expect = 7.915e-9
Identity = 62/261 (23.75%), Postives = 101/261 (38.70%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNC--HETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            DG   V + P   G + + V+ N++ + GSPF         D  M       +SH  V   A   +N S      L   +  PS     C      +G+   ++V    G +++++   G  H+  SP   V+               SQ EI                 +  ++   G GL +        F +D   AGYG L + I GP +   ++  + + +    V Y   E G +II +++ D+ +PGSPF V V
Sbjct: 1909 DGTCSVSYLPVLPGDYSILVKYNEQHVPGSPF---TARVTGDDSMR------MSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQ-HVASSPIPVVI---------------SQSEI----------------GDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSK--VDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKV 2126          

HSP 23 Score: 60.8474 bits (146), Expect = 3.592e-8
Identity = 73/306 (23.86%), Postives = 118/306 (38.56%), Query Frame = 2
Query: 4823 ITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVD--KKAKFFVNTSNAGSGSLNVAID------GPSKVNMN---CHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQA--RLNSVNSFFVDASQAGYGILLVGIAGPVR--PCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
             TV A+ G    L   VQ   G    A+V+  G+G Y   + PR+   H   V      I  SPFR+ VG   + P  V   G G++   +   +   F V+ + AG G +++ I       GP++ +++        D +   Y     G+Y I + +                        +Q    S + ++            + S +  K+  +G GL +    L     F V+A  AG G L V  +G  +     +V +    +N +TV Y   + G   + V +G   IP SPF V V
Sbjct:  695 FTVDAKHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGA-GSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTPRGAGSYTIMVLF-----------------------ADQATPTSPIRVKV-----------EPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAV 965          
BLAST of Filamin-A vs. Ensembl Human
Match: FLNA (filamin A [Source:HGNC Symbol;Acc:HGNC:3754])

HSP 1 Score: 808.135 bits (2086), Expect = 0.000e+0
Identity = 493/1203 (40.98%), Postives = 690/1203 (57.36%), Query Frame = 3
Query: 1245 SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEG----PGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLR---PNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAG---------KDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNA---------FHGVNFEINTKDGVPVDL-----------NAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGE-PVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDS 4742
            +SKV   G GLE+  A E   F +D   A SA + + +      P E  I   D+GDGT  + Y    PG YT+ + Y    +P  P  + V P     +D S V   GPG+  +GVF++   +F+VDA  ++Q G   VKA V +PSG  T   + +  +G Y V YTP EEG H ++VTY+G P+  SPF V    G +   V   GPG+ S   N+  +F V+  GAG G LGLA+EGP++A++ C DNKDG+C VEY P +AG Y ++V +    +  SPF V V D     KVK  GP     ++R   P  F +D S+AG APL+VKV  P   +   PV +      A GT  V YVP   GP  I V Y    +  SPFK  V+      KVK  G G+      + AS+P  F ++ KDAG    + V + +P G+P   HI+   +G YT  Y     G + I +   G  +P SPY V+++PTG+  KC +               TIQ+ +E+VIT++TK AGKG++TCTV   +  +V             V V E+ DG   + Y   + G+Y++ V++GG+ +PN  F  TA    Q   +   RS Q       A              GVN  ++     P DL             +V  PSG + +  IT  DN    + + Y PSE G H++ +      I GSP QF+VD    G VTA+GPGL+ G  N+ A FT+ TKDAG GGLSL +EGPSK EI C DN DGT  VSY+P  PG+Y+I++K+ +Q + GSPFTA +TG+  ++ S + VG++++IP+ I  +DLS LTA +  PS  + PC++K++ NG +G+SF PKETGEHLV+V + G  +  SP  V +   E+GDA++V+VSG+GL +G   +  EF IDTRDAGYG L++SIEGPSK +I+ +D E+G C V Y PTEPGNY+IN+ +A ++VPGSPF+V V G+  V    + + R + A     VG +C+++LKI E++++D+   V +PSG T   +I +  N    I+FV  E G H VSV +K +H+ GSPFQFTVG +  GG+  V A GPGLE+    +  EF+I+TREAGAG +++A+EGPSKAE+ F++ +D GSC V Y V +PGDYE S+KFN EHI +SPF + V   S
Sbjct: 1133 ASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQ--DHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPA----VDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLV--EPVDVVD---NADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGL--NTTGVPASLPVEFTIDAKDAGEGL-LAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEV------------DVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVN-GLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTIT--DNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRV---KESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKD-GSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS 2302          

HSP 2 Score: 248.44 bits (633), Expect = 0.000e+0
Identity = 126/283 (44.52%), Postives = 180/283 (63.60%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGH--YKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAE--KSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++A V +PSG +E   V +I   +Y V+F PRE G +L+ V+ N   I GSPF+I VG   +  DPG+V A G GL   +    A+F VNTSNAG+G+L+V IDGPSKV M+C E  +GY  TY   APG+Y+I+I YGG +HI GSPF A V G +  +N +  E  S      +   C  Q+       ++  K++ +GLGL +A +   +SF VD S+AG  +LLVG+ GP  PCEE++VKHVG+  ++V Y++K+ G + ++V+WGD+ IPGSP+ V V
Sbjct: 2337 IDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVV 2619          

HSP 3 Score: 484.182 bits (1245), Expect = 8.035e-139
Identity = 489/1667 (29.33%), Postives = 723/1667 (43.37%), Query Frame = 3
Query:   33 DLYEVTYRP-QECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLND-GIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIE---VCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPAT-LAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGL-LCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQES----------PLITEEPILSEQIKTL--------KAGNPHNPMQKANP--------------GKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQP------SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGK-QTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKV--NEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDA----------KLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQ------VEKVKVDGDGIIPQNGA-ILASMPAVFHVNTKD-AGVNP-DVIVGLFNPNGE-----PMPLHIEARP------NGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVA----------VGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVN---------VHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKD-VTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNG-EHIVNSPF 4718
            + Y V Y P Q+ P    +   VT GG+ IP SPF++  +   + SK    +  L   V + + Q F VK    G + +    +   +G  V   +   +  +     + P + G + +  + DG PV  +P  +    E     +  KV+   P ++     +P  F + +  K      + + V  P    +        DGT  V++VP E G ++I     D  I  +P     +P  D  +   K S P    A   + GQ    CS     + T         + +  +   P  V  +    G     +IP   G Y++       P+   P  + V+ +          P I  + +  E             + G PH   + ANP              G     YT  EE +  + +   + S  P S    P       S+V V+G G++     +   FT++++ A +  +G+ VEGP EA + C+DN DG+C V Y     G Y++NV Y    +P SP  VPV+       D S V  SGPGLSP  V  +    F VD S+    G   ++  VQ P G  +   ++DN + G   V Y P+ EGP+ I+V Y    +  SPF VK  P  +A  V ASGPGL++  V  +   +F +D   AG G L + I  P     + H  DN DGT  V Y P   G Y I +K+  ++I  SP+ V  V      K      I             ++      T+D   AGK  +   V  P     D  V   +      GTFD+ Y   + G  +I V++    +  SPF+   +   Q      +   ++       Q G    A    +  VN  D   + P D+++      GE      MP    A+P      +G  T  Y   + G H++ +  D   +P SP              A   G    + VNK +  T+ TK+AG+G ++  ++   + ++                 ++ DG  SV Y+P   G+Y + VKY  Q +P   F           R T   S++  +S+    +A    +  IN  +     L A VV PSG   E P         ++ I + P E G H + V   G+ +  SP    +     G   RV   G GL  G T E AEF I T+DAG GGLSL +EGPSK +I  ED  DGT +V+Y P  PGNY I IKF DQ + GSPF+  +TGE   K  +           VG+  ++ LKIP   +  +TA++T+PS       I +  N    + F P E G H V+V  KG  +PGSPF+  V     G A KV+  G GLE+  A    EF+I TR+AG G L I++EGPSKAEI  +D ++G C V Y+  EPG+Y ++V +  +++P SPF        VVP  +   +  +  V + Q     E  LK+++ A   + +N         VH+PSG  E C + +       ++F+ RE+G++ + V     HI GSPF+  VG    GG    V+A G GLE G      EF + T  AGAG +SV ++GPSK +M  QE  +     VTY    PG Y  SIK+ G  HI  SPF
Sbjct:  904 NTYTVKYTPVQQGP----VGVNVTYGGDPIPKSPFSVAVSPSLDLSKI--KVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPL----EAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDT--KGAGTGGLGLTVEGPCEAQLECLDNG--DGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKV--KCSGPGLERATAGEVGQFQVDCSSAGSAELT---------IEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSV-DVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVH----DVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKA---GVAPLQVKVQGPKGLVEPVDVVDNAD-GTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENE-----DGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGV-VNKPATFTVNTKDAGEGGLSLAIEGPSKAEI--------------SCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPF---------TARVTGDDSMR--MSHLKVGSA---ADIPINISETDLSLLTATVVPPSG--REEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPF--------VVPVASPSGDARRLTVSSLQ-----ESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPE--GYRVTYTPMAPGSYLISIKYGGPYHIGGSPF 2485          

HSP 4 Score: 342.428 bits (877), Expect = 5.299e-107
Identity = 336/1218 (27.59%), Postives = 538/1218 (44.17%), Query Frame = 3
Query: 1230 KPDQPSSKVIVYGKGLEKVA--AKEKAIFTIDSKDAPSAPIGVTVEGPG----EAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKD---CFAKFTVDASEVSQNGQGTVKALVQSPSGKQ--TNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAE-IQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVV---QPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKA-GKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTK---GEGRVTAFGPGLSSGTTNEVAEFTIITKDA-GPGGLSLIVEGPSKTEIKCE-------DNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQV----------AVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISI--EGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKD-----LKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGS-KDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVED 4736
            +P     K   YG G+E      K++A FT++++ A    + V VE P     EA +   ++ + T  V Y   V G + + VL+   HI +SP  V V   D    D S VTA GPGL P G   +    F  FT  A      G G V+ ++Q P G++      ++   +  Y   Y PT EG H ++VT+ G+PI  SP+ V      N     A G GL     +V E   F V   GAG G L + ++GP   E ++  D  DG    EY P+  G Y +++ +  ++I  SPF V+V  E   +KV++ GP ++   + +   F ++        L   V  P            + +    G+ DV Y P+E G   + V  N   I  SPF  ++    Q    ++VK  G G+  +   +  + PA F V+ K  G  P + V + +  G P+   ++   NG Y+C Y       H   V   G  +P SP+ V      +P K  +   G  KT ++ ++ +  T++  EAG+G ++  + K     VG  E     D I+     + +   +V Y P+  G Y + V +  Q+ P          S    +        ++   EL       VN +   K  + V  +   +     + +V I   D++ +   + Y P ++GP  + V   G PI  SPF   V       + +V+  G  +  G      EFT+ +K A G G ++  + GPS   + C+       DN      V ++P+  G Y + + +   P+ GSPF       P K S+V          + G+ +   +    +    L   +  P + ++ C+     +G   VS+ P E G++ +N+    T IPGSPFK +V      DA+KVK SG GLE+  A +  +F +D   AG   L I I  E    AE+  +D+ +G  T+ Y+P  PG Y + + Y G+ VP  P  + VE       +T  ++     ++   V         +D  AL       +K  V  PSG      ++D G+G  ++++   E G+H V V +    +  SPFQ     VT G     V   GPG++ G  +  N+F + TR AG G + +A+EGPS+A+M   +++D GSC+V Y   + G Y  ++ + G  +  SPF + V D
Sbjct:  249 RPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYV---DKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGA------GTGEVEVVIQDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQ-------AKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGL--EKTGVAVNKPAEFTVDAKHGGKAP-LRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGI-KCAPGVVGPAEADIDFDIIR-----NDNDTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSG--LTKGDAVRDVDII--DHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLGEKVDVGKDQ---EFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNS----VVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVA-PTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECL--DNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVV--PCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVE----PAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQV---PVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKD-GSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHD 1417          

HSP 5 Score: 68.9366 bits (167), Expect = 5.299e-107
Identity = 80/297 (26.94%), Postives = 114/297 (38.38%), Query Frame = 2
Query: 4820 SITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKK--AKFFVNTSNAGSGSLNVAIDGPSKVNMNCH--ETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPF--TAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMV 5689
            S  V      +  L+  VQ P G +EP  V    DG   V + P   G + + V    + +  SPF++ V     D   V ASG GL+   V      +F ++  +AG G L V I  P       H  +  DG Y   YV    G Y I I YGG+  I  SP+   AV  G+ S   V                  VS       + +   I         ++       VD   AG G +   +  P     +V V    +  F + Y   + G ++I VR+G + +P SPF V
Sbjct: 1443 SFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKV-LPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGD-EIPFSPYRVRAVPTGDASKCTVT-----------------VSIGGHGLGAGIGPTI---------QIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQV 1711          

HSP 6 Score: 355.14 bits (910), Expect = 5.698e-98
Identity = 352/1218 (28.90%), Postives = 544/1218 (44.66%), Query Frame = 3
Query: 1251 KVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDN-KNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIE------GPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP---IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGL----YTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVE-QIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTR-SVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF----FVDTKGEGRVTAFGPGL-SSGTTNEV-AEFTI----ITKDAGPGGLSLIVEGPSK--TEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAV----------GNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGL--ANQGNEFTIDTRDAGYGSLNISIEGPSKA--EIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPC-ETQKMERVQEAVKATQVGGNCEINLKIDEMALKD--LKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTAS-------GPGLEKGFIDINNEFAIY--TREAGAGNISVAMEGPSKAEMKFQ--ESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            KV  +G GLE     + A F +++       +G +VEGP +A I+C D GDG+C V Y     G Y ++VL ++  I  SP +  +  +D  ++     V A GPGL   GV  +  A+FTVDA      G+  ++  VQ   G     L+ +  NG Y   Y P +   H   V++ G+ I +SPF V    G +   V   GPG+     K +E T F VD   AG G + + I+      GPA+A+I      N + T  V+YTP  AG Y I V F D+    SP  V+V       KVK++GP       +L +P HFT++   AGK  L+V+ S    G + R V I         T+ V Y P + GP  ++V Y   PI  SPF   V     + K+KV G G       +       F V +K AG    V   +  P+G  +P  +E    GL        +   + G +++ V  DG P+P SP+ ++++    P K        +       +  TI+TK AG G +  TV+       G  E Q++ LD        + DG  SV Y+P E G+Y + + +    IP   F       F   +   +   ++   + E+         F+++       +L  ++   +G   EV I  + +  H I   Y P   G + + +   G+P+   P +      VDT G   V  +GPG+   G   E   EF++    +T+  GP  +   V  PS   TE   +D  DG +KV Y P   G +++ + +   P+  SPF   +T E    S+V V             ++  ++   +    L   +  PS+ K+ C+  K  +G+  V + P E G + +NV   G  +PGSPFKV V   +V DA+KVK SG GL  G+  AN    F +DT  AG   L + ++GP      +D  DN +G  TV Y+P+  G Y I+V Y  + VP SPF V     KV+P  +  K++     +  T V  +  +   ID     +  L V +  P G  +   I+D  +G   + +V   +G + + + +    I  SP++  V +V  G +   T +               I I  E  I   T+ AG G ++  +  P  +E+     E++D G+  + Y   QPG Y   ++F GEH+ NSPF +
Sbjct:  551 KVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADI--RDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDA---KHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHD---NTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLG-----EKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEP---GLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVE-------GPCEAQLECLD--------NGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVG-------QFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTIT--YIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSG---VQCYGPGIEGQGVFREATTEFSVDARALTQTGGP-HVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVT-EGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNK--DGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPV--HDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKV-----KVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYR--VRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENED-GTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQV 1711          

HSP 7 Score: 353.214 bits (905), Expect = 2.517e-97
Identity = 357/1200 (29.75%), Postives = 537/1200 (44.75%), Query Frame = 3
Query: 1266 GKGLE--KVAAKEKAIFTIDSKDAPSAPIGVTVEGP-GEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPG---FNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIEG----PADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP---IKDAKLLRPNHFTIDCSEAGKAPLEVKV-SKPGS-GISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNP-DVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIAS----VHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQ-FFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIV--EGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEP-VKKSQV----------AVGNSSEIPLKIPSSDLST-----LTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKID--EMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFI--DINNEFAIYTREAGAGNISVAMEGPSKAEMK--FQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            G+GL+   V  KE A F + +K A S  + VTV+GP GE  +   D GDG  G  Y   VPG Y + + +   +I +SP  V V            V A GPGL  EG      A F V+A     +  GT+   V+ PS  Q     D+  +G   VRY P E G + ++V      I+ SPF+   +     F+   V A GPGL      VN+  +F VD    G   L + ++     P +A ++  DN +GT    Y P K   +   V +    I +SPF V V     P KVK  GP       K   P +FT+DC+EAG+  + + +   PG  G ++  +    +      TF V Y P   G   I V +       SP +  V       KVK +G G+      +    P  F VN K AG    DV             + I    +  YT +Y     G   ++V   G P+PKSP++V   P+ +  K  + +G  + + V K+   T+++K AG GQ      K+  + VG         ++  KV+    G+ +    V ++P+EEG Y VEV Y G  +P   F        + V  T    V+         +A     F I+TK      L   V  P     E  +   DN      + Y P+E G + + +      I GSPF+   V      +V   GPGL   T  EV +F +    AG   L++ +  E     E+  +D+ DGT  ++Y+P  PG Y + IK+  QP+    F + +  EP V  S V           V   +     + +  L+      + A +  PS       ++   +G   V +TP E G H V+V   G+ +P SPF+V V   E  D ++V+V G G++ G  N+ N+FT++TR AG G L +++EGPS+A++ C DN++G C+V+Y+P E G Y +NVTY G  VPGSPF V V        +  K++     +    V  N   + ++D  +  +  L+V V  P G  EP D+ D  +G   + +V    G + +SVL+ D  +  SPF+  V  +    +  V ASGPGL    +   +  EF I  ++AG G ++V +  P     K   Q++ D G+  V Y     G Y   IK+ G+ I  SP+ +
Sbjct:  460 GRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKV----GTECGNQKVRAWGPGL--EGGVVGKSADFVVEAI---GDDVGTLGFSVEGPS--QAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVEALVK--DNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDN-DTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGL--SRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKV-SGLGEKVDVGKDQEFTVKSKGAG-GQ-----GKVASKIVGPSGA-----AVPCKVEP---GLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPF------PLEAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPC----EAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPN--FPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVT--EGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHD----VTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKV--LPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHD-GTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRV 1607          

HSP 8 Score: 320.472 bits (820), Expect = 2.988e-87
Identity = 340/1249 (27.22%), Postives = 546/1249 (43.71%), Query Frame = 3
Query: 1230 KPDQPSSKVIVYGKGLEKVAAK--EKAIFTIDSKDAPSAPIGVTVEG--PGEAV--IDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLID-NLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVN--PDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVN----FEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF-FVDTKGEGRVTAFGPGL-SSGTTNEV-AEFTIITKDAGPGGLSLIV---EG-PSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI--TGEPVKKS----------------QVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVK------------VSGKGLEKGLANQGNEFTIDTRDAGY--------------GSLNISIEGPSK--AEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPS-KAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAARAVS 4772
            +P   +SKV   G GL +   +  +   FT+++K A    + V   G   G+AV  +D +D+ D T  V Y     G   +NV Y    IP+SP  V V P    +LDLS +  SG G   + V KD   +FTV +      GQG V + +  PSG      ++  L     VVR+ P EEGP+++ VTY+G+P+  SPF ++A        V A GPGL         +F +D  GAG G LGL +EGP +A+++C DN DGTC V Y P + GDY+I++ F D  I  SPF   VV      KVK  GP ++ A       F +DCS AG A L +++       +  P  +  ++    GT  + Y+P   G   + +KY   P+   P K  V        V+  G GI  Q   +       F V+ +       P V   + NP+G     +++ R +G+Y  EY  ++ G H + V  DG+P+P SP+ V      +P +  +     ++   NK +  T+ET+ AG G +   V+       G  E        K+   ++ DG  SV Y+P E G Y + V YGG  +P G  F+   +        +T + + + S    S      N    F+++T       L  KV  P G +E  P+   DN      ++Y PS  GP+ + V      +  SPF+   + T    +V A GPGL ++G    +  EFTI  KDAG G L++ +   EG P KT I  +DNHDGT+ V+YVP   G Y I+IK+    I  SP+      TG+  K +                 + +G  + I +   ++    +T  + TP   +V   + +  +G   + +T  + G++++ V   G  +P SPF+V       GD   V+               +G ++  A +     ++  D                 G +   +  PS   A+    DN++G  TV+Y P+E G + +++ Y   ++PGSP    V+    V C    +      +    V       +   +     L + +  PS     C   D  +G   + ++    G + + V + ++H+ GSPF   V       + D +     L+ G      +  I   E     ++  +  PS + E    +    G   +++   + G++   +K NG+H+ +SP  +++    I   +   VS
Sbjct:  840 EPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSP----SLDLSKIKVSGLGEKVD-VGKD--QEFTVKSK--GAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSE----AGLPAEV-YIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQ--GVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVE-------GPSEA-------KMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVP-GSPFKVPVHD-------VTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVE--PVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHI--QDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTAL---AGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVD---YVNC--GHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISC--TDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARV-------TGDDSMRMSHLKVGSA---ADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVS 2026          

HSP 9 Score: 299.286 bits (765), Expect = 8.515e-81
Identity = 422/1701 (24.81%), Postives = 675/1701 (39.68%), Query Frame = 3
Query:   42 EVTYRPQECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDED-----SKYIG-TLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPM-IEVCAPQTFKVLSPEK--------------VINPDLVDV--QVLNPENKIIPIHKEAAPDGTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKD--------------NTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPI--LSEQ----------IKTLKAGNPH-------NPMQKANPGK---------SNKPYTALEEAIKEMKESA----VESSKWPQS--KPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEK--TQFVVD---LDGAGHGSLGLAIEGPAD--AEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKC-AIKAGKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQN-----------QISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFV--------------------DTKGEGRVTAFGP-----GLSSGTTNEVAEF-TIITKDAGPGGLSLIVEGPSK--TEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPF--------TANITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDC--KDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGN---CEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV---GSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPS--KAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            +V Y PQE     A+H  V    EDI  SPF        +D      K  G  LE  K  V + +P  F V    G K+   V V D  G PVE  LVK     TY  +Y P K  +H    S  G  +  +P  V+V      N  K+   G+A   ++   P  F V   E               V+ P   D+   ++  +N           D   V + P+  G ++I     DQ    +P  VK  P  D  +   +    +   VE     + KP  FT+                    D + D D++    D+H                ++ P + GP  +  +   +PI  SP ++ V  S  +++  +  L E+          +K+  AG           P   A P K         S   +   EE   E++ +     V  S +P     P +P SKV  +G GL+  +A   A FTID+K A +  +G+TVEGP EA ++C+DNGDGTC V Y    PG Y IN+L+ + HIP SP    V P      D S V  SGPGL  E        +F VD S     G   +   + S +G      I +  +G + + Y P   G + + + Y G P+ + P  ++ +P  +   V   GPG+    V  +  T+F VD   L   G   +   +  P+    E    D  DG   VEYTP + G + + V ++   +  SPF V V +   P +V+  GP I+     +PN FT++   AG   L + V  P    S+  ++    +    G+  V Y+P E G   ++V Y    + GSPFK  V       KVK  G G+ P  G + A++P  F V+T  AGV P + V +  P G   P+ +    +G  T  Y     G + ISV      +P+SP+ VK +PT +  K  A   G + T +  +     TI+ K+AG+G +   +   E +              K  +Q++ DG  +V Y+P   G Y + +KYGG  IP   +   A  +    + T+T S+             QI  E            ++TK      +   V  P G   +V +  N++      I Y   + G + + V   G  +  SPFQ                        T  +G    + P     G++      +  F  +I      G ++  V  PS    +    DN DGT  V Y P   G + + I++ +  I GSP           ++T      +   V   +   +    +    L+  +  PSK ++ C   +  +G   VS+ P   G++ + V      +PGSPF   V  ++    + +KV              +  I+  +     L  ++  PS  E  C  K   NG   + ++P E G ++++V   G++V  SP  V +        E     RV+ + +    G      E  +   +     L +++  PS      + ED  +G  R+ +   E G + +++   D+H+ GSPF   V   G V     + +T          +  + + ++   E    +++  +  PS    E +  E ++   C + +  ++ G +  S+K+ G+H+  SPF   V
Sbjct:  605 DVRYWPQEA-GEYAVH--VLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLE--KTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVE-ALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDN-----------DTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVE-----LGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDII----DHHD----------NTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKP-SKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVP----CFDASKVKCSGPGL--ERATAGEVGQFQVDCSSA---GSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGP----SEAKMSCMDNKD---GSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSP--GMVRANLPQSFQVDTSKAGVAP-LQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPK------------KTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETV--------ITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENED--GTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQ--DGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKV----------GSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS-----QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVD--INTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRV----KESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYC-IRFVPAEMGTHTVSVKYKGQHVPGSPFQFTV 2203          

HSP 10 Score: 263.848 bits (673), Expect = 6.182e-70
Identity = 328/1247 (26.30%), Postives = 510/1247 (40.90%), Query Frame = 3
Query: 1224 QSKPDQPSSKVIVYGKGLEKVAAKEKAI--FTIDSKDAPSA---PIGVTVEGPGEAVIDCV--DNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIEGPADA--EIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLL---RPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVD-----GDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMP---------------------------TGNPEKCAIKA-GKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKC--EDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLK----------------IPSSD--LSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGN--EFTIDTRDAGYGSLNISIEGPS--KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVE-----GDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGA-GNISVAMEGPSKA-EMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            Q +P   +S V  YG G+E      +A   F++D++         +   V  P   + +    D GDG   V Y     GL++++V YD   +P SP  VPV     +  D S V   GPG+      K    KFTV   E    G G +   V+ PS  + +  +DN  +G   V Y P E G + +NVTY G  +  SPF V      +A  V  SGPGL     + N    F VD   AG   L + ++GP      +   DN DGT  V Y P + G Y ISV + DE++  SPF V+V+      KVK+ GP  +   +    P  FTID  +AG+  L V+++ P      +P     ++    GT+ V YVP+  G   I +KY    I  SP++   V      K  V                I      V  V+TK AG    V   +  P+G  + + +    +G +   Y     G + I V   G  +P SP+ V ++                            T  PE+  +   G D T     + VI    K   KG+IT  V    R   G+V Q  + D        + DG  +V Y P E G + ++++Y    IP         Y            + + + N+ A+       F +NTKD     L+  +  PS    +  I+  DN      + Y P   G + + V    + + GSPF   V      R++    G ++     ++E  +         L+  V  PS  E  C  +   +G   +S+VP+  G + + +K   Q +A SP        PV  SQ  +G++S + +                 I + D     L+  +  PSK+ +    + + +G   V++ P E G +++N+      +PGSPF V V  E      K  ++ +     +AN G+  + ++   +     +   +  PS    E +  + EN    ++++P E G + ++V Y G++VPGSPF   V      G   V      +ER +  V A       E ++   E     L + V  PS        ED  +G+  + +V +E G + VSV   + HI  SPF   V S + G ++ +T S   L++  + +N   +      GA G I   +  PS A E  +    D+   AV +   + G Y   +KFNG HI  SPF I V
Sbjct: 1221 QVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPV----TEGCDPSRVRVHGPGIQSGTTNKP--NKFTV---ETRGAGTGGLGLAVEGPSEAKMS-CMDN-KDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDP----EGKPKKT-HIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKG-KVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIK---KGEITGEV----RMPSGKVAQPTITD--------NKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPAT-------FTVNTKDAGEGGLSLAIEGPS----KAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSL-------LTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPI-------PVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDIN--TEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGE---GRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPA-------EFSIWTREAGAGGLAIAVEGPS--KAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS-GDARRLTVSS--LQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRV 2393          

HSP 11 Score: 250.751 bits (639), Expect = 6.229e-66
Identity = 268/1030 (26.02%), Postives = 429/1030 (41.65%), Query Frame = 3
Query: 1296 EKAIFTIDSKDAPSAPIGVTVEGP--GEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAK-FTVDASEVSQNG------------------QGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSP--FIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQP--AQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTI-QVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDT-KGEGRVTAFGPGLSSGT-TNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKC---EDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAV-------------GNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNV-YEKGTDIPGSPFKVNVKNEEV---------------------------------GDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSK--AEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNV 4145
            E+ + T+D+K A    +  TV  P   E  +D V+N DGT  + Y  P PG Y I V +   H+P SP  V     D  ++     +     L+P+  +     + +  +   V  NG                  +G +   V+ PSGK     I +  +G   VRY P+E G H++++ Y+ + I  SP  F V      N   VTA GPGL    VN+   F V+   AG G L LAIEGP+ AEI C DN+DGTC V Y PV  GDY I VK+N++ +  SPF   V  +           +   K+       I+ SE   + L   V  P     + P  +K++     G   + +VP+E G  L+ VK N   ++ SP    + Q       +V+V G G+    G      PA F ++T+DAG    + + +  P+   + ++ E   +G     Y   + G++ I++      +P SP++VK    G  ++   +  +  ++  V     ++++  E     +T  V        G+  + +++        E  +    + ++P E G + V VKY GQ +P   F     ++   + E     V+        + A     F I T++     L   V  PS    +  I+  D    +  + Y   E G +++ V      I  SPF   V +  G+ R         SG   N+ A F  ++ +   G +   V  PS    +C   E + D  + V ++P+  G Y I +KF    I GSPF   + GEP       +             GN +E  +   ++    L+  +  PSK+K+ C  ++   G   V++TP   G +L+++ Y     I GSPFK  V    +                                  DA+KV   G GL K    Q + FT+D   AG   L + + GP     EI  K   + + +V YL  + G Y + V +  +++PGSP+ V V
Sbjct: 1641 EETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQ---LAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDY---VNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMR-------MSHLKVGSAADIPINISETDLSLLTATVVPPSG--REEPCLLKRLRN---GHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGL--HEGHTFE--PAEFIIDTRDAGYG-GLSLSIEGPS--KVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVT----SPSGKTHEAEIV--------EGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPF----QFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPS----KAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFA-VSLNGAKGAIDAKVHSPSGALEECYVTEIDQD-KYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRV-GEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDC--QECPEG-YRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVV 2619          

HSP 12 Score: 164.466 bits (415), Expect = 1.108e-39
Identity = 175/666 (26.28%), Postives = 276/666 (41.44%), Query Frame = 3
Query:  636 VTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLL-CEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEE-----------------------PILSEQIKTLKAGNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQP------------SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVY--PKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNG-QGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVK-AKPGFNAQ--LVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFND-EDISDSPF------------HXXXXXXXXXXXXXSK------------GPIKDAKLL------------RPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNV 2396
            ++FVPKE G H +      Q +  +P  V  + +++I +A   + S   L     EG   +P  F I   +T D    +  + LS +    + + ++ L  G     + P + G Y +     +  + GSP ++ V     + E                        P +S Q  T +  +P     +A   +       +     EM    V      Q  P  P            + KV   G GLE+  A   A F+I +++A +  + + VEGP +A I   D  DG+CGV Y V  PG Y ++V ++  HIP SP VVPV     D + L +S++  SG  ++    F             VS NG +G + A V SPSG      +  ++  KY VR+ P E G + I+V + G  I  SPF ++  +PG      LV+A G GL         +FVV+   AG G+L + I+GP+  ++ C +  +G   V YTP+  G Y IS+K+     I  SPF            H             +K            GP   +K++            + + FT+DCS+AG   L V V  P +   +  + +K V       + V Y+ ++ G   + VK+    I GSP++  V
Sbjct: 1982 ISFVPKETGEHLVHVKKNGQHVASSPIPV-VISQSEIGDASRVRVSGQGL----HEGHTFEPAEFII---DTRD--AGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFA------------VSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGY-RVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEE--ILVKHV---GSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVV 2619          

HSP 13 Score: 130.183 bits (326), Expect = 2.882e-29
Identity = 97/284 (34.15%), Postives = 134/284 (47.18%), Query Frame = 2
Query: 4853 PKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLK--QARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            P ++A V  PSGN+    VQ  GDG Y V+++P E G H V V  +  P+  SPF++PV     DP  V   G G+     +K  KF V T  AG+G L +A++GPS+  M+C + +DG     Y+    G Y +N+TYGG+  + GSPF   V                                    ++  K+ C G GL     R N   SF VD S+AG   L V + GP    E V V    +   TV+YV    G + I V +GD+++P SPF V V
Sbjct: 1264 PHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTE-GCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGH-QVPGSPFKVPVH---------------------------------DVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKV 1512          

HSP 14 Score: 124.79 bits (312), Expect = 1.569e-27
Identity = 87/298 (29.19%), Postives = 142/298 (47.65%), Query Frame = 2
Query: 4808 GGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            G    I +   + ++  L A+V  PSG  EP +++++ +G  G+ F P+E G HLV V+ N + +  SP  + +   +  D   V  SG+GL      + A+F ++T +AG G L+++I+GPSKV++N  + EDG    TY  T PGNYIINI +  + H+ GSPF+  V G              +V+   + +R     A   S       C  L LK   ++  +             +   +  P     E  +    N+ + + +V  E GTH + V++  + +PGSPF   V
Sbjct: 1939 GSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKF-ADQHVPGSPFSVKVTG------------EGRVKESITRRRRAPSVANVGSH------CD-LSLKIPEISIQD-------------MTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTV 2203          

HSP 15 Score: 111.309 bits (277), Expect = 1.910e-23
Identity = 81/300 (27.00%), Postives = 133/300 (44.33%), Query Frame = 2
Query: 4811 GLISITVRAEDGEIP------KLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMV 5689
            GL   ++R  D  IP      ++   V+ PSG +    +    DG   V+++P E G H + +  +   I GSP +  V +     G V A G GL+H +V+K A F VNT +AG G L++AI+GPSK  ++C + +DG    +Y+   PG+Y I + Y    H+ GSPFTA V G+ S                                         + +   ++ S     ++ S+    +L   +  P    E  ++K + N    + +V KE+G H++ V+   + +  SP  V
Sbjct: 1755 GLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNC--GHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQ-HVPGSPFTARVTGDDS-----------------------------------------MRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPV 2010          

HSP 16 Score: 100.138 bits (248), Expect = 3.831e-20
Identity = 78/300 (26.00%), Postives = 132/300 (44.00%), Query Frame = 2
Query: 4802 DAGGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHY-KADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            + G    ++++  +  I  + A V +PSG    A + +  +  Y ++F P E GTH V V+   + + GSPF+  VG   +     V A G GL  A     A+F + T  AG+G L +A++GPSK  ++  + +DG     YV   PG+Y +++ +    HI  SPF   V                                   S +  ++    L     ++N   SF V  + A  G +   +  P    EE  V  +  +++ V ++ +E+G ++I V++    IPGSPF + V
Sbjct: 2128 NVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKF-NEEHIPDSPFVVPV--------------------------------ASPSGDARRLTVSSLQESGLKVNQPASFAVSLNGA-KGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRV 2393          

HSP 17 Score: 95.5153 bits (236), Expect = 9.280e-19
Identity = 82/283 (28.98%), Postives = 125/283 (44.17%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQ-IGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            K+ + +  PSG   P  V+  +G     V+F PRE G + V V  +  P+ GSPF +        P  V A G GL        A+F ++T  AG+G L + ++GP +  + C +  DG    +YV T PG+Y INI +  + HI GSPF A                H     +AS                 K+ C G GL++A    V  F VD S AG   L + I        EV ++  G+   T+ Y+    G + + +++G + +P  P  + V+
Sbjct:  976 KVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEA-VAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF-ADTHIPGSPFKA----------------HVVPCFDAS-----------------KVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVE 1223          

HSP 18 Score: 92.4337 bits (228), Expect = 8.911e-18
Identity = 86/333 (25.83%), Postives = 146/333 (43.84%), Query Frame = 3
Query: 3795 EHLVNVY----EKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLE--KGLANQGNEFTIDTRDAGYGSLNISIEGPS----KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEM-----ALKDLKVNVHTP---SGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVG-SVTPGGSKDVTASGPGLEKGFIDINN--EFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            EH V  Y     K    PG+P +  +      +  K +  G G+E    +  +  EFT++TR AG G + + +E P+    +A++   +++N   +V Y+P   G + + V +AG+++  SPF V V+  +          +V       +  GN        E+        +++V +  P    G  EP  +E  G+   R  +     G+H V V      I  SP+  TVG +  P   + V   G GL+   + +    +F +YT+ AG+G + V ++GP   E   Q+    G     Y    PG Y  +I + G++I  SPF + V
Sbjct:  227 EHSVMTYLSQFPKAKLKPGAPLRPKL------NPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQ------GDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVIQDPMGQKGTVEP-QLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPSACRAV---GRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKV 543          

HSP 19 Score: 91.6633 bits (226), Expect = 1.646e-17
Identity = 102/352 (28.98%), Postives = 139/352 (39.49%), Query Frame = 2
Query: 4856 KLEASVQTP---SGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSH--AIVDKKAKFFVNTSNAGSGSLNVAIDGPS-KVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVV----------------EG---NKSATNVNQE------------EQHSQVEIEASDK---RC-VSQYAEKSSSNVEKIIC----------------------------QGLGLKQA--RLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++E  +Q P    G +EP + +  GD  Y   + P   G H V V     PI  SP+ + VG    +P    A G GL      V + A F V T  AGSG L V + GP  +  +   +  DG Y F Y    PG YI+ IT+GG  +I  SPF   V                EG    KSA  V +             E  SQ +IE  DK    C V  + +++      ++C                            +G GL++    +N    F VDA   G   L V +        E +VK  GN  ++  YV ++   H  MV WG   IP SPF V+V
Sbjct:  388 EVEVVIQDPMGQKGTVEPQL-EARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQ-ACNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQ-NIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNV 736          

HSP 20 Score: 73.559 bits (179), Expect = 4.732e-12
Identity = 78/284 (27.46%), Postives = 116/284 (40.85%), Query Frame = 2
Query: 4871 VQTPSGNMEPAIVQQIGDGQ--YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGL--SHAIVDKKAKFFVNTSNAGSGSLNVAIDGP----SKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            V+ P+G+ E A V    D    + V + P   GTH V V    + I  SPF + V   + D   V A G GL  S  I +K   F + T+ AG+G + V I  P      V        D  Y  +Y  T  G + +++T+ G   I  SP+T  V                                +  + +  + + +GL  K  R+     F V    AG G L V + GP +  E V  K +G+  +  +Y     GT+I+ + WG ++I  SPF V V
Sbjct:  293 VEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVIQDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAG-VPIPRSPYTVTV-------------------------------GQACNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGP-KGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKV 543          

HSP 21 Score: 67.781 bits (164), Expect = 2.836e-10
Identity = 79/312 (25.32%), Postives = 136/312 (43.59%), Query Frame = 2
Query: 4817 ISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFR---IPVGHYKADPGMVHASGEGLSHAI-----VDKKAKFFVNTSNAGSGSLNVAIDGP--SKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPF-TAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKII-CQGLGLKQAR-LNSVNSFFVDASQAGYGILLVGIAGPVR-PCEEVVVKHVGNNQ---FTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            +  T+ A+D     L   +  P G  +   +Q   DG Y V + P   G + + ++     I  SP+R   +P G        V   G GL   I     + ++    V+T  AG G +   +  P  S+V+++  E EDG ++  Y A  PG Y+I + +GG  H+  SPF    + G++ +    Q    SQ   + + +   +Q  +++ +    ++   GL +   R  + V  F +   +         I G VR P  +V    + +N+    TV Y   E+G H + +R+ +  IPGSP   +VD
Sbjct: 1539 VEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGE-HVPNSPFQVTALAGDQPSV---QPPLRSQ---QLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGE---------ITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVD 1834          

HSP 22 Score: 63.1586 bits (152), Expect = 7.712e-9
Identity = 62/261 (23.75%), Postives = 101/261 (38.70%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNC--HETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            DG   V + P   G + + V+ N++ + GSPF         D  M       +SH  V   A   +N S      L   +  PS     C      +G+   ++V    G +++++   G  H+  SP   V+               SQ EI                 +  ++   G GL +        F +D   AGYG L + I GP +   ++  + + +    V Y   E G +II +++ D+ +PGSPF V V
Sbjct: 1890 DGTCSVSYLPVLPGDYSILVKYNEQHVPGSPF---TARVTGDDSMR------MSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQ-HVASSPIPVVI---------------SQSEI----------------GDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSK--VDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKV 2107          

HSP 23 Score: 60.8474 bits (146), Expect = 3.471e-8
Identity = 73/306 (23.86%), Postives = 118/306 (38.56%), Query Frame = 2
Query: 4823 ITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVD--KKAKFFVNTSNAGSGSLNVAID------GPSKVNMN---CHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQA--RLNSVNSFFVDASQAGYGILLVGIAGPVR--PCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
             TV A+ G    L   VQ   G    A+V+  G+G Y   + PR+   H   V      I  SPFR+ VG   + P  V   G G++   +   +   F V+ + AG G +++ I       GP++ +++        D +   Y     G+Y I + +                        +Q    S + ++            + S +  K+  +G GL +    L     F V+A  AG G L V  +G  +     +V +    +N +TV Y   + G   + V +G   IP SPF V V
Sbjct:  668 FTVDAKHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGA-GSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTPRGAGSYTIMVLF-----------------------ADQATPTSPIRVKV-----------EPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAV 938          
BLAST of Filamin-A vs. Ensembl Human
Match: FLNA (filamin A [Source:HGNC Symbol;Acc:HGNC:3754])

HSP 1 Score: 807.749 bits (2085), Expect = 0.000e+0
Identity = 493/1203 (40.98%), Postives = 690/1203 (57.36%), Query Frame = 3
Query: 1245 SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEG----PGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLR---PNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAG---------KDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNA---------FHGVNFEINTKDGVPVDL-----------NAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGE-PVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDS 4742
            +SKV   G GLE+  A E   F +D   A SA + + +      P E  I   D+GDGT  + Y    PG YT+ + Y    +P  P  + V P     +D S V   GPG+  +GVF++   +F+VDA  ++Q G   VKA V +PSG  T   + +  +G Y V YTP EEG H ++VTY+G P+  SPF V    G +   V   GPG+ S   N+  +F V+  GAG G LGLA+EGP++A++ C DNKDG+C VEY P +AG Y ++V +    +  SPF V V D     KVK  GP     ++R   P  F +D S+AG APL+VKV  P   +   PV +      A GT  V YVP   GP  I V Y    +  SPFK  V+      KVK  G G+      + AS+P  F ++ KDAG    + V + +P G+P   HI+   +G YT  Y     G + I +   G  +P SPY V+++PTG+  KC +               TIQ+ +E+VIT++TK AGKG++TCTV   +  +V             V V E+ DG   + Y   + G+Y++ V++GG+ +PN  F  TA    Q   +   RS Q       A              GVN  ++     P DL             +V  PSG + +  IT  DN    + + Y PSE G H++ +      I GSP QF+VD    G VTA+GPGL+ G  N+ A FT+ TKDAG GGLSL +EGPSK EI C DN DGT  VSY+P  PG+Y+I++K+ +Q + GSPFTA +TG+  ++ S + VG++++IP+ I  +DLS LTA +  PS  + PC++K++ NG +G+SF PKETGEHLV+V + G  +  SP  V +   E+GDA++V+VSG+GL +G   +  EF IDTRDAGYG L++SIEGPSK +I+ +D E+G C V Y PTEPGNY+IN+ +A ++VPGSPF+V V G+  V    + + R + A     VG +C+++LKI E++++D+   V +PSG T   +I +  N    I+FV  E G H VSV +K +H+ GSPFQFTVG +  GG+  V A GPGLE+    +  EF+I+TREAGAG +++A+EGPSKAE+ F++ +D GSC V Y V +PGDYE S+KFN EHI +SPF + V   S
Sbjct: 1160 ASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQ--DHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPA----VDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLV--EPVDVVD---NADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGL--NTTGVPASLPVEFTIDAKDAGEGL-LAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEV------------DVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVN-GLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTIT--DNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRV---KESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKD-GSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS 2329          

HSP 2 Score: 248.44 bits (633), Expect = 0.000e+0
Identity = 126/283 (44.52%), Postives = 180/283 (63.60%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGH--YKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAE--KSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++A V +PSG +E   V +I   +Y V+F PRE G +L+ V+ N   I GSPF+I VG   +  DPG+V A G GL   +    A+F VNTSNAG+G+L+V IDGPSKV M+C E  +GY  TY   APG+Y+I+I YGG +HI GSPF A V G +  +N +  E  S      +   C  Q+       ++  K++ +GLGL +A +   +SF VD S+AG  +LLVG+ GP  PCEE++VKHVG+  ++V Y++K+ G + ++V+WGD+ IPGSP+ V V
Sbjct: 2364 IDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVV 2646          

HSP 3 Score: 483.797 bits (1244), Expect = 1.178e-138
Identity = 489/1667 (29.33%), Postives = 723/1667 (43.37%), Query Frame = 3
Query:   33 DLYEVTYRP-QECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLND-GIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIE---VCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPAT-LAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGL-LCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQES----------PLITEEPILSEQIKTL--------KAGNPHNPMQKANP--------------GKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQP------SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGK-QTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKV--NEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDA----------KLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQ------VEKVKVDGDGIIPQNGA-ILASMPAVFHVNTKD-AGVNP-DVIVGLFNPNGE-----PMPLHIEARP------NGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVA----------VGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVN---------VHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKD-VTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNG-EHIVNSPF 4718
            + Y V Y P Q+ P    +   VT GG+ IP SPF++  +   + SK    +  L   V + + Q F VK    G + +    +   +G  V   +   +  +     + P + G + +  + DG PV  +P  +    E     +  KV+   P ++     +P  F + +  K      + + V  P    +        DGT  V++VP E G ++I     D  I  +P     +P  D  +   K S P    A   + GQ    CS     + T         + +  +   P  V  +    G     +IP   G Y++       P+   P  + V+ +          P I  + +  E             + G PH   + ANP              G     YT  EE +  + +   + S  P S    P       S+V V+G G++     +   FT++++ A +  +G+ VEGP EA + C+DN DG+C V Y     G Y++NV Y    +P SP  VPV+       D S V  SGPGLSP  V  +    F VD S+    G   ++  VQ P G  +   ++DN + G   V Y P+ EGP+ I+V Y    +  SPF VK  P  +A  V ASGPGL++  V  +   +F +D   AG G L + I  P     + H  DN DGT  V Y P   G Y I +K+  ++I  SP+ V  V      K      I             ++      T+D   AGK  +   V  P     D  V   +      GTFD+ Y   + G  +I V++    +  SPF+   +   Q      +   ++       Q G    A    +  VN  D   + P D+++      GE      MP    A+P      +G  T  Y   + G H++ +  D   +P SP              A   G    + VNK +  T+ TK+AG+G ++  ++   + ++                 ++ DG  SV Y+P   G+Y + VKY  Q +P   F           R T   S++  +S+    +A    +  IN  +     L A VV PSG   E P         ++ I + P E G H + V   G+ +  SP    +     G   RV   G GL  G T E AEF I T+DAG GGLSL +EGPSK +I  ED  DGT +V+Y P  PGNY I IKF DQ + GSPF+  +TGE   K  +           VG+  ++ LKIP   +  +TA++T+PS       I +  N    + F P E G H V+V  KG  +PGSPF+  V     G A KV+  G GLE+  A    EF+I TR+AG G L I++EGPSKAEI  +D ++G C V Y+  EPG+Y ++V +  +++P SPF        VVP  +   +  +  V + Q     E  LK+++ A   + +N         VH+PSG  E C + +       ++F+ RE+G++ + V     HI GSPF+  VG    GG    V+A G GLE G      EF + T  AGAG +SV ++GPSK +M  QE  +     VTY    PG Y  SIK+ G  HI  SPF
Sbjct:  931 NTYTVKYTPVQQGP----VGVNVTYGGDPIPKSPFSVAVSPSLDLSKI--KVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPL----EAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDT--KGAGTGGLGLTVEGPCEAQLECLDNG--DGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKV--KCSGPGLERATAGEVGQFQVDCSSAGSAELT---------IEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSV-DVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVH----DVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKA---GVAPLQVKVQGPKGLVEPVDVVDNAD-GTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENE-----DGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGV-VNKPATFTVNTKDAGEGGLSLAIEGPSKAEI--------------SCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPF---------TARVTGDDSMR--MSHLKVGSA---ADIPINISETDLSLLTATVVPPSG--REEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPF--------VVPVASPSGDARRLTVSSLQ-----ESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPE--GYRVTYTPMAPGSYLISIKYGGPYHIGGSPF 2512          

HSP 4 Score: 342.428 bits (877), Expect = 5.953e-107
Identity = 336/1218 (27.59%), Postives = 538/1218 (44.17%), Query Frame = 3
Query: 1230 KPDQPSSKVIVYGKGLEKVA--AKEKAIFTIDSKDAPSAPIGVTVEGPG----EAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKD---CFAKFTVDASEVSQNGQGTVKALVQSPSGKQ--TNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAE-IQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVV---QPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKA-GKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTK---GEGRVTAFGPGLSSGTTNEVAEFTIITKDA-GPGGLSLIVEGPSKTEIKCE-------DNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQV----------AVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISI--EGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKD-----LKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGS-KDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVED 4736
            +P     K   YG G+E      K++A FT++++ A    + V VE P     EA +   ++ + T  V Y   V G + + VL+   HI +SP  V V   D    D S VTA GPGL P G   +    F  FT  A      G G V+ ++Q P G++      ++   +  Y   Y PT EG H ++VT+ G+PI  SP+ V      N     A G GL     +V E   F V   GAG G L + ++GP   E ++  D  DG    EY P+  G Y +++ +  ++I  SPF V+V  E   +KV++ GP ++   + +   F ++        L   V  P            + +    G+ DV Y P+E G   + V  N   I  SPF  ++    Q    ++VK  G G+  +   +  + PA F V+ K  G  P + V + +  G P+   ++   NG Y+C Y       H   V   G  +P SP+ V      +P K  +   G  KT ++ ++ +  T++  EAG+G ++  + K     VG  E     D I+     + +   +V Y P+  G Y + V +  Q+ P          S    +        ++   EL       VN +   K  + V  +   +     + +V I   D++ +   + Y P ++GP  + V   G PI  SPF   V       + +V+  G  +  G      EFT+ +K A G G ++  + GPS   + C+       DN      V ++P+  G Y + + +   P+ GSPF       P K S+V          + G+ +   +    +    L   +  P + ++ C+     +G   VS+ P E G++ +N+    T IPGSPFK +V      DA+KVK SG GLE+  A +  +F +D   AG   L I I  E    AE+  +D+ +G  T+ Y+P  PG Y + + Y G+ VP  P  + VE       +T  ++     ++   V         +D  AL       +K  V  PSG      ++D G+G  ++++   E G+H V V +    +  SPFQ     VT G     V   GPG++ G  +  N+F + TR AG G + +A+EGPS+A+M   +++D GSC+V Y   + G Y  ++ + G  +  SPF + V D
Sbjct:  276 RPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYV---DKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGA------GTGEVEVVIQDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQ-------AKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGL--EKTGVAVNKPAEFTVDAKHGGKAP-LRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGI-KCAPGVVGPAEADIDFDIIR-----NDNDTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSG--LTKGDAVRDVDII--DHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLGEKVDVGKDQ---EFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNS----VVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVA-PTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECL--DNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVV--PCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVE----PAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQV---PVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKD-GSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHD 1444          

HSP 5 Score: 68.9366 bits (167), Expect = 5.953e-107
Identity = 80/297 (26.94%), Postives = 114/297 (38.38%), Query Frame = 2
Query: 4820 SITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKK--AKFFVNTSNAGSGSLNVAIDGPSKVNMNCH--ETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPF--TAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMV 5689
            S  V      +  L+  VQ P G +EP  V    DG   V + P   G + + V    + +  SPF++ V     D   V ASG GL+   V      +F ++  +AG G L V I  P       H  +  DG Y   YV    G Y I I YGG+  I  SP+   AV  G+ S   V                  VS       + +   I         ++       VD   AG G +   +  P     +V V    +  F + Y   + G ++I VR+G + +P SPF V
Sbjct: 1470 SFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKV-LPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGD-EIPFSPYRVRAVPTGDASKCTVT-----------------VSIGGHGLGAGIGPTI---------QIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQV 1738          

HSP 6 Score: 354.755 bits (909), Expect = 7.548e-98
Identity = 352/1218 (28.90%), Postives = 544/1218 (44.66%), Query Frame = 3
Query: 1251 KVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDN-KNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIE------GPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP---IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGL----YTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVE-QIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTR-SVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF----FVDTKGEGRVTAFGPGL-SSGTTNEV-AEFTI----ITKDAGPGGLSLIVEGPSK--TEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAV----------GNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGL--ANQGNEFTIDTRDAGYGSLNISIEGPSKA--EIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPC-ETQKMERVQEAVKATQVGGNCEINLKIDEMALKD--LKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTAS-------GPGLEKGFIDINNEFAIY--TREAGAGNISVAMEGPSKAEMKFQ--ESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            KV  +G GLE     + A F +++       +G +VEGP +A I+C D GDG+C V Y     G Y ++VL ++  I  SP +  +  +D  ++     V A GPGL   GV  +  A+FTVDA      G+  ++  VQ   G     L+ +  NG Y   Y P +   H   V++ G+ I +SPF V    G +   V   GPG+     K +E T F VD   AG G + + I+      GPA+A+I      N + T  V+YTP  AG Y I V F D+    SP  V+V       KVK++GP       +L +P HFT++   AGK  L+V+ S    G + R V I         T+ V Y P + GP  ++V Y   PI  SPF   V     + K+KV G G       +       F V +K AG    V   +  P+G  +P  +E    GL        +   + G +++ V  DG P+P SP+ ++++    P K        +       +  TI+TK AG G +  TV+       G  E Q++ LD        + DG  SV Y+P E G+Y + + +    IP   F       F   +   +   ++   + E+         F+++       +L  ++   +G   EV I  + +  H I   Y P   G + + +   G+P+   P +      VDT G   V  +GPG+   G   E   EF++    +T+  GP  +   V  PS   TE   +D  DG +KV Y P   G +++ + +   P+  SPF   +T E    S+V V             ++  ++   +    L   +  PS+ K+ C+  K  +G+  V + P E G + +NV   G  +PGSPFKV V   +V DA+KVK SG GL  G+  AN    F +DT  AG   L + ++GP      +D  DN +G  TV Y+P+  G Y I+V Y  + VP SPF V     KV+P  +  K++     +  T V  +  +   ID     +  L V +  P G  +   I+D  +G   + +V   +G + + + +    I  SP++  V +V  G +   T +               I I  E  I   T+ AG G ++  +  P  +E+     E++D G+  + Y   QPG Y   ++F GEH+ NSPF +
Sbjct:  578 KVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADI--RDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDA---KHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHD---NTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLG-----EKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEP---GLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVE-------GPCEAQLECLD--------NGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVG-------QFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTIT--YIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSG---VQCYGPGIEGQGVFREATTEFSVDARALTQTGGP-HVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVT-EGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNK--DGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPV--HDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKV-----KVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYR--VRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENED-GTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQV 1738          

HSP 7 Score: 352.829 bits (904), Expect = 3.391e-97
Identity = 357/1200 (29.75%), Postives = 537/1200 (44.75%), Query Frame = 3
Query: 1266 GKGLE--KVAAKEKAIFTIDSKDAPSAPIGVTVEGP-GEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPG---FNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIEG----PADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP---IKDAKLLRPNHFTIDCSEAGKAPLEVKV-SKPGS-GISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNP-DVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIAS----VHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQ-FFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIV--EGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEP-VKKSQV----------AVGNSSEIPLKIPSSDLST-----LTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKID--EMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFI--DINNEFAIYTREAGAGNISVAMEGPSKAEMK--FQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            G+GL+   V  KE A F + +K A S  + VTV+GP GE  +   D GDG  G  Y   VPG Y + + +   +I +SP  V V            V A GPGL  EG      A F V+A     +  GT+   V+ PS  Q     D+  +G   VRY P E G + ++V      I+ SPF+   +     F+   V A GPGL      VN+  +F VD    G   L + ++     P +A ++  DN +GT    Y P K   +   V +    I +SPF V V     P KVK  GP       K   P +FT+DC+EAG+  + + +   PG  G ++  +    +      TF V Y P   G   I V +       SP +  V       KVK +G G+      +    P  F VN K AG    DV             + I    +  YT +Y     G   ++V   G P+PKSP++V   P+ +  K  + +G  + + V K+   T+++K AG GQ      K+  + VG         ++  KV+    G+ +    V ++P+EEG Y VEV Y G  +P   F        + V  T    V+         +A     F I+TK      L   V  P     E  +   DN      + Y P+E G + + +      I GSPF+   V      +V   GPGL   T  EV +F +    AG   L++ +  E     E+  +D+ DGT  ++Y+P  PG Y + IK+  QP+    F + +  EP V  S V           V   +     + +  L+      + A +  PS       ++   +G   V +TP E G H V+V   G+ +P SPF+V V   E  D ++V+V G G++ G  N+ N+FT++TR AG G L +++EGPS+A++ C DN++G C+V+Y+P E G Y +NVTY G  VPGSPF V V        +  K++     +    V  N   + ++D  +  +  L+V V  P G  EP D+ D  +G   + +V    G + +SVL+ D  +  SPF+  V  +    +  V ASGPGL    +   +  EF I  ++AG G ++V +  P     K   Q++ D G+  V Y     G Y   IK+ G+ I  SP+ +
Sbjct:  487 GRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKV----GTECGNQKVRAWGPGL--EGGVVGKSADFVVEAI---GDDVGTLGFSVEGPS--QAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVEALVK--DNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDN-DTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGL--SRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKV-SGLGEKVDVGKDQEFTVKSKGAG-GQ-----GKVASKIVGPSGA-----AVPCKVEP---GLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPF------PLEAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPC----EAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPN--FPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVT--EGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHD----VTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKV--LPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHD-GTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRV 1634          

HSP 8 Score: 320.087 bits (819), Expect = 3.809e-87
Identity = 340/1249 (27.22%), Postives = 546/1249 (43.71%), Query Frame = 3
Query: 1230 KPDQPSSKVIVYGKGLEKVAAK--EKAIFTIDSKDAPSAPIGVTVEG--PGEAV--IDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLID-NLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVN--PDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVN----FEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF-FVDTKGEGRVTAFGPGL-SSGTTNEV-AEFTIITKDAGPGGLSLIV---EG-PSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI--TGEPVKKS----------------QVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVK------------VSGKGLEKGLANQGNEFTIDTRDAGY--------------GSLNISIEGPSK--AEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPS-KAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAARAVS 4772
            +P   +SKV   G GL +   +  +   FT+++K A    + V   G   G+AV  +D +D+ D T  V Y     G   +NV Y    IP+SP  V V P    +LDLS +  SG G   + V KD   +FTV +      GQG V + +  PSG      ++  L     VVR+ P EEGP+++ VTY+G+P+  SPF ++A        V A GPGL         +F +D  GAG G LGL +EGP +A+++C DN DGTC V Y P + GDY+I++ F D  I  SPF   VV      KVK  GP ++ A       F +DCS AG A L +++       +  P  +  ++    GT  + Y+P   G   + +KY   P+   P K  V        V+  G GI  Q   +       F V+ +       P V   + NP+G     +++ R +G+Y  EY  ++ G H + V  DG+P+P SP+ V      +P +  +     ++   NK +  T+ET+ AG G +   V+       G  E        K+   ++ DG  SV Y+P E G Y + V YGG  +P G  F+   +        +T + + + S    S      N    F+++T       L  KV  P G +E  P+   DN      ++Y PS  GP+ + V      +  SPF+   + T    +V A GPGL ++G    +  EFTI  KDAG G L++ +   EG P KT I  +DNHDGT+ V+YVP   G Y I+IK+    I  SP+      TG+  K +                 + +G  + I +   ++    +T  + TP   +V   + +  +G   + +T  + G++++ V   G  +P SPF+V       GD   V+               +G ++  A +     ++  D                 G +   +  PS   A+    DN++G  TV+Y P+E G + +++ Y   ++PGSP    V+    V C    +      +    V       +   +     L + +  PS     C   D  +G   + ++    G + + V + ++H+ GSPF   V       + D +     L+ G      +  I   E     ++  +  PS + E    +    G   +++   + G++   +K NG+H+ +SP  +++    I   +   VS
Sbjct:  867 EPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSP----SLDLSKIKVSGLGEKVD-VGKD--QEFTVKSK--GAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSE----AGLPAEV-YIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQ--GVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVE-------GPSEA-------KMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVP-GSPFKVPVHD-------VTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVE--PVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHI--QDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTAL---AGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVD---YVNC--GHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISC--TDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARV-------TGDDSMRMSHLKVGSA---ADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVS 2053          

HSP 9 Score: 298.901 bits (764), Expect = 1.262e-80
Identity = 422/1701 (24.81%), Postives = 675/1701 (39.68%), Query Frame = 3
Query:   42 EVTYRPQECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDED-----SKYIG-TLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPM-IEVCAPQTFKVLSPEK--------------VINPDLVDV--QVLNPENKIIPIHKEAAPDGTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKD--------------NTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPI--LSEQ----------IKTLKAGNPH-------NPMQKANPGK---------SNKPYTALEEAIKEMKESA----VESSKWPQS--KPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEK--TQFVVD---LDGAGHGSLGLAIEGPAD--AEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKC-AIKAGKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQN-----------QISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFV--------------------DTKGEGRVTAFGP-----GLSSGTTNEVAEF-TIITKDAGPGGLSLIVEGPSK--TEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPF--------TANITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDC--KDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGN---CEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV---GSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPS--KAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            +V Y PQE     A+H  V    EDI  SPF        +D      K  G  LE  K  V + +P  F V    G K+   V V D  G PVE  LVK     TY  +Y P K  +H    S  G  +  +P  V+V      N  K+   G+A   ++   P  F V   E               V+ P   D+   ++  +N           D   V + P+  G ++I     DQ    +P  VK  P  D  +   +    +   VE     + KP  FT+                    D + D D++    D+H                ++ P + GP  +  +   +PI  SP ++ V  S  +++  +  L E+          +K+  AG           P   A P K         S   +   EE   E++ +     V  S +P     P +P SKV  +G GL+  +A   A FTID+K A +  +G+TVEGP EA ++C+DNGDGTC V Y    PG Y IN+L+ + HIP SP    V P      D S V  SGPGL  E        +F VD S     G   +   + S +G      I +  +G + + Y P   G + + + Y G P+ + P  ++ +P  +   V   GPG+    V  +  T+F VD   L   G   +   +  P+    E    D  DG   VEYTP + G + + V ++   +  SPF V V +   P +V+  GP I+     +PN FT++   AG   L + V  P    S+  ++    +    G+  V Y+P E G   ++V Y    + GSPFK  V       KVK  G G+ P  G + A++P  F V+T  AGV P + V +  P G   P+ +    +G  T  Y     G + ISV      +P+SP+ VK +PT +  K  A   G + T +  +     TI+ K+AG+G +   +   E +              K  +Q++ DG  +V Y+P   G Y + +KYGG  IP   +   A  +    + T+T S+             QI  E            ++TK      +   V  P G   +V +  N++      I Y   + G + + V   G  +  SPFQ                        T  +G    + P     G++      +  F  +I      G ++  V  PS    +    DN DGT  V Y P   G + + I++ +  I GSP           ++T      +   V   +   +    +    L+  +  PSK ++ C   +  +G   VS+ P   G++ + V      +PGSPF   V  ++    + +KV              +  I+  +     L  ++  PS  E  C  K   NG   + ++P E G ++++V   G++V  SP  V +        E     RV+ + +    G      E  +   +     L +++  PS      + ED  +G  R+ +   E G + +++   D+H+ GSPF   V   G V     + +T          +  + + ++   E    +++  +  PS    E +  E ++   C + +  ++ G +  S+K+ G+H+  SPF   V
Sbjct:  632 DVRYWPQEA-GEYAVH--VLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLE--KTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVE-ALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDN-----------DTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVE-----LGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDII----DHHD----------NTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKP-SKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVP----CFDASKVKCSGPGL--ERATAGEVGQFQVDCSSA---GSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGP----SEAKMSCMDNKD---GSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSP--GMVRANLPQSFQVDTSKAGVAP-LQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPK------------KTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETV--------ITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENED--GTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQ--DGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKV----------GSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS-----QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVD--INTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRV----KESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYC-IRFVPAEMGTHTVSVKYKGQHVPGSPFQFTV 2230          

HSP 10 Score: 263.462 bits (672), Expect = 9.686e-70
Identity = 325/1244 (26.13%), Postives = 510/1244 (41.00%), Query Frame = 3
Query: 1224 QSKPDQPSSKVIVYGKGLEKVAAKEKAI--FTIDSKDAPSA---PIGVTVEGPGEAVIDCV--DNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIEGPADA--EIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLL---RPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVD-----GDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPE------------KCAIKAGKDKT-------IQVNKESVITIETKEA------GKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKC--EDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLK----------------IPSSD--LSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGN--EFTIDTRDAGYGSLNISIEGPS--KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVE-----GDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGA-GNISVAMEGPSKA-EMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            Q +P   +S V  YG G+E      +A   F++D++         +   V  P   + +    D GDG   V Y     GL++++V YD   +P SP  VPV     +  D S V   GPG+      K    KFTV   E    G G +   V+ PS  + +  +DN  +G   V Y P E G + +NVTY G  +  SPF V      +A  V  SGPGL     + N    F VD   AG   L + ++GP      +   DN DGT  V Y P + G Y ISV + DE++  SPF V+V+      KVK+ GP  +   +    P  FTID  +AG+  L V+++ P      +P     ++    GT+ V YVP+  G   I +KY    I  SP++   V      K  V                I      V  V+TK AG    V   +  P+G  + + +    +G +   Y     G + I V   G  +P SP+ V ++    P             +     G  +T       + VN   V ++   +        KG+IT  V    R   G+V Q  + D        + DG  +V Y P E G + ++++Y    IP         Y            + + + N+ A+       F +NTKD     L+  +  PS    +  I+  DN      + Y P   G + + V    + + GSPF   V      R++    G ++     ++E  +         L+  V  PS  E  C  +   +G   +S+VP+  G + + +K   Q +A SP        PV  SQ  +G++S + +                 I + D     L+  +  PSK+ +    + + +G   V++ P E G +++N+      +PGSPF V V  E      K  ++ +     +AN G+  + ++   +     +   +  PS    E +  + EN    ++++P E G + ++V Y G++VPGSPF   V      G   V      +ER +  V A       E ++   E     L + V  PS        ED  +G+  + +V +E G + VSV   + HI  SPF   V S + G ++ +T S   L++  + +N   +      GA G I   +  PS A E  +    D+   AV +   + G Y   +KFNG HI  SPF I V
Sbjct: 1248 QVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPV----TEGCDPSRVRVHGPGIQSGTTNKP--NKFTV---ETRGAGTGGLGLAVEGPSEAKMS-CMDN-KDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDP----EGKPKKT-HIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKG-KVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEV----RMPSGKVAQPTITD--------NKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPAT-------FTVNTKDAGEGGLSLAIEGPS----KAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSL-------LTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPI-------PVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDIN--TEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGE---GRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPA-------EFSIWTREAGAGGLAIAVEGPS--KAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS-GDARRLTVSS--LQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRV 2420          

HSP 11 Score: 250.751 bits (639), Expect = 6.775e-66
Identity = 268/1030 (26.02%), Postives = 429/1030 (41.65%), Query Frame = 3
Query: 1296 EKAIFTIDSKDAPSAPIGVTVEGP--GEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAK-FTVDASEVSQNG------------------QGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSP--FIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQP--AQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTI-QVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDT-KGEGRVTAFGPGLSSGT-TNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKC---EDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAV-------------GNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNV-YEKGTDIPGSPFKVNVKNEEV---------------------------------GDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSK--AEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNV 4145
            E+ + T+D+K A    +  TV  P   E  +D V+N DGT  + Y  P PG Y I V +   H+P SP  V     D  ++     +     L+P+  +     + +  +   V  NG                  +G +   V+ PSGK     I +  +G   VRY P+E G H++++ Y+ + I  SP  F V      N   VTA GPGL    VN+   F V+   AG G L LAIEGP+ AEI C DN+DGTC V Y PV  GDY I VK+N++ +  SPF   V  +           +   K+       I+ SE   + L   V  P     + P  +K++     G   + +VP+E G  L+ VK N   ++ SP    + Q       +V+V G G+    G      PA F ++T+DAG    + + +  P+   + ++ E   +G     Y   + G++ I++      +P SP++VK    G  ++   +  +  ++  V     ++++  E     +T  V        G+  + +++        E  +    + ++P E G + V VKY GQ +P   F     ++   + E     V+        + A     F I T++     L   V  PS    +  I+  D    +  + Y   E G +++ V      I  SPF   V +  G+ R         SG   N+ A F  ++ +   G +   V  PS    +C   E + D  + V ++P+  G Y I +KF    I GSPF   + GEP       +             GN +E  +   ++    L+  +  PSK+K+ C  ++   G   V++TP   G +L+++ Y     I GSPFK  V    +                                  DA+KV   G GL K    Q + FT+D   AG   L + + GP     EI  K   + + +V YL  + G Y + V +  +++PGSP+ V V
Sbjct: 1668 EETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQ---LAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDY---VNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMR-------MSHLKVGSAADIPINISETDLSLLTATVVPPSG--REEPCLLKRLRN---GHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGL--HEGHTFE--PAEFIIDTRDAGYG-GLSLSIEGPS--KVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVT----SPSGKTHEAEIV--------EGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPF----QFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPS----KAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFA-VSLNGAKGAIDAKVHSPSGALEECYVTEIDQD-KYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRV-GEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDC--QECPEG-YRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVV 2646          

HSP 12 Score: 164.466 bits (415), Expect = 1.131e-39
Identity = 175/666 (26.28%), Postives = 276/666 (41.44%), Query Frame = 3
Query:  636 VTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLL-CEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEE-----------------------PILSEQIKTLKAGNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQP------------SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVY--PKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNG-QGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVK-AKPGFNAQ--LVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFND-EDISDSPF------------HXXXXXXXXXXXXXSK------------GPIKDAKLL------------RPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNV 2396
            ++FVPKE G H +      Q +  +P  V  + +++I +A   + S   L     EG   +P  F I   +T D    +  + LS +    + + ++ L  G     + P + G Y +     +  + GSP ++ V     + E                        P +S Q  T +  +P     +A   +       +     EM    V      Q  P  P            + KV   G GLE+  A   A F+I +++A +  + + VEGP +A I   D  DG+CGV Y V  PG Y ++V ++  HIP SP VVPV     D + L +S++  SG  ++    F             VS NG +G + A V SPSG      +  ++  KY VR+ P E G + I+V + G  I  SPF ++  +PG      LV+A G GL         +FVV+   AG G+L + I+GP+  ++ C +  +G   V YTP+  G Y IS+K+     I  SPF            H             +K            GP   +K++            + + FT+DCS+AG   L V V  P +   +  + +K V       + V Y+ ++ G   + VK+    I GSP++  V
Sbjct: 2009 ISFVPKETGEHLVHVKKNGQHVASSPIPV-VISQSEIGDASRVRVSGQGL----HEGHTFEPAEFII---DTRD--AGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFA------------VSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGY-RVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEE--ILVKHV---GSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVV 2646          

HSP 13 Score: 130.568 bits (327), Expect = 2.679e-29
Identity = 97/284 (34.15%), Postives = 134/284 (47.18%), Query Frame = 2
Query: 4853 PKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLK--QARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            P ++A V  PSGN+    VQ  GDG Y V+++P E G H V V  +  P+  SPF++PV     DP  V   G G+     +K  KF V T  AG+G L +A++GPS+  M+C + +DG     Y+    G Y +N+TYGG+  + GSPF   V                                    ++  K+ C G GL     R N   SF VD S+AG   L V + GP    E V V    +   TV+YV    G + I V +GD+++P SPF V V
Sbjct: 1291 PHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTE-GCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGH-QVPGSPFKVPVH---------------------------------DVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKV 1539          

HSP 14 Score: 124.405 bits (311), Expect = 1.669e-27
Identity = 87/298 (29.19%), Postives = 142/298 (47.65%), Query Frame = 2
Query: 4808 GGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            G    I +   + ++  L A+V  PSG  EP +++++ +G  G+ F P+E G HLV V+ N + +  SP  + +   +  D   V  SG+GL      + A+F ++T +AG G L+++I+GPSKV++N  + EDG    TY  T PGNYIINI +  + H+ GSPF+  V G              +V+   + +R     A   S       C  L LK   ++  +             +   +  P     E  +    N+ + + +V  E GTH + V++  + +PGSPF   V
Sbjct: 1966 GSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKF-ADQHVPGSPFSVKVTG------------EGRVKESITRRRRAPSVANVGSH------CD-LSLKIPEISIQD-------------MTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTV 2230          

HSP 15 Score: 111.309 bits (277), Expect = 1.867e-23
Identity = 81/300 (27.00%), Postives = 133/300 (44.33%), Query Frame = 2
Query: 4811 GLISITVRAEDGEIP------KLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMV 5689
            GL   ++R  D  IP      ++   V+ PSG +    +    DG   V+++P E G H + +  +   I GSP +  V +     G V A G GL+H +V+K A F VNT +AG G L++AI+GPSK  ++C + +DG    +Y+   PG+Y I + Y    H+ GSPFTA V G+ S                                         + +   ++ S     ++ S+    +L   +  P    E  ++K + N    + +V KE+G H++ V+   + +  SP  V
Sbjct: 1782 GLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNC--GHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQ-HVPGSPFTARVTGDDS-----------------------------------------MRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPV 2037          

HSP 16 Score: 100.138 bits (248), Expect = 3.970e-20
Identity = 78/300 (26.00%), Postives = 132/300 (44.00%), Query Frame = 2
Query: 4802 DAGGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHY-KADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            + G    ++++  +  I  + A V +PSG    A + +  +  Y ++F P E GTH V V+   + + GSPF+  VG   +     V A G GL  A     A+F + T  AG+G L +A++GPSK  ++  + +DG     YV   PG+Y +++ +    HI  SPF   V                                   S +  ++    L     ++N   SF V  + A  G +   +  P    EE  V  +  +++ V ++ +E+G ++I V++    IPGSPF + V
Sbjct: 2155 NVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKF-NEEHIPDSPFVVPV--------------------------------ASPSGDARRLTVSSLQESGLKVNQPASFAVSLNGA-KGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRV 2420          

HSP 17 Score: 95.5153 bits (236), Expect = 9.298e-19
Identity = 82/283 (28.98%), Postives = 125/283 (44.17%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQ-IGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            K+ + +  PSG   P  V+  +G     V+F PRE G + V V  +  P+ GSPF +        P  V A G GL        A+F ++T  AG+G L + ++GP +  + C +  DG    +YV T PG+Y INI +  + HI GSPF A                H     +AS                 K+ C G GL++A    V  F VD S AG   L + I        EV ++  G+   T+ Y+    G + + +++G + +P  P  + V+
Sbjct: 1003 KVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEA-VAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF-ADTHIPGSPFKA----------------HVVPCFDAS-----------------KVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVE 1250          

HSP 18 Score: 92.4337 bits (228), Expect = 8.853e-18
Identity = 86/333 (25.83%), Postives = 146/333 (43.84%), Query Frame = 3
Query: 3795 EHLVNVY----EKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLE--KGLANQGNEFTIDTRDAGYGSLNISIEGPS----KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEM-----ALKDLKVNVHTP---SGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVG-SVTPGGSKDVTASGPGLEKGFIDINN--EFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            EH V  Y     K    PG+P +  +      +  K +  G G+E    +  +  EFT++TR AG G + + +E P+    +A++   +++N   +V Y+P   G + + V +AG+++  SPF V V+  +          +V       +  GN        E+        +++V +  P    G  EP  +E  G+   R  +     G+H V V      I  SP+  TVG +  P   + V   G GL+   + +    +F +YT+ AG+G + V ++GP   E   Q+    G     Y    PG Y  +I + G++I  SPF + V
Sbjct:  254 EHSVMTYLSQFPKAKLKPGAPLRPKL------NPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQ------GDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVIQDPMGQKGTVEP-QLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPSACRAV---GRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKV 570          

HSP 19 Score: 91.6633 bits (226), Expect = 1.622e-17
Identity = 102/352 (28.98%), Postives = 139/352 (39.49%), Query Frame = 2
Query: 4856 KLEASVQTP---SGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSH--AIVDKKAKFFVNTSNAGSGSLNVAIDGPS-KVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVV----------------EG---NKSATNVNQE------------EQHSQVEIEASDK---RC-VSQYAEKSSSNVEKIIC----------------------------QGLGLKQA--RLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++E  +Q P    G +EP + +  GD  Y   + P   G H V V     PI  SP+ + VG    +P    A G GL      V + A F V T  AGSG L V + GP  +  +   +  DG Y F Y    PG YI+ IT+GG  +I  SPF   V                EG    KSA  V +             E  SQ +IE  DK    C V  + +++      ++C                            +G GL++    +N    F VDA   G   L V +        E +VK  GN  ++  YV ++   H  MV WG   IP SPF V+V
Sbjct:  415 EVEVVIQDPMGQKGTVEPQL-EARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQ-ACNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQ-NIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNV 763          

HSP 20 Score: 73.559 bits (179), Expect = 4.505e-12
Identity = 78/284 (27.46%), Postives = 116/284 (40.85%), Query Frame = 2
Query: 4871 VQTPSGNMEPAIVQQIGDGQ--YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGL--SHAIVDKKAKFFVNTSNAGSGSLNVAIDGP----SKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            V+ P+G+ E A V    D    + V + P   GTH V V    + I  SPF + V   + D   V A G GL  S  I +K   F + T+ AG+G + V I  P      V        D  Y  +Y  T  G + +++T+ G   I  SP+T  V                                +  + +  + + +GL  K  R+     F V    AG G L V + GP +  E V  K +G+  +  +Y     GT+I+ + WG ++I  SPF V V
Sbjct:  320 VEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVIQDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAG-VPIPRSPYTVTV-------------------------------GQACNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGP-KGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKV 570          

HSP 21 Score: 67.781 bits (164), Expect = 2.769e-10
Identity = 79/312 (25.32%), Postives = 136/312 (43.59%), Query Frame = 2
Query: 4817 ISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFR---IPVGHYKADPGMVHASGEGLSHAI-----VDKKAKFFVNTSNAGSGSLNVAIDGP--SKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPF-TAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKII-CQGLGLKQAR-LNSVNSFFVDASQAGYGILLVGIAGPVR-PCEEVVVKHVGNNQ---FTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            +  T+ A+D     L   +  P G  +   +Q   DG Y V + P   G + + ++     I  SP+R   +P G        V   G GL   I     + ++    V+T  AG G +   +  P  S+V+++  E EDG ++  Y A  PG Y+I + +GG  H+  SPF    + G++ +    Q    SQ   + + +   +Q  +++ +    ++   GL +   R  + V  F +   +         I G VR P  +V    + +N+    TV Y   E+G H + +R+ +  IPGSP   +VD
Sbjct: 1566 VEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGE-HVPNSPFQVTALAGDQPSV---QPPLRSQ---QLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGE---------ITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVD 1861          

HSP 22 Score: 63.1586 bits (152), Expect = 7.528e-9
Identity = 62/261 (23.75%), Postives = 101/261 (38.70%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNC--HETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            DG   V + P   G + + V+ N++ + GSPF         D  M       +SH  V   A   +N S      L   +  PS     C      +G+   ++V    G +++++   G  H+  SP   V+               SQ EI                 +  ++   G GL +        F +D   AGYG L + I GP +   ++  + + +    V Y   E G +II +++ D+ +PGSPF V V
Sbjct: 1917 DGTCSVSYLPVLPGDYSILVKYNEQHVPGSPF---TARVTGDDSMR------MSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQ-HVASSPIPVVI---------------SQSEI----------------GDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSK--VDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKV 2134          

HSP 23 Score: 60.8474 bits (146), Expect = 3.360e-8
Identity = 73/306 (23.86%), Postives = 118/306 (38.56%), Query Frame = 2
Query: 4823 ITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVD--KKAKFFVNTSNAGSGSLNVAID------GPSKVNMN---CHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQA--RLNSVNSFFVDASQAGYGILLVGIAGPVR--PCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
             TV A+ G    L   VQ   G    A+V+  G+G Y   + PR+   H   V      I  SPFR+ VG   + P  V   G G++   +   +   F V+ + AG G +++ I       GP++ +++        D +   Y     G+Y I + +                        +Q    S + ++            + S +  K+  +G GL +    L     F V+A  AG G L V  +G  +     +V +    +N +TV Y   + G   + V +G   IP SPF V V
Sbjct:  695 FTVDAKHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGA-GSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTPRGAGSYTIMVLF-----------------------ADQATPTSPIRVKV-----------EPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAV 965          
BLAST of Filamin-A vs. Ensembl Human
Match: FLNC (filamin C [Source:HGNC Symbol;Acc:HGNC:3756])

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 488/1260 (38.73%), Postives = 685/1260 (54.37%), Query Frame = 3
Query: 1248 SKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTV--EGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDA--KLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKC---------AIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQ---EVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGE-PVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYV----------------INVTYAGK-------------------------NVPGSPFNV----------------------NVEGDKVVPCETQKMERVQEAVKATQVGGN-------------------CEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            SKV   G GLE+    E A FT+D  +A  A + + +  +   +A +   +N DGT  + Y    PG YTI + Y    +P+ P  V V P     +D S V  SGPG+ P GV ++   +FTVDA  ++  G   V A V +PSG +T+  + +  +G Y V+YT  EEG H + V Y+ + +  SPF V    G +   V A GPGL    VN+  +F V+  GAG G LGLAIEGP++A++ C DNKDG+C VEY P   GDYD+++ F    I  SPF V V D V P KVK  GP   A  +   P  FT+DCS+AG+APL+V V  P +G+++ PV ++       GT  V Y P   GP  + VKY    +  SPFK  V+      KV+  G G+      I AS+P  F ++ +DAG    + V + +P G+P   +I    +G YT  Y     G + I++   G  +P SP+ + ++PTG+  KC          + A     IQ+ +E+VIT++ K AG+G++TCTV   +  +            + V V E+ DG   ++Y   E G+Y++ +++GG+ IPN  F   AT       E  E+M R     I   +                    +L  +V  PSG      IT  DN    I + Y P+E+G HQ+ +   G  I GSP QF+VD      V+A+GPGLS G  N+ A FTI+TKDAG GGLSL VEGPSK EI C+DN DGT  VSY+P APG+Y+II++F D+ I GSPFTA ITG+  ++ SQ+ VG S+++ LKI  SDLS LTA +  PS  + PC++K++ N  +G+SFTPKE GEH+V+V + G  +  SPFK+ V   E+GDA+KV+V GKGL +G   Q  EF +DTR+AGYG L +SIEGPSK +I+C+D E+G C V Y PTEPG Y+                + VT  G+                          +PG+ F +                        E  K    ET++  RV+E+   TQVGG+                        +  E + +D+   V +PSG  E  +I +  +    ++FV +E G H V+V ++ +H+ GSPFQFTVG +  GG+  V A G GLE+G   +  EF+I+TREAGAG +S+A+EGPSKAE+ F++ +D GSC V+Y V +PGDYE SIKFN EHI +SPF + V
Sbjct: 1156 SKVRASGPGLERGKVGEAATFTVDCSEAGEAELTIEILSDAGVKAEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPA----VDTSGVKVSGPGVEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYEEGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDVVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGP-TGVAE-PVEVRD---NGDGTHTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGL--NASGIPASLPVEFTIDARDAGEGL-LTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDEIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTCTVSTPDGAE------------LDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLATEEPVVPVEPMESMLRPFNLVIPFAVQKG-----------------ELTGEVRMPSGKTARPNIT--DNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSQLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTYCPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEES---TQVGGDPFPAVFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKVEAAEIVEGEDSAYSVRFVPQEMGPHTVAVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKD-GSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPV 2368          

HSP 2 Score: 394.815 bits (1013), Expect = 1.302e-141
Identity = 452/1637 (27.61%), Postives = 695/1637 (42.46%), Query Frame = 3
Query:   39 YEVTYRP-QECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKP-NVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLN-----PENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKA-DIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKG---LLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPILSEQIKTLKAGNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQPSSKVIVYGKGLEK--VAAKEKAIFTIDSKDAPSAPIGVTVE------GPGEAVID--CVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQ---SPSGKQTNG--LIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHS-CKVNEKTQFVVDLDGAG-HGSLGLAIEGPADAEIQCHDNKDGTC---LVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKE--SVITIETKE---AGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFV-DTKGEGRVTAFGPGLSSGTTNEVAE-FTIITKDAGPGGLSLIVEGPSKTE--IKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVG---NSSEIPLKIP--------SSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATK----VKVSGKGLEKGLA-----NQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCK--DNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCE-TQKMERVQEAVKATQVGGNCEINLKIDEMALK-DLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI-IVEDDSIK 4748
            +  TYRP  E P++  +H  V   G  I  SPF +  ++    +    +   L+P  V++++   FKV        E  VTV    G   EPV V++     ++  Y P   G++++T +  G  + ++P  V V  E    V+K++  G  P +E    Q  K  S + V+     +V  L      P    I    +   DG+  V + P E G +++     D+ I ++P I   LP   D      K   P    +E     V+KP  FTI  D       D  +     D     P+  K +P G     C ++P K             PIK    TI++    +                  P +P  + N G+ + P                               +V VYG G+EK  + A E   FT+D  +A    + + ++      GP EA ID   + N + T  V Y  P  G YTI VL+ N  IP SP  + V P      D S V A GPGL+  GV       FTV        G G  K  VQ   +  G+      +IDN ++  Y V+YT  ++G   + VTY G P+  SPF+V   P  +   +   G  L+S   V ++  F V+  GAG  G L + +  P+   I C     G      V Y P + G Y + + ++   +  SPF VE V    P KV + GP +K   +  P  F+ID   AG   L + V  P            + +    G+  V Y+P E G   I++ + ++ I GSPFK  +       KV+  G G+  + G +  +  A F V+  +AG   ++ + + +  G    + I    +G Y   Y     G + I++   G P+PK P  V   P  +     +     +   V +E  +  T++ +     G   +T  V      K                V ++ DG   V Y   EEG +LVEV Y   ++P   F    T   +    T  R+    +   L + A     F + T+      L   +  PS    E  ++  DN   +  ++Y P   G + + +   GRPI GSPF+  V D    G+V   GPGL +G    V + FT+    AG   L + V GP+     ++  DN DGT  V Y P   G Y + +K+ DQ +  SPF   +          A G   N+S IP  +P         +    LT ++  P        I+   +G   VS+ P  +G + + +   G +IP SPF+++      GDA+K    V + G GL   L       Q    T+D + AG G +  ++  P  AE+D    +N +G   + Y   EPG YVI + + G+++P SPF+V    + VVP E  + M R                NL I     K +L   V  PSG T   +I D  +G + +++   E G+H + + +   HI GSP QF V ++    S+ V+A GPGL  G ++    F I T++AG G +S+A+EGPSKAE+  ++++D G+C V+Y  + PGDY   ++F+ +HI  SPF   I  DDS++
Sbjct:  436 FRCTYRPAMEGPHT--VH--VAFAGAPITRSPFPVHVSEACNPNACRASGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTE-EPVKVREAGDGVFECEYYPVVPGKYVVTITWGGYAIPRSPFEVQVSPE--AGVQKVRAWG--PGLETG--QVGK--SADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKG--DGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILPAPPDCFPDKVKAFGPG---LEPTGCIVDKPAEFTI--DARAAGKGDLKLYAQDADG---CPIDIKVIPNGDGTFRCSYVPTK-------------PIK---HTIIISWGGVNV----------------PKSPF-RVNVGEGSHP------------------------------ERVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGRYTIMVLFANQEIPASPFHIKVDPSH----DASKVKAEGPGLNRTGVEVGKPTHFTV-----LTKGAGKAKLDVQFAGTAKGEVVRDFEIIDN-HDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNVAPPLDLSKIKVQG--LNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGGAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGTPAPFSIDTKGAGTGGLGLTVEGPCE-------AKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHIPGSPFKATIRPVFDPSKVRASGPGL--ERGKVGEA--ATFTVDCSEAG-EAELTIEILSDAGVKAEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPGVEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKT------------DTYVTDNGDGTYRVQYTAYEEGVHLVEVLYDEVAVPKSPFRVGVT---EGCDPTRVRAFGPGLEGGLVNKANR---FTVETRGAGTGGLGLAIEGPS----EAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDVVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDGTHTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDEIPYSPFRIHAL--PTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTCTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLATEEPVVPVEPMESMLR--------------PFNLVIPFAVQKGELTGEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAIN---SRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKD-GTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMR 1920          

HSP 3 Score: 132.109 bits (331), Expect = 1.302e-141
Identity = 95/350 (27.14%), Postives = 159/350 (45.43%), Query Frame = 2
Query: 4802 DAGGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGN-KSATNVNQEEQ-------------------------HSQVEIEASDKRCVSQYAEKSSSNVEKI-----------------------ICQGLGLKQARLNSVNSFFVDAS-QAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            + G    ++++  + ++ +L AS++ PSGN EP +++++ +   G+ F+P+E G H+V V  + K +  SPF+I VG  +  D   V   G+GLS     + A+F V+T NAG G L ++I+GPSKV++NC + EDG  + TY  T PG YIINI +  + H+ GSPFT  V G  +   ++ +  Q                          +Q  +  +  R    Y     + + K                           G  L + RL S  S       +A    +   +  P    E   +    ++ ++V +V +E G H + V++  + +PGSPF   V
Sbjct: 1925 NVGTSTDVSLKITESDLSQLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTYCPTEPGTYIINIKF-ADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKVEAAEIVEGEDSAYSVRFVPQEMGPHTVAVKYRGQHVPGSPFQFTV 2273          

HSP 4 Score: 391.349 bits (1004), Expect = 8.581e-138
Identity = 402/1473 (27.29%), Postives = 635/1473 (43.11%), Query Frame = 3
Query:  636 VTFVPKENGPHSIGCWVQDQPINETPCIVK-SLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKG---LLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQES---------------PLITEEPILSEQIKTLKAGNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKWP------------------------QSKPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIE------GPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP---IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNG---LYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEK-CAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSF--QEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSP----FQFFVDTKGEGRVTAFGPGLS-SGTTNEV-AEFTIITKD---AGPGGLSLIVEGPS--KTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANIT--GEPVKKSQVA-------VGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGL-ANQGNEFTIDTRDAGYGSLNISIEGPSKAE--IDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPC-ETQKMERVQEAVKATQVGGNCEINLKIDEMALKD--LKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKD-----VTASGPGLEKGF---IDINNEFAIY--TREAGAGNISVAMEGPSKAEMKFQ--ESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPV 4754
            V++VPK  G H +      Q I  +P  V   +   D +     K S     +E      NKP  F I          D  VV++ P   +   V+     KG     C + P   GP+++  +    PI  SP  + V E+                 +  + +   ++ T  AG+    +    P  + +P       ++E  +   E   +P                        Q  P+    KV  +G GLE     + A F +++       +G ++EGP +A I+C D GDG+C V Y    PG Y ++V+ D+  I  SP +  + P          V A GPGL P G   D  A+FT+DA      G+G +K   Q   G   +  +    +G +   Y PT+   H I +++ G+ +  SPF V    G + + V   GPG+     K NE T F VD   AG G + + I+      GPA+A+I      N + T  V+YTP  AG Y I V F +++I  SPFH++V       KVK++GP       ++ +P HFT+    AGKA L+V+ +    G   R   I         ++ V Y   + G   + V Y   P+  SPF  NV  P  + K+KV G      N  +       F VNT+ AG    + V + +P+  P+P  +E  P G        Y   + G +K+ +  DG P+P SP+ V+ +   +P K CA   G    + V   +  +I+TK AG G +  TV+       G  E        K++ Q++ DG  +V Y+P E GEY + + +    IP   F  T    F   +VR +     + ++             F ++  +    +L  +++  +G   EV I +N +  ++I   Y P+  G + + +   G P+   P     Q  VDT G   V   GPG+   G   EV  EFT+  +     G   ++  V  PS  KT+    DN DGT++V Y     G + + + + +  +  SPF   +T   +P +            V  ++   ++   +    L   +  PS+ K+ C  K   +G+  V + P   G++ VN+   G  IPGSPF+V VK+  V D  KVK SG GL  G+ A     FT+D   AG   L +++ GP+     ++ +DN +G  TV Y P   G Y + V YA + VP SPF +     KV+P  +  K+      + A+ +  +  +   ID     +  L V +  P G  +  +I D G+G   + ++   SG + +++ +    I  SPF+       P G        V+  G GL       I I  E  I    + AG G ++  +  P  AE+     E+ D G+  + Y   +PG Y  +I+F GEHI NSPFH++  ++ + PV
Sbjct:  338 VSYVPKVAGLHKVTVLFAGQNIERSPFEVNVGMALGDAN-----KVSARGPGLEPVGNVANKPTYFDIYTAGAGTG--DVAVVIVDPQGRRDT-VEVALEDKGDSTFRCTYRPAMEGPHTVHVAFAGAPITRSPFPVHVSEACNPNACRASGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVK-----VREAGDGVFECEYYPVVPGKYVVTITWGGYAIPRSPFEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILPAPPDCFP-DKVKAFGPGLEPTGCIVDKPAEFTIDARAA---GKGDLKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGRYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKAKLDVQFAGTAKGEVVRDFEIIDNHDY---SYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNVAPPLDLSKIKVQG-----LNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLE--PGGGAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGL-VGTPAPFSIDTKGAGTGGLGLTVE-------GPCEA-------KIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHIPGSPFKATIRPVFDPSKVRASGPGLERGKVG--------EAATFTVDCSEAGEAELTIEILSDAGVKAEVLIHNNADGTYHIT--YSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSG---VKVSGPGVEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYEEGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAGTGGLGLAIEGPSEAKMSC--KDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKD--VVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDGTHTVHYTPATDGPYTVAVKYADQEVPRSPFKI-----KVLPAHDASKVRASGPGLNASGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDEIPYSPFRI---HALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTCTVSTPDGAELDVDVVENHD-GTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLATEEPVVPV 1742          

HSP 5 Score: 122.865 bits (307), Expect = 8.581e-138
Identity = 98/338 (28.99%), Postives = 148/338 (43.79%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSA----TNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGL-----------------------------------------------------GLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            +L   V+ PSG      +    DG   V+++P E G H + ++ +   I GSP +  V    +    V A G GLSH +V+K A F + T +AG G L++A++GPSK  + C + +DG    +Y+ TAPG+Y I + +  + HI GSPFTA + G+ S      NV      S ++I  SD   ++      S N E  + + L                                                     GL +     V  F VD   AGYG L + I GP +   ++  + + +    V Y   E GT+II +++ DK +PGSPF V V
Sbjct: 1764 ELTGEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSR--HVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDYSIIVRF-DDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVS-LKITESDLSQLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSK--VDINCEDMEDGTCKVTYCPTEPGTYIINIKFADKHVPGSPFTVKV 2095          

HSP 6 Score: 387.111 bits (993), Expect = 6.438e-108
Identity = 359/1192 (30.12%), Postives = 552/1192 (46.31%), Query Frame = 3
Query: 1251 KVIVYGKGL-EKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAV--IDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQ--LVTAS--GPGLHSC-----KVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAK-LLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPN--GLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGR----VTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIV---EGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQP-IAGSPFTANITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVN---------VHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKD-VTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNG-EHIVNSPF 4718
            KV   G GL   V A+    FT+D   A  AP+ V V GP      ++  DNGDGT  V Y     G YT+ V Y +  +P+SP  + V P      D S V ASGPGL+  G+      +FT+DA +    G+G +   +  P GK     I +  +G Y V Y P   G + I + Y G  I  SPF + A P  +A   LVT S  G GL +C     ++ ++T   VD   AG G +   +  P  AE+     +N DGT  + YT  + G Y I+++F  E I +SPFHV   +E          P++  + +LRP +  I  +   K  L  +V  P SG + RP     +     GT  V Y P E G   + +KY+ + I GSP +   V       V   G G+   +G  + + PA F + TKDAG       GL      P    I  + N  G  T  Y     GD+ I V  D   +P SP+T K   TG+       + +   + V   + ++++  E+   Q+T ++    R   G  E           ++  P+    + + PKE GE++V V+  G+ + N  F      S  E+ +     V  +  +E   + F    F ++T++     L   +  PS    +V I   D      K+ Y P+E G + + +    + + GSPF   V   GEGR    +T      S  T     +  +      PG    +V   E  ++T  +    +  T +        G     ++ ++   + G PF A + G+ + + ++    S     +  +S    +TA++T+PS       I +  + A  V F P+E G H V V  +G  +PGSPF+  V     G A KV+  G GLE+G+A    EF+I TR+AG G L+I++EGPSKAEI  +D ++G C V Y+  EPG+Y +++ +  +++P SPF        VVP  +   +  +  V + Q     E  LK+++ A   +++N         VHTPSG  E C + +  +    I+F+  E+G+H + V     HI GSPF+  VG  +  G    V+A GPGLE G   +++EF + T  AG+G +SV ++GPSK ++  +E  +     VTY    PG+Y  +IK+ G +HIV SPF
Sbjct: 1445 KVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDGTHTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAH----DASKVRASGPGLNASGIPASLPVEFTIDARDA---GEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDEIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTCTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLATEEPVV-------PVEPMESMLRPFNLVIPFA-VQKGELTGEVRMP-SGKTARP----NITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQF-YVDAINSRHVSAYGPGL--SHG--MVNKPATFTIVTKDAGEG-----GLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKI--TGD------DSMRTSQLNVGTSTDVSLKITESDLSQLTASI----RAPSGNEE--------PCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPS--EIGDASKVRVWGKGLSE--GHTFQVAEFIVDTRNAGYGGLGLSIEGPS----KVDINCEDMEDGTCKVTYCPTEPGTYIINIKFADKHVPGSPFT--VKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKI----PGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPA-VFGDFLGRERLGSFGSITRQQEGEASS-QDMTAQVTSPSGKVEAAEIVEGEDSAYSVRFVPQEMGPHTVAVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPF--------VVPVASLSDDARRLTVTSLQ-----ETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELDSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPE--GHVVTYTPMAPGNYLIAIKYGGPQHIVGSPF 2555          

HSP 7 Score: 352.443 bits (903), Expect = 4.568e-97
Identity = 439/1648 (26.64%), Postives = 677/1648 (41.08%), Query Frame = 3
Query:   96 VTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLND-GIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIE---VCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQ----------ESPLITEEPILSE-------QIKTLKA-GNPHNPMQKANP--------------GKSNKPYTALEEAIKEMK----ESAVESSKWPQSKPDQPS-SKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKV--NEKTQFVVDLDGAGHGSLGLAI---EG-PADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXX---XXSKGPIKDAKLLRPNH-------FTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNP-DVIVGLFNPNGE-----PMPLHIEARPN------GLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVA----------VGNSSEIPLKIPSSDLSTLTA-ELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVY-EKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGS---LNISIEGPS----KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVE-----GDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGA-GNISVAMEGPSKA-EMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDS 4742
            VT GG+ +P SPF +      + SK    ++ L   V + Q Q F V     G + +  V ++  +  P+   L            Y P + G + +  + DG PV  +P  V  V  +P +  K+   G  P ++   V  P  F + +  K      + + V  P    I        DG+  V+++P E G ++I     +  I  +P      P  D  +   + S P       + G+V +  +FT+  D +     +  + +LS    +   +            + P   G Y++      +P+   P  + VQ            P +    +L E         ++L A G  H   +  NP              G     YTA EE +  ++    E AV  S +     +    ++V  +G GLE     +   FT++++ A +  +G+ +EGP EA + C DN DG+C V Y    PG Y +N+ +    IP SP  VPV  KD   +D   V  SGPGL   GV       FTVD S   Q G+  ++  V  P+G      + +  +G + V YTP  +GP+ + V Y    +  SPF +K  P  +A  V ASGPGL++  +  +   +F +D   AG G L + I   EG P  A I+  DN DGT  V Y P  +G Y I++K+  ++I  SPF +  +      K     S G       L P          T+D   AG+  +   VS P     D  V          GTFD+ Y   E G  +I +++    I  SPF                          +LA+   V  V   ++ + P ++++      GE      MP    ARPN      G  T  Y   + G H++ +  DG  +P SP         +    A   G    + VNK +  TI TK+AG+G ++  V+   + ++                +++ DG  +V Y+P   G+Y + V++  + IP   F  TA  +  +   T   +V               V+ +I   D     L A +  PSG  E   +    N   +I I + P E G H + V   G+ +  SPF+  V     G   +V  +G GLS G T +VAEF + T++AG GGL L +EGPSK +I CED  DGT KV+Y P  PG Y I IKF D+ + GSPFT  +TGE   K  +           +G++ ++ LKIP +    ++A E  T +  +      +          +    GE    V  E+ T + G PF                V G  L  G    G+  +I  +  G  S   +   +  PS     AEI   + E+   +V+++P E G + + V Y G++VPGSPF   V      G   V      +ER    V A       E ++   E     L + V  PS        ED  +G+  + +V +E G + VS+   D HI  SPF   V S++    +    S   L++  + +N   +   +  GA G I   +  PS A E  +    D     + +   + G +   +KFNG HI  SPF I V + S
Sbjct:  944 VTYGGDPVPKSPFVVNVAPPLDLSKI--KVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGGAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGV--LPPDPSKVCAYG--PGLKGGLVGTPAPFSIDT--KGAGTGGLGLTVEGPCEAKIECQDNG--DGSCAVSYLPTEPGEYTINILFAEAHIPGSPFKATIRPVFDPSKV--RASGPGL-----ERGKVGEAATFTV--DCSEAGEAELTIEILSDAGVKAEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPGVEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYEEGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPV--KDV--VDPGKVKCSGPGLG-AGVRARVPQTFTVDCS---QAGRAPLQVAVLGPTGVAEPVEVRDNGDGTHTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIR--DNGDGTYTVSYLPDMSGRYTITIKYGGDEIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTCTVSTPDGAELDVDVVENH-----DGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFH-------------------------VLATEEPVVPVEPMESMLRPFNLVIPFAVQKGELTGEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGM-VNKPATFTIVTKDAGEGGLSLAVEGPSKAEI--------------TCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPF--TAKITGDDSMRTSQLNVGTSTD----------VSLKITESD--LSQLTASIRAPSGNEEPCLLKRLPN--RHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTYCPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTER----TEISKTRGGETKREVRVEESTQVGGDPFPA--------------VFGDFL--GRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKVEAAEI--VEGEDSAYSVRFVPQEMGPHTVAVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPA-------EFSIWTREAGAGGLSIAVEGPS--KAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTS---LQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELDSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQS 2467          

HSP 8 Score: 335.495 bits (859), Expect = 7.813e-92
Identity = 341/1206 (28.28%), Postives = 530/1206 (43.95%), Query Frame = 3
Query: 1251 KVIVYGKGLEKVA--AKEKAIFTIDSKDAPSAPIGVTVEGPG----EAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVR--YTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAE--IQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQ----VEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPN--GLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKA-GKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSG--CMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGE-GRVTAFGPGLSSGTTNEVAEFTIITKDA-GPGGLSLIVEGPSKTEIKCEDNHDGTFK---VSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVA---------VGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISI--EGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMAL-----KDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVED 4736
            K I YG G+E       + A FT+ + DA    + V +E P     EA +   ++ D T  V Y   V GL+ + VL+   +I +SP  V V        D + V+A GPGL P G   +    F +     +  G G V  ++  P G++    +   + G    R  Y P  EGPH ++V + G PI  SPF V      N     ASG GL     +V E   F V   GAG G L + ++GP   E  ++  +  DG    EY PV  G Y +++ +    I  SPF V+V  E   +KV++ GP ++  ++ +   F ++        +  +V   G  I        + +    G+ DV Y P E G   + V  +   I  SPF  +++ PA      +KVK  G G+ P     +   PA F ++ + AG      + L+  + +  P+ I+  PN  G + C Y       H I +   G  +PKSP+ V      +PE+  +   G +KT ++ N+ +  T++  EAG+G ++  + K     VG  E     D IK     + +   +V Y P   G Y + V +  Q IP   F      S    +        N+   E+        +F + TK      L+ +    +    + +  I  N +Y + +K  Y   ++G   + V   G P+  SPF   V    +  ++   G         E A F++ T+ A G G L + +  PS+  I C+    G  +   V Y+P   G Y + I +   P+ GSPF       P      A         VG  +   +    +    L   +  P + K+ C  +   +G+  VS+ P E GE+ +N+      IPGSPFK  ++   V D +KV+ SG GLE+G   +   FT+D  +AG   L I I  +   KAE+   +N +G   + Y P  PG Y I + Y G  VP  P  V+V+       +T  ++     V+   V         +D  +L       +   V  PSG      + D G+G  R+++ A E G+H V VL+ +  +  SPF+  VG         V A GPGLE G ++  N F + TR AG G + +A+EGPS+A+M  ++++D GSC V Y    PGDY+ +I F G  I  SPF + V+D
Sbjct:  277 KAIAYGPGIEPQGNTVLQPAHFTVQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNIERSPFEVNV---GMALGDANKVSARGPGLEPVGNVANKPTYFDI---YTAGAGTGDVAVVIVDPQGRRDTVEVALEDKGDSTFRCTYRPAMEGPHTVHVAFAGAPITRSPFPVHVSEACNPNACRASGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYPVVPGKYVVTITWGGYAIPRSPFEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEA-------IGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIL-PAPPDCFPDKVKAFGPGLEPT--GCIVDKPAEFTIDARAAGKGD---LKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGI-KCAPGVVGPAEADIDFDIIK-----NDNDTFTVKYTPPGAGRYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKP----THFTVLTKGAGKAKLDVQFAGTAKGEVVRDFEIIDNHDYSYTVK--YTAVQQGNMAVTVTYGGDPVPKSPFVVNVAPPLDLSKIKVQGLNSKVAVGQEQA-FSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGGAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGTPAPFSIDTKGAGTGGLGLTVEGPCEAKIEC--QDNGDGSCAVSYLPTEPGEYTINILFAEAHIPGSPFKATIR--PVFDPSKVRASGPGLERGKVGEAATFTVDCSEAGEAELTIEILSDAGVKAEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQ----PAVDTSGVKVSGPGVEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYEEGVHLVEVLYDEVAVPKSPFR--VGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKD-GSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKD 1439          

HSP 9 Score: 314.309 bits (804), Expect = 2.340e-85
Identity = 327/1211 (27.00%), Postives = 531/1211 (43.85%), Query Frame = 3
Query: 1233 PDQPSSKVIVYGKGLEK--VAAKEKAIFTIDSKDAPSAPIGVTVEGP--GEAVID--CVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGK-YVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIK-QVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKD--AGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKC-AIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGV--NFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF-FVDTKGEGRVTAFGPGL-SSGTTNEV-AEFTIITKDAGPGGLSLIV---EG-PSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPF---------------TANITGEPVKKS---QVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGK--GLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAE----MKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            P   +SKV   G GL +  V   +   FT+ +K A  A + V   G   GE V D   +DN D +  V Y     G   + V Y    +P+SP VV V P     LDLS +   G         +  F+  T  A      GQG +   + SPS +     ++     +   VRY P EEGP+K+++TY+G P+  SPF V+     +   V A GPGL    V     F +D  GAG G LGL +EGP +A+I+C DN DG+C V Y P + G+Y I++ F +  I  SPF   +     P KV++ GP ++  K+     FT+DCSEAG+A L +++      +SD  V  +  +   A GT+ + Y P   G   I +KY   P+   P + +V        VKV G G+ P    +L  +   F V+ +   A     V   + NP+G     ++    +G Y  +Y  ++ G H + V  D   +PKSP+ V      +P +  A   G +  + VNK +  T+ET+ A                 G    I+     K+  +++ DG  +V Y+P   G+Y V + +GG+ IP   F          V++ +           L +     V   F ++        L   V+ P+G  E V +  N +  H +   Y P+  GP+ + V    + +  SPF+   +      +V A GPGL +SG    +  EFTI  +DAG G L++ +   EG P K  I+  DN DGT+ VSY+P   G Y I IK+    I  SPF               T +I G  +      ++ +G  + I +   ++    +T  ++TP   ++   + + ++G   + +T  E G++++ +   G  IP SPF V    E V     ++   +   L    A Q  E T + R          +     A  +  DN++G  TV+Y PTE G + + + Y G ++PGSP    V+        ++ +      +    V       +   +     L + V  PS     C  +D  +G   + ++    G + + V   D+HI GSPF   +       + D +     L  G    + + ++   E+    ++ ++  PS  E    +K   ++  G   +++   + G++  S++ +G+H+ NSPF I+V
Sbjct:  863 PSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKAKLDVQFAGTAKGEVVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNVAPP----LDLSKIKVQGLNSKVAVGQEQAFSVNTRGA-----GGQGQLDVRMTSPSRRPIPCKLEPGGGAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGTPAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHIPGSPFKATIRPVFDPSKVRASGPGLERGKVGEAATFTVDCSEAGEAELTIEI------LSDAGVKAEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPGVEPH--GVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYEEGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGL-VNKANRFTVETRGA--------------GTGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRV-------PVKDVVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDGTHTVH--YTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIR--DNGDGTYTVSYLPDMSGRYTITIKYGGDEIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTCTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLATEEPVVPVEPMESMLRPFNLVIPFAVQKGELTGEVR----------MPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDA-----INSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITC--KDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKI-------TGDDSMRTSQLNVG---TSTDVSLKITESDLSQLTASIRAPSGNEEPCLLKRLPNRHIG---ISFTPKEVGEHVVSVRKSGKHVTNSPFKILV 2000          

HSP 10 Score: 266.544 bits (680), Expect = 1.124e-70
Identity = 296/1137 (26.03%), Postives = 475/1137 (41.78%), Query Frame = 3
Query: 1503 PVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLI--DNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGF-NAQLVTASGPGLHSCK--VNEKTQFVVDLDGAGHGSLGLAIEGPAD----AEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPF--HXXXXXXXXXXXXXSKG-PIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCE--YQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKC------AIKAGKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAK--VVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVD-TKGEGRVTAFGPGLSSGTTNEVAE---FTIITKDAGPGGLSLIVEGPSKTEI----KCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVK---------KSQVAVGNSSEIPLKIPSSD-LSTLTAELTTPSKIKVPCVIKKMNNG-ALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPC-ETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLE-KGFI-DINNEFAIYTRE---AGAGNISVAMEGPSKAEM-KFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAARA 4766
            P  P  +K L+     A GPG+ P+G      A FTV   +    G G V   ++ P G      +  +N  +  Y V Y P   G HK+ V + G  I+ SPF V       +A  V+A GPGL       N+ T F +   GAG G + + I  P       E+   D  D T    Y P   G + + V F    I+ SPF  HV         +   +G   K  ++     F +    AG   L+V V  P    ++ PV +++   A  G F+  Y P   G  ++ + +    I  SPF+  V   A V+KV+  G G+  + G +  S   V      + G     I G       P    IE    G  +C+  Y   + G++ + V  D   +  SP+    +P   P  C      A   G + T   V+K +  TI+ + AGKG +     K+  Q             I +KV  + DG     Y+P +  ++ + + +GG ++P   F           R  +      +   +     +  V+     +  V + +     VV P+    +  I  NDN    +K  Y P   G + + V    + I  SPF   VD +    +V A GPGL+  T  EV +   FT++TK AG   L +   G +K E+    +  DNHD ++ V Y     GN  + + +   P+  SPF  N+   P+           S+VAVG      +    +     L   +T+PS+  +PC ++      A  V + P E G + V++   G  +PGSPF V  +     D +KV   G GL+ GL      F+IDT+ AG G L +++EGP +A+I+C+DN +G C V YLPTEPG Y IN+ +A  ++PGSPF   +      P  +  K+      ++  +VG      +   E    +L + + + +G      I +  +G   I +     G + +++ +    +   P +  V       +  V  SGPG+E  G + ++  EF +  R     G  +++  +  PS A+   +      G+  V Y   + G +   + ++   +  SPF + V  +   P   RA
Sbjct:  264 PGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFTVQTVDA---GVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNIERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGRRDTVEVALEDKGDSTFRCTYRPAMEGPHTVHVAFAGAPITRSPFPVHVSEACNPNACRASGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKG--TEEPVKVRE---AGDGVFECEYYPVVPGKYVVTITWGGYAIPRSPFEVQVSPEAGVQKVRAWGPGL--ETGQVGKSADFVVEAIGTEVGTLGFSIEG-------PSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILPA--PPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDL-----KLYAQDADGC-------PIDIKVIPNGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVK--YTPPGAGRYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNR-TGVEVGKPTHFTVLTKGAGKAKLDVQFAGTAKGEVVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNVA-PPLDLSKIKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGGAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAV--EGVLPPDPSKVCAYGPGLKGGLVGTPAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHIPGSPFKATIR-----PVFDPSKVRASGPGLERGKVGEAATFTVDCSEAGEAELTIEILSDAGVKAEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAV--DTSGVKVSGPGVEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYEEGVHLVEVLYDEVAVPKSPFRVGVT-EGCDPTRVRA 1355          

HSP 11 Score: 247.284 bits (630), Expect = 7.266e-65
Identity = 266/1025 (25.95%), Postives = 442/1025 (43.12%), Query Frame = 3
Query: 1815 KAKPG-------FNAQLVTASGPGL--HSCKVNEKTQFVVDLDGAGHGSLGLAIEGPA----DAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXS-KGPIKDAK---LLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIK-QVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG----RVTAFGPGL--SSGTTNEVAEFTIITKDAGPGGLSLIVE------GPSKTEIKCE--DNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI-----------TGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNG--ALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLA-NQGNEFTIDTRDA-GYGSLNISIEGPSKAEIDCKDNENG---VCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAM--EGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVE 4733
            K KPG        N +   A GPG+      V +   F V    AG G + + IE P     +A++  +++KD T  V Y P  AG + ++V F  ++I  SPF V V   +      S +GP  +       +P +F I  + AG   + V +  P      R  T++  +E     TF   Y P   GP  + V +  +PI+ SPF  +V +       +  G G+ P+   +     A F V TK AG   ++ V +  P G   P+ +    +G++ CEY     G + +++   G  +P+SP+ V+  P    +K        +T QV K +   +E      G +  +++   +               K++  +  DG   V Y P E GEY V V    + I +  F      +  +      ++    +             F I+ +     DL        GC  ++ +  N +     +  Y P++   H + ++  G  +  SPF+  V   GEG    RV  +GPG+  +    NE   FT+   +AG G +S+ ++      GP++ +I  +   N + TF V Y P   G Y I++ F +Q I  SPF   +            G  + ++ V VG  +   +    +  + L  +    +K +V    + ++N   +  V +T  + G   V V   G  +P SPF VNV      D +K+KV  +GL   +A  Q   F+++TR A G G L++ +  PS+  I CK    G      V+Y+P E G Y +++TY G  VPGSPF V    + V+P +  K+      +K   VG     ++         L + V  P      C  +D G+G+  + ++  E G + +++L  + HI GSPF+ T+  V       V ASGPGLE+G +     F +   EAG   +++ +  +   KAE+    + D G+  +TY  + PG Y  +IK+ G  +   P  + V+
Sbjct:  261 KLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFTVQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNIERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDP----QGRRDTVEVALEDKGDSTFRCTYRPAMEGPHTVHVAFAGAPITRSPFPVHVSEACNPNACRASGRGLQPK--GVRVKEVADFKVFTKGAGSG-ELKVTVKGPKGTEEPVKVREAGDGVFECEYYPVVPGKYVVTITWGGYAIPRSPFEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEAIGTEVGTLGFSIEGPSQA--------------KIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILPAPPDCFPDKVKAFGPGL-EPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVIPNGD--GTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNV---GEGSHPERVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGRYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKAKLDVQFAGTAKGEVVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNVAPPL--DLSKIKV--QGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGGAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAV----EGVLPPDPSKVCAYGPGLKGGLVGTPAPFSIDTKGAGTGGLGLTVEGPCEAKIEC--QDNGDGSCAVSYLPTEPGEYTINILFAEAHIPGSPFKATIRPVF--DPSKVRASGPGLERGKVGEAATFTVDCSEAGEAELTIEILSDAGVKAEVLIHNNAD-GTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQ 1245          

HSP 12 Score: 244.588 bits (623), Expect = 4.871e-64
Identity = 387/1653 (23.41%), Postives = 641/1653 (38.78%), Query Frame = 3
Query:  117 IPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAP---MIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAV---EEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTI----VVQESPLITEEPILSEQIKTL----------KAGNPHNPMQKANPG------------------------KSNKPYTALEEAIKEMKESAVESSKWPQSKPDQPSSKVIVYGKGLEK--VAAKEKAIFTIDSKDAPSAPIGVTV---EG-PGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCK-VNEKTQFVVDLDGAGHGSLGLAIEGPAD--AEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPT--GNPEKCAIKA---GKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVN-SQGRPIKGSPF-QFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGG---LSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPF--TANITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAE---------LTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGL-ANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNE--NGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKD-RHIRGSPFQFTV-GSVTPGG----------------------------------SKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGP-SKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            IPGSPF        + SK   +   L+   K+ +  TF V  ++  ++E  + +    GV  E VL+   +  TY  TY+P   G + IT    G PV K P  V V   +  +  K+   G+ P   + EV    T    S       + V  +VLNP       +     DGT +V +   E G H +     +           ++PK+     + +   P  +       + G VNK   FT+  +          + +  P   + +  K  K       E+IP   G Y +  +    PI GSP  +    VV    +    P L   ++            +AG    P+Q A  G                         ++ PYT    A+K   +    S    +  P   +SKV   G GL    + A     FTID++DA    + V +   EG P +A I   DNGDGT  V Y   + G YTI + Y    IP SP  +   P  + +  L TV+  G GL      +    + TV   +    G+G V   V +P G + +  +   ++G + + YT  E G + I + + G  I +SPF V A      + V    P     +  N    F V       G L   +  P+   A     DNKDGT  V Y P + G + + +K++   I  SP    V              +    + +P  FTI   +AG+  L + V  P    S   +T K  +    GT  V Y+P   G   I V+++   I GSPF   +     +   +++          +  S      +   D      +   +  P+G   P  ++  PN      +   +VG+H +SV   G  +  SP+ +   P+  G+  K  +      +  T QV +     ++T+ AG G +  +++   +              + +  ++  DG   V Y P E G Y++ +K+  + +P G  F         ++E++TR  Q        S A  G   ++N K  +P +   ++V     +      S+  Y    + +   +  G  + +V   +   + G PF   F D  G  R+ +FG  ++     E +   +  +   P G    + IVEG            D  + V +VPQ  G + + +K++ Q + GSPF  T    GE       A G   E  +    ++ S  T E         +  PSK ++    +   +G+ GVS+  +E G++ V++      IP SPF V V +    DA ++ V+    E GL  NQ   F +    A  G ++  +  PS A  +C  +E  +   T++++P E G + I+V + G ++PGSPF + V G++    +   +      ++    G + E  +         L V +  PS     C   +   G++ + +     G + +++ +   +HI GSPF+  V G    GG                                  +  V   GPGL + F+   N F +   +AG   + V + GP +  E  + +        VTY V + GDY   +K+  E +  SPF + V
Sbjct: 1140 IPGSPFKATIRPVFDPSKVRASGPGLERG-KVGEAATFTVDCSEAGEAELTIEILSDAGVKAE-VLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPGVEPHGVLREVTTEFTVDARS-LTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYEEGVHLVEVLYDEV----------AVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTV--ETRGAGTGGLGLAIEGPSEAK-MSCKDNK-DGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDVVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAG--RAPLQVAVLGPTGVAEPVEVRDNGDGTHTVHYTPATDGPYTV---AVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIR--DNGDGTYTVSYLPDMSGRYTITIKYGGDEIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTCTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLA----TEEPVVPVEPMESMLRPFNLVIPFAVQ-----KGELTGEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGP----SKAEITCKDNKD---GTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLN----------VGTSTDVSLKITESDLS---QLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVRVWGKGLSEGHTFQVAE---FIVDTRNAGYGGLGLSIEGPSK--------------VDINCEDMEDGTCKVTYCPTEPGTYIINIKFADKHVP-GSPFTVKVTGEGRMKESITRRRQ------APSIATIGSTCDLNLK--IPGNW-FQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGDFLGRERLGSFG-SITRQQEGEASSQDMTAQVTSPSGKVEAAEIVEG-----------EDSAYSVRFVPQEMGPHTVAVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEI--AFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLS-DDARRLTVTSL-QETGLKVNQPASFAVQLNGA-RGVIDARVHTPSGAVEECYVSELDSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRV-GEQSQAGDPGLVSAYGPGLEGGTTGVSSEFIVNTLNAGSGALSVTIDGPSKVQLDC--RECPEGHV-VTYTPMAPGNYLIAIKYGGPQHIVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVKV 2691          

HSP 13 Score: 232.646 bits (592), Expect = 2.483e-60
Identity = 129/286 (45.10%), Postives = 175/286 (61.19%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK--ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAE-----KSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++A V TPSG +E   V ++   ++ ++F P E G H + V+ N   I GSPF+I VG      DPG+V A G GL        ++F VNT NAGSG+L+V IDGPSKV ++C E  +G+  TY   APGNY+I I YGG  HIVGSPF A V G + +   +  E  S V +E   K   S+ +      K SS+  K++ +G GL QA +   NSF VD S+AG  +++VG+ GP  PCEEV VKH+GN  + V Y VKE G +I++V+WGD+ +PGSPF V V
Sbjct: 2407 IDARVHTPSGAVEECYVSELDSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVGSPFKAKVTGPRLSGGHSLHET-STVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVKV 2691          

HSP 14 Score: 121.324 bits (303), Expect = 1.533e-26
Identity = 95/281 (33.81%), Postives = 131/281 (46.62%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQA-RLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            + A V  PSG      V   GDG Y V+++  E G HLV V  ++  +  SPFR+ V     DP  V A G GL   +V+K  +F V T  AG+G L +AI+GPS+  M+C + +DG     Y+   PG+Y +NIT+GG   I GSPF   V                                 K   +  K+ C G GL    R     +F VD SQAG   L V + GP    E V V+  G+   TV Y     G + + V++ D+++P SPF + V
Sbjct: 1288 VTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYEEGVHLVEVLYDEVAVPKSPFRVGVTE-GCDPTRVRAFGPGLEGGLVNKANRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGR-PIPGSPFRVPV---------------------------------KDVVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDGTHTVHYTPATDGPYTVAVKYADQEVPRSPFKIKV 1533          

HSP 15 Score: 110.538 bits (275), Expect = 3.237e-23
Identity = 88/304 (28.95%), Postives = 139/304 (45.72%), Query Frame = 2
Query: 4796 REDAGGLISITVRAEDGEIPK--LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHY-KADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            RE  G   SIT R ++GE     + A V +PSG +E A + +  D  Y V+F P+E G H V V+   + + GSPF+  VG   +     V A G GL   +    A+F + T  AG+G L++A++GPSK  +   + +DG    +YV   PG+Y ++I +  + HI  SPF   V                                   S +  ++    L     ++N   SF V  + A  G++   +  P    EE  V  + +++ T+ ++  E+G H I V++    IPGSPF + V
Sbjct: 2195 RERLGSFGSIT-RQQEGEASSQDMTAQVTSPSGKVEAAEIVEGEDSAYSVRFVPQEMGPHTVAVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKF-NDEHIPDSPFVVPV--------------------------------ASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGA-RGVIDARVHTPSGAVEECYVSELDSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRV 2463          

HSP 16 Score: 108.227 bits (269), Expect = 1.655e-22
Identity = 138/529 (26.09%), Postives = 215/529 (40.64%), Query Frame = 3
Query:   39 YEVTYRPQECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLED--------LKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVV----------------QESPLITEEPILSEQIKTLKA--GNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQP------------SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPV 1508
            Y V+Y P     S      +  GG++IP SPF I      + SK + T+          L P +++ Q     V      + +   TVS  +G  ++ V V +    T+   YT  + G+++IT    G+ +  +P  V   +E    VE        PM  +  P  F ++ P  V   +L   +V  P  K    +     DGT  V + P E G H +G       I  +P            +AIN +   A        G VNKP +FTIV  +  +      + V  P   + I  K  K        ++P   G YS++   D+  I GSP T  +                 +  L   E  LS+   +++A  GN    + K  P +    +  +    KE+ E  V   K  +   + P            +SKV V+GKGL +    + A F +D+++A    +G+++EGP +  I+C D  DGTC V Y    PG Y IN+ + + H+P SP  V V
Sbjct: 1598 YTVSYLPD---MSGRYTITIKYGGDEIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTCTVSTPDGAELD-VDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLATEEPVVPVE--------PMESMLRP--FNLVIPFAVQKGELTG-EVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYV-------DAINSRHVSA-YGPGLSHGMVNKPATFTIVTKDAGEG--GLSLAVEGPSKAE-ITCKDNK-DGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSQLTASIRAPSGNEEPCLLKRLPNR----HIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTYCPTEPGTYIINIKFADKHVPGSPFTVKV 2095          

HSP 17 Score: 93.9745 bits (232), Expect = 3.183e-18
Identity = 78/295 (26.44%), Postives = 129/295 (43.73%), Query Frame = 2
Query: 4817 ISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQ-YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
             S+  R   G+  +L+  + +PS    P  ++  G  +   V++ P E G + V +  +  P+ GSPF +  G    DP  V A G GL   +V   A F ++T  AG+G L + ++GP +  + C +  DG    +Y+ T PG Y INI +    HI GSPF A +                                 +   +  K+   G GL++ ++    +F VD S+AG   L + I        EV++ +  +  + + Y     GT+ I +++G   +P  P  VHV
Sbjct:  986 FSVNTRGAGGQG-QLDVRMTSPSRRPIPCKLEPGGGAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAV-EGVLPPDPSKVCAYGPGLKGGLVGTPAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILF-AEAHIPGSPFKATI---------------------------------RPVFDPSKVRASGPGLERGKVGEAATFTVDCSEAGEAELTIEILSDAGVKAEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHV 1244          

HSP 18 Score: 85.1149 bits (209), Expect = 1.401e-15
Identity = 71/263 (27.00%), Postives = 112/263 (42.59%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFF-VNTSNAGSGSLNVAIDGPSKVNMNCHETEDG---YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVN--SFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVH 5692
            DG   V++ P   G + V +    +PI GSPFR+PV     DPG V  SG GL   +  +  + F V+ S AG   L VA+ GP+ V       ++G   +   Y     G Y + + Y                        +QE   S  +I+              + +  K+   G GL  + + +     F +DA  AG G+L V I  P    ++  ++  G+  +TV Y+   SG + I +++G  +IP SPF +H
Sbjct: 1402 DGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDV-VDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDGTHTVHYTPATDGPYTVAVKY-----------------------ADQEVPRSPFKIKV-----------LPAHDASKVRASGPGLNASGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDEIPYSPFRIH 1629          

HSP 19 Score: 84.7297 bits (208), Expect = 1.865e-15
Identity = 79/268 (29.48%), Postives = 109/268 (40.67%), Query Frame = 2
Query: 4907 VQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKK--AKFFVNTSNAGSGSLNVAIDGP--SKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++  GD  +   + P   G H V V     PI  SPF + V     +P    ASG GL    V  K  A F V T  AGSG L V + GP  ++  +   E  DG +E  Y    PG Y++ IT+GG + I  SPF                    QV  EA                V+K+   G GL+  ++     F V+A     G L   I GP +   ++     G+    V Y   E G + + V   D+DI  SPF+ H+
Sbjct:  428 LEDKGDSTFRCTYRPAMEGPHTVHVAFAGAPITRSPFPVHVSE-ACNPNACRASGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYPVVPGKYVVTITWGG-YAIPRSPFEV------------------QVSPEA---------------GVQKVRAWGPGLETGQVGKSADFVVEAIGTEVGTLGFSIEGPSQ--AKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHI 658          

HSP 20 Score: 83.1889 bits (204), Expect = 5.378e-15
Identity = 82/356 (23.03%), Postives = 136/356 (38.20%), Query Frame = 2
Query: 4817 ISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRI---PVGHYKADPGMVHASGEGLSHAI-----VDKKAKFFVNTSNAGSGSLNVAIDGP--SKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGN------FHIVGS---------------PFTAVV----------------EGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEK---------------SSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            +  T+ A D     L   +  P G  + A ++  GDG Y V + P   G + + ++     I  SPFRI   P G        V   G GL   +     + ++    V+   AG G +   +  P  ++++++  E  DG ++  Y A  PG Y+I I +GG       FH++ +               PF  V+                 G  +  N+   +  +     A  ++ + Q   K                + N   +   G GL    +N   +F +    AG G L + + GP +   E+  K   +   TV Y+    G + I+VR+ DK IPGSPF   +
Sbjct: 1560 VEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDEIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTCTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLATEEPVVPVEPMESMLRPFNLVIPFAVQKGELTGEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSK--AEITCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKI 1913          

HSP 21 Score: 82.4185 bits (202), Expect = 9.525e-15
Identity = 76/282 (26.95%), Postives = 117/282 (41.49%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCE-EVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            +L+ +V+ P G  EP  V++ GDG +  ++ P   G ++V +      I  SPF + V   +A    V A G GL    V K A F V       G+L  +I+GPS+  + C +  DG  +  Y  T PG Y +++    +  I  SPF A                     I  +   C     +     +E   C         ++    F +DA  AG G L +  A     C  ++ V   G+  F   YV  +   H I++ WG  ++P SPF V+V
Sbjct:  508 ELKVTVKGPKGTEEPVKVREAGDGVFECEYYPVVPGKYVVTITWGGYAIPRSPFEVQVSP-EAGVQKVRAWGPGLETGQVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVIC-DDEDIRDSPFIA--------------------HILPAPPDCFPDKVKAFGPGLEPTGCI--------VDKPAEFTIDARAAGKGDLKL-YAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNV 758          

HSP 22 Score: 79.7221 bits (195), Expect = 7.283e-14
Identity = 83/276 (30.07%), Postives = 123/276 (44.57%), Query Frame = 2
Query: 4919 GDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKAD--PGMVHASGEGL--SHAIVDKKAKFFVNTSNAGSGSLNV---AIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARL--NSVNSFFVDASQAGYGILLVGI---AGPVRPCEEVV---VKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            GDG   V++ P E G + V V  + + I  SPF   +     D  P  V A G GL  +  IVDK A+F ++   AG G L +     DG   +++      DG +  +YV T P  + I I++GG  ++  SPF            VN  E                       S+ E++   G G+++  L  N    F VD S+AG G + +GI    G V P E  +   +    N+ FTV Y    +G + IMV + +++IP SPF + VD
Sbjct:  622 GDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILPAPPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADG-CPIDIKVIPNGDGTFRCSYVPTKPIKHTIIISWGG-VNVPKSPF-----------RVNVGE----------------------GSHPERVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGRYTIMVLFANQEIPASPFHIKVD 862          

HSP 23 Score: 78.9518 bits (193), Expect = 1.063e-13
Identity = 82/289 (28.37%), Postives = 124/289 (42.91%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPV--GHYKADPGMVHASGEGLSHAIVDKK--AKFFVNTSNAGSGSLNVAIDGP--SKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFT--AVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGL---KQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMV 5689
            L+ +V  P+G  EP  V+  GDG + V ++P   G + V V+   + +  SPF+I V   H   D   V ASG GL+ + +      +F ++  +AG G L V I  P       N  +  DG Y  +Y+    G Y I I YGG+  I  SPF   A+  G+ S                    +C+   +         I   GLG     + ++       VDA  AG G +   ++ P     +V V    +  F + Y   E G ++I +R+G + IP SPF V
Sbjct: 1477 LQVAVLGPTGVAEPVEVRDNGDGTHTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAH---DASKVRASGPGLNASGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGD-EIPYSPFRIHALPTGDAS--------------------KCLVTVS---------IGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTCTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHV 1732          

HSP 24 Score: 78.1814 bits (191), Expect = 1.883e-13
Identity = 80/300 (26.67%), Postives = 118/300 (39.33%), Query Frame = 2
Query: 4823 ITVRAEDGEIPKLEASVQTPSGNMEPAIV--QQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHA--IVDKKAKFFVNTSNAGSGSLNVAIDGP----SKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
             TV+  D  + ++   ++ P G+ E A V      D  Y V + P+  G H V V    + I  SPF + VG    D   V A G GL     + +K   F + T+ AG+G + V I  P      V +   +  D  +  TY     G + +++ + G   I  SPF   V                               +E  + N  +   +GL  K  R+  V  F V    AG G L V + GP    E V V+  G+  F  +Y     G +++ + WG   IP SPF V V
Sbjct:  298 FTVQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNIERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGRRDTVEVALEDKGDSTFRCTYRPAMEGPHTVHVAFAGA-PITRSPFPVHV-------------------------------SEACNPNACRASGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYPVVPGKYVVTITWGGYAIPRSPFEVQV 565          

HSP 25 Score: 59.6918 bits (143), Expect = 7.291e-8
Identity = 71/265 (26.79%), Postives = 107/265 (40.38%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETE---DGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVR---PCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRW-GDKDIPGSPFMVHV 5695
            DG  GV +  +E G + V ++ N + I  SPF +PV     D   +  +    +   V++ A F V   N   G ++  +  PS     C+ +E   D +   ++    G + I++ + G  HI GSPF   V G +S               +A D   VS Y              G GL+       + F V+   AG G L V I GP +    C E    HV      V Y     G ++I +++ G + I GSPF   V
Sbjct: 2333 DGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTSLQETGLKVNQPASFAVQL-NGARGVIDARVHTPSGAVEECYVSELDSDKHTIRFIPHENGVHSIDVKFNGA-HIPGSPFKIRV-GEQS---------------QAGDPGLVSAY--------------GPGLEGGTTGVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHV------VTYTPMAPGNYLIAIKYGGPQHIVGSPFKAKV 2559          

HSP 26 Score: 53.9138 bits (128), Expect = 4.115e-6
Identity = 81/313 (25.88%), Postives = 121/313 (38.66%), Query Frame = 2
Query: 4799 EDAGGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPG----MVHASGEGLSHAIVD--KKAKFFVNTSNAGSGSLNVAIDGPSKVNM-NCHETEDGYEFTYV----ATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQA-GYGILLVGIAGPVR---PCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVH 5692
            E   G +SI ++   G +   EA +          I++   D  + VK++P   G + + V    + I  SPF     H K DP      V A G GL+   V+  K   F V T  AG   L+V   G +K  +    E  D ++++Y     A   GN  + +TYGG+  +  SPF   V                                     ++ KI  QGL  K A +    +F V+   A G G L V +  P R   PC+  +    G     V Y+  E G + + + +    +PGSPF V 
Sbjct:  793 EAGQGDVSIGIKCAPGVVGPAEADIDF-------DIIKNDND-TFTVKYTPPGAGRYTIMVLFANQEIPASPF-----HIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKAKLDVQFAGTAKGEVVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGD-PVPKSPFVVNV---------------------------------APPLDLSKIKVQGLNSKVA-VGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCK--LEPGGGAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVE 1055          
BLAST of Filamin-A vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 528.094 bits (1359), Expect = 6.088e-155
Identity = 418/1399 (29.88%), Postives = 678/1399 (48.46%), Query Frame = 3
Query:  744 IHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKG-LLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQE-----SPLITEEPILSE------------QIKTLKAG----------NPH-NPM----QKANPGKSNKPYTALEEA-IKEMKESAVESSKWPQS----KPDQPS--SKVIVYGKGLEK-VAAKEKAIFTIDSKDAPSAPIGVTV-EGPGEAV-IDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKF----NDEDISDSPFHXXXXXXXXXXXXXSKGPIK-DAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCL---IDVKYNKSPISGSPFKTNVVQPAQVEKVKVDG--DGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEA-RPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVL----DSIKVK-VQEHPDGIASVH----YMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAV-KATQVGGNC------EINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            IH A    S         + G VN+PC F +     N +  D    V  P   +   +  ++ P G  +  + P  AG Y +    D   I+ SP  + V E      P  T    + E            ++ T   G          +P  NP+    ++  PG     YT + +A IK   + +V     P +    K  +P+  SK+ ++G G++  V +KE   FTID+  A    + V + +  GE V +D +DN DG+  V Y    PG Y +NV++    I  SPI + V P    N+D+S +   G  L  E +      + T++  ++    +G    L+   +GK+ N  +    +G Y       E G HK+ + ++ +P++++  +V+   G +     A GPGL    V EK  F +DLDGAG G+L + + GPA AE +  D  +G C VEY     GDY++++KF      E +  SPF   V  +  P ++   G  + + +L +P +F ID S+    P  VK + P      +PV  +    + P   +V +VP    P +   I++ Y+   I     K       Q+ K+  D   D +        AS       + +D G    +   +F P+G+    H+ +   NG+Y   + T   G++ +   ++G  +         +P       A K G+ + + + +E V   E  E     +T     I+ +K      I+VL    D+++++ +QE  D    V     +   + G   ++V YGG+ + + ++       ++ ++    + V  +  +       +   F +      P DL A V+ P+   E   I   DN    I + Y P   G H+L +   G  ++G+P +F+VD  G+G  T +GPGL +    E A FT+  K +    LS+ +EGP+K++IK  DN DGT   ++VP  PG Y + +K   + +  SPF   + GE  K+S ++VG++SE+ L I   +L  ++A + +P  I+ PC ++ ++ G LGVSFTP+E GEHL+ V   G  +P +PFK+ V   +VGDA+KV+VSG G  KG+  Q NE  +DT  AGYG L++S++GPSKAE+ CK+ ++G+  V Y PTEPG Y I + +A  +V  SP  V         C  +   RV + + K  +  G C       + LK+   +  D+   +  P G T+  ++ D G    ++KF  +  GIH +SV++KD H+ GSPFQFTVGS + GG+  V A+G G+ +G     N F IY REAG G ++V +EGPSKA ++F++  D G+C V Y+V+ PG+Y  ++KFN +HI +SPF + +
Sbjct:  405 IHVAPESSSKIRAFGAGLEGGIVNEPCVFDV---EMNGESKDLSFAVEGPSKAE---IGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVTGIDESKVYNVGEKIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFE--YTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKP----NVDVSGIRVEG--LENENLLIGSHLRPTINIGKLEPKSKGL--QLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEA--VVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITISGLDQPNYRLNQPINFVIDTSKTKDLP--VKATVPSDFAQLQPVVSRS--PSNPRHHNVRFVPSG-KPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEV------AARVPV-----MAEKIGRKEDV-IKEEIVFHPEIAEHSPTVLTYN-HPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEAIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEII--DNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQ--------CTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHND-GNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYI 1754          

HSP 2 Score: 293.508 bits (750), Expect = 1.670e-79
Identity = 309/1220 (25.33%), Postives = 517/1220 (42.38%), Query Frame = 3
Query: 1248 SKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLY----DNVHIPQSPIVVPV-YPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYV-VRYTPTEEGPH---KINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIE-------------GPADAEIQCH---DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRP------------NHFTIDCSEAGKAP-LEVKVSKPGSGISDRPVTIKQVEGAAPGTFD-VCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGII--PQNGAILASMPAVFHVNTKDAGVNP-DVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAV------------GNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNG-NLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVE 4733
            +K   YG GLE+    EKA+F +D   A    + + + GP +A     D G+G C V Y    PG Y + + +       H+  SP    V Y KD   + +S       GL       +    F +D S+        VKA V S   +    +  + +N ++  VR+ P+ + P+    I + Y+GL I +   +VK  P    QL+      LH  K +  T   +  + +  G +   +              GP   E   H     ++G   V +    AG+Y +    N ++++        V  +  +  + +  IK+  +  P            NH  ID  +    P ++V  +KP +    R   I+++        D + +   +LG   +DV Y    +    ++   +   + E+++ +   ++   ++          F  N +D G  P D+   +  P  +     I    +G    +Y     G H++S+  +GA L  +P        G+        G    + V + +  T+  K +   +++ +++   + ++              K+ ++ DG  S  ++P   GEY V VK GG+++ +  F        Q+ R  ++    ++++  +      G++  I +              P G  E   +   D  +  + + + P E G H + V   G+ +  +PF+  VD    G   +V   G G + G T +  E  + T  AG GGLS+ V+GPSK E+ C++   G  KV Y P  PG Y I IKF D  +  SP T   TG+   +    +               S + LK+ ++    +TA L  P        ++ +      + FTPK  G H ++V  K   + GSPF+  V +   G A KV+ +G+G+ +G     N F I  R+AG G++ ++IEGPSKA ++ KD+ +G C V Y    PG YV+ V +  +++P SPF V +        E +K+E  Q   +    G      + +   A   L+  V TP+   +  DI    +G +  ++FV +E+G H + V      +R SPF+  VG         ++ASG GL KG      EF I T  AGAG ++V M+GPSKA +   E + KG   V Y    PG Y  S+K+NG H   SPF I VE
Sbjct:  793 NKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITIS-------GLDQPNYRLNQPINFVIDTSKTKDL---PVKATVPSDFAQLQPVVSRSPSNPRHHNVRFVPSGK-PNVSIPIEIIYDGLKIDEK--LVKVLPEVEPQLIKI----LHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEVA------ARVPVMAEKIGRKEDVIKEEIVFHPEIAEHSPTVLTYNH-PIDAKKKKAHPAIQVLAAKPDAV---RLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEA--IGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAV-VGEPATFTVCAKGSQAKELSVSIEGPAKSQI--------------KIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQK-RSHLSVGSTSEVALPITQQELKGISASIKS--------------PGGIEEPCFVRLLDGGR--LGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAP---ATGEVRKLELAQFHGQGIPAGKAFTFTV-LTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELE-KG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVE 1945          

HSP 3 Score: 246.899 bits (629), Expect = 3.332e-65
Identity = 228/869 (26.24%), Postives = 391/869 (44.99%), Query Frame = 3
Query: 1647 TVKALVQSPSGKQTNGLIDNLNNGKYV---VRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGF------NAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAE--IQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPT--GNPEKCAIK-AGKDK--TIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKF-FQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI---TGEPVKKSQVAVGNSSEIPLK-------IPSSDLSTLTAELTTPS-KIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKV 4160
             ++ L   P   +   + + ++NG  V   + +T T+ G + ++V Y G  +    +    K  +       A++V      +   +   K QF V   G     L   +  P   +   +  DN DGT LV+YTP   G +++S+  N   +  +P    V              +++A +  P  FT+ C++  +A  E+ VS  G   S       ++     GT    +VP   G   + VK     +  SPF+           V V G+G    + ++ ++      +  ++      +   + +P G   P  +     G     +   + G+H I+V  DG  +PK+P+ +K   T  G+  K  +  +GK K  T+Q N+   + ++T +AG G ++ +V+   + ++                +E   G+  V Y P E G Y + +K+    + +     Q    S   V +T+ + V+ Q    L     H     +NT    P+D+ A+++ P G  +++ +   D  +   ++ + P   G H L V  +   + GSPFQF V +  EG   +V A G G+  G T     F I  ++AG G +++ +EGPSK  ++ +D++DG   V Y    PG Y + +KF DQ I  SPF   I   TGE V+K ++A  +   IP         +       L A++ TP+ ++    ++   +  +  + F PKETG H ++V   G  +  SPF++ V  +++ D T +  SG GL KG   Q  EF I+T +AG G L + ++GPSKA +D  + E G   V+Y P  PG+Y  +V Y G + PGSPF + VEG ++
Sbjct: 1127 AIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEAIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTV-CAKGSQAK-ELSVSIEGPAKSQI-----KIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFR-----------VLVMGEGQKRSHLSVGSTSEVALPITQQEL---KGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANE---LLVDTSKAGYGGLSVSVQGPSKAEL--------------TCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVE-QHGICLPDQESHLFLKLLNTS---PMDITARLMDPKGHTDDIEM--RDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGE-VRKLELAQFHGQGIPAGKAFTFTVLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKGY-KVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKEL 1949          

HSP 4 Score: 182.956 bits (463), Expect = 9.764e-46
Identity = 98/279 (35.13%), Postives = 151/279 (54.12%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQ-YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMV 5689
            LEA V TP+  ++   +  I DG+ Y ++F P+E G H + V  +  P+  SPFR+ VG     DP  + ASG+GL      +K +F +NT+NAG+G L V +DGPSK  ++ +E E GY+  Y   APG+Y  ++ Y G  H  GSPF   VEG +   N   E  H +++  A   +       +   +  K+  +G GL +       +F +D   AG  +L+VG+     PCEEVVV+H G+  +   Y + +     + +++GDK+IPGSPF +
Sbjct: 1793 LEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNG-IHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAI 2070          

HSP 5 Score: 170.629 bits (431), Expect = 5.690e-42
Identity = 234/898 (26.06%), Postives = 373/898 (41.54%), Query Frame = 3
Query: 1650 VKALVQSPS-GKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSP--FIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNV--VQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQV-----NKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSV-QNQISNELAS-NAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVD-TKGEGRVTAF----GPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDN---HDG-TFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITG----EPVKKS-------QVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEV-------------------------------GDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISI---EGPSKAEIDCKDNENG--VCTVKYLPTEPGNYVINVTYAGKNVPGSPFNV 4139
            ++A+V  P+  K+   +IDNL+ G  +V+YTP   G H++++   G  +Q +P  F V A   +     T  GPGL +  V E   F V   G+    L ++IEGPA ++I+ HDNKDGTC   + P   G+Y + VK   + + DSPF V V+ E +     S G   +  L          S + K+P          G  + P  ++ ++G   G   V + P E G  LI VK +   +  +PFK  V   Q     KV+V G G     G  L +   +  V+T  AG    + V +  P+     L  +   +GL    Y   + G + I++      +  SP TV+   TG      I+  +    Q      ++ES + ++        IT  +   +    G  + I++ D  +   Q        + + PK EG + + V Y    + NG  FQ    SF E      R+  Q  +  E  + NAF+  + E      V V +      PS    E      D+   N  +DY+ +  G + + V    + I  SPF+ ++    GE R        G G+ +G   +   FT++T  A  G L   V  P+  E+   D     DG ++ + +VP+  GN+ I +     P+  SPF   + G    +P   S       +   G   E  +   ++    LT ++  PSK  +     ++  G   V +TP   G +  +V   G   PGSPFK+ V+ +E+                               GDA KV   G GL K    +   F IDT  AG   L + +   +GP + E+  +   +G  VC+ + +P     +V  + Y  K +PGSPF +
Sbjct: 1232 LEAIVMPPTQKKEVAEIIDNLD-GTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDA---YGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSP----------GGIEEPCFVRLLDG---GRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSG--KAKGITLQANELL--VDTSKAGYG-GLSVSVQGPS--KAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQC--TGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPK----GHTDDIEMRDLGQQYYQ--------LKFTPKMEGIHTLSVMYKDAHV-NGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGV-GAVAVTIEG----PSKATLEF----KDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAG---KAFTFTVLTHRA-KGHLEAKVVTPN-NEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAY--ELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCE-EVVVRHQGSGHYVCSYR-IPDRVKGFVF-IKYGDKEIPGSPFAI 2070          

HSP 6 Score: 125.946 bits (315), Expect = 1.903e-28
Identity = 184/736 (25.00%), Postives = 299/736 (40.62%), Query Frame = 3
Query: 2193 EAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAG---VNPDVIVGLFNP-NGEPMPLHIEARPNGLYTCEYQTHDV--------GDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG-RVTAFGPGLSSGT-TNEVAEFTIITKDAGPGGLSLIVEGPS--KTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTAN---------ITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTP-KETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYA----GKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTE 4310
            +A + P+E  V  P +G   R V +   +G +PG     Y    +G   ++V + K P++GSPF    ++       KV G GI P+   I  +     HV + D      N ++ + +  P +G  +P+ +       Y  E Q+ D          D ++ V V G  +    + +   P  + +  A  AG +  I VN+  V  +E     K  ++  V+   + ++G               QE PDG A + Y P   G Y V V   G+ I +  F    T   + ++ + TR     I      N    + F ++T+    VDL  KV      +  +   + +      +    P     H++ V+  G  + G+PF   V    +  ++  FGPG+     + E   FTI    AGPG + + +        ++   DN DG+F V Y  Q PG Y + + F  + I  SP   N         I  E ++   + +G+     + I   +  +   +L      K   V  K+N      + TP  E GEH + +     +IP     V V      D  K K  G GLE+ +  +   F +D   AG G+L++ + GP+KAE   +D  NG C+V+Y+   PG+Y + + +      ++V GSPF   V+  K  P +       Q   +  Q      IN  ID    KDL V    PS F +
Sbjct:  245 DAIEGPVEAIVVDP-TGKEHRMVIL---DGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFP---LRGKPKNSFKVWGRGIAPE--GIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVG------YNDESQSMDFEYSPKQAPDDLEVLVKVAGEVI--ESHKIHVAPESSSKIRAFGAGLEGGI-VNEPCVFDVEMNGESK-DLSFAVEGPSKAEIG--------------CQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRV--TGIDESKVYNVGEKIPFRVDTR-LCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGLQLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLL--FDEIPVKEAVVEVIKGT--DVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKK-DPSQITISGLDQPNYRLNQ-----PINFVIDTSKTKDLPVKATVPSDFAQ 932          

HSP 7 Score: 118.242 bits (295), Expect = 5.160e-26
Identity = 102/353 (28.90%), Postives = 154/353 (43.63%), Query Frame = 2
Query: 4847 EIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQE-----EQH------------------SQVEIEAS-----------DKRCVSQ--YAEKSSSNVEKIICQGLGLKQARLN--------------------------------SVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            E+  + AS+++P G  EP  V+ +  G+ GV F+PRE G HL+ V+ + K +  +PF+I V   +  D   V  SG G +  I  +  +  V+TS AG G L+V++ GPSK  + C E + G  +  Y  T PG Y I I +  + H+  SP T    G KSA  V Q      EQH                  S ++I A            + R + Q  Y  K +  +E I    +  K A +N                                + N+F +   +AG G + V I GP +   E    + GN    VDY V   G +++ V++ D+ IP SPF V++
Sbjct: 1406 ELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKF-ADHHVKDSPLTVQCTG-KSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCH--VDYKVATPGEYVVAVKFNDQHIPDSPFKVYI 1754          

HSP 8 Score: 101.293 bits (251), Expect = 5.900e-21
Identity = 199/883 (22.54%), Postives = 326/883 (36.92%), Query Frame = 3
Query: 2292 GTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASM----PAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQ---IKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKF------FQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRV--TAFGPGLSSGTTNEVAEFTIITK--DAGPGGLSLIVEGPS--KTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI-------------TGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVK--NEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKD----NENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV--------------------------GSVT-----PGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAM---EGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            GT  V Y P+  G   + +  N + + G+P K  V            GDG     G  L +     PA F V  K +    ++ V +  P    + +H     +G  +  +     G++K+ V + G  +  SP+ V  M  G          K   + V   S + +   +     I+ ++K       G +E+   +++LD           G   V + P+E GE+L+ VK  G+ +P   F       Q    S  EV  +         +NEL           ++T       L+  V  PS    +  +T  +     IK+ Y P+E G + + +      +K SP       K  GRV  T        G      E  +  K  +  P  ++  +  P     +I+  D     +++ + P+  G + + + +KD  + GSPF   +              G+ V + +    N+  I  +   + +  +   +  PSK  +    K  N+G   V +     GE++V V      IP SPFKV +     EV      +  G+G+  G A     FT+ T  A  G L   +  P+  E+D  D     +     ++++P E GN+ I+VT  G  +  SPF + V G  +  C+   +    + +     G  CE  +         L V +  PS  T   D  +   G  ++++     G +  SV +   H  GSPF+  V                          G+V       G +  VTA G GL K F      F I T  AG   + V +   +GP   E      Q  G    +YR+         IK+  + I  SPF I
Sbjct: 1254 GTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYV---------DAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAK-ELSVSIEGPAKSQIKIH--DNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQ---------KRSHLSVGSTSEVALPITQQELKGISASIKS-----PGGIEEPCFVRLLDG----------GRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELL----------VDTSKAGYGGLSVSVQGPS----KAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHR--EAGVGAVAVTIEGPSKATLE--FKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAFT---FTVLTHRAK-GHLEAKVVTPNN-EVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDL--CDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKAT--LDAYELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGP--CEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAI 2070          

HSP 9 Score: 95.5153 bits (236), Expect = 3.385e-19
Identity = 114/465 (24.52%), Postives = 196/465 (42.15%), Query Frame = 3
Query: 1314 IDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQN-GQGTVKALVQSPSGKQ----TNGLIDNLNNGKYVVRYTPTEEGPHKINVTYE--GLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSE----AGKAPLEVKVSKPGSGISDR---------PVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISV 2648
            +D+ + P   I V   G    ++       G     Y++P  GL+++NV +  + +  SP  +   PK+       +    G G++PEG+ K+      V++ +  +N     +   V  PS       + G  D   +  +   Y+P ++ P  + V  +  G  I+     V  +   ++  + A G GL    VNE   F V+++G     L  A+EGP+ AEI C +  DG+ ++ YTP  AG Y + V  + + I DSPF + V +           PI+  K        ID S+      K P  V     G  +  +         P++    E   PG F+   +P+      IDV      + G+PF   V +P    K+K+ G G+   +G + +  P  F ++   AG    V V L +  GE + L +    +G +T +Y     G ++++V
Sbjct:  244 VDAIEGPVEAIVVDPTGKEHRMVILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFPLRGKPKN-------SFKVWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDF--EYSP-KQAPDDLEVLVKVAGEVIESHKIHVAPE---SSSKIRAFGAGLEGGIVNEPCVFDVEMNGESK-DLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTE-----------PIEGLKPSATRVTGIDESKVYNVGEKIPFRVDTRLCGVDLVPKVEILDPELNPISYGARE-ITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGV---DGPVYSKEPTRFTIDATQAGPGA-VEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNV 678          

HSP 10 Score: 82.4185 bits (202), Expect = 3.929e-15
Identity = 76/281 (27.05%), Postives = 121/281 (43.06%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            LEA V  P+   E A +    DG   VK++P+  G+H + +  N   + G+P +  V  Y    G     G GL +A+V + A F V    + +  L+V+I+GP+K  +  H+ +DG     +V   PG Y +++  GG   +  SPF  +V G        Q+  H  V                S+S V       L + Q  L  ++     AS    G       G   PC    V+ +   +  V +  +E+G H+I V+   K +P +PF + VD
Sbjct: 1232 LEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGD--GWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGK-AVKDSPFRVLVMGE------GQKRSHLSV---------------GSTSEV------ALPITQQELKGIS-----ASIKSPG-------GIEEPC---FVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVD 1467          

HSP 11 Score: 78.1814 bits (191), Expect = 6.584e-14
Identity = 117/476 (24.58%), Postives = 202/476 (42.44%), Query Frame = 3
Query: 3399 EFTIITKDAGPGGLSLIVEGPSKTE---IKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTP----SKIKVPCVIKKMNNGA--------------LGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNV----EGDKVVPCETQKMERVQEAVKATQVGGNCEINLKID-EMALKDL--KVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDIN-NEFAIYTREAGAGNISVAMEGPS--KAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVE 4733
            +F ++  DA  G +  IV  P+  E   +  +    G     Y     G +++ +  K  P+ GSPF   + G+P  K+   V      P  I  +D+  +  E   P    +   +   + K ++G+              +   ++PK+  + L  + +   ++  S  K++V  E    ++K++  G GLE G+ N+   F ++  +     L+ ++EGPSKAEI C++  +G   + Y PT  G Y + V   GK++  SPF + V    EG K  P  T ++  + E+ K   VG   +I  ++D  +   DL  KV +  P          +   G      +      H + V      + G+PF   V    P  +  +   GPG++          F I   +AG G + VA+        ++   ++QD GS  V Y   +PG Y+ ++ F GE I  SP  I V+
Sbjct:  240 KFAVV--DAIEGPVEAIVVDPTGKEHRMVILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFP--LRGKP--KNSFKVWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVIES-HKIHVAPES---SSKIRAFGAGLEGGIVNEPCVFDVEM-NGESKDLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLK--PSAT-RVTGIDES-KVYNVGE--KIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKE--PTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQD-GSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVK 693          

HSP 12 Score: 64.6994 bits (156), Expect = 9.715e-10
Identity = 44/144 (30.56%), Postives = 70/144 (48.61%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGN---FHIVGSPFTAVVEGNKSATNVN 5341
            DG Y       E G H + +  ++ P+  +   +  G    D     A G GL  A+V +KA F ++   AG G+L++ + GP+K      +  +G     YVA APG+Y + I +G +    H+ GSPF AVV+  K  + + 
Sbjct:  753 DGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVIKG---TDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQIT 893          

HSP 13 Score: 57.7658 bits (138), Expect = 1.174e-7
Identity = 40/109 (36.70%), Postives = 61/109 (55.96%), Query Frame = 3
Query: 4449 VTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAG--AGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVED--DSIKPVAAR 4763
            V P  S  + A G GLE G +   NE  ++  E    + ++S A+EGPSKAE+  QE  D GS  ++Y  +  G Y+  +  +G+HI +SPF + V +  + +KP A R
Sbjct:  407 VAPESSSKIRAFGAGLEGGIV---NEPCVFDVEMNGESKDLSFAVEGPSKAEIGCQERPD-GSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATR 511          

HSP 14 Score: 54.299 bits (129), Expect = 1.176e-6
Identity = 106/475 (22.32%), Postives = 175/475 (36.84%), Query Frame = 3
Query: 1380 IDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPG----FNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDG-TCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXX---XXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFK---------------TNVVQPAQVEKVKVDGDGIIPQ----------NGAILASM----PAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVK 2693
            I+  D G     + +   + G++T++V+Y + H+  SP    V            V A+G     +GV +     F        + G G V   ++ PS K T    D+ N+G   V Y     G + + V +    I DSPF V   P        +L    G G+ + K    T  V+     GH    +         I     +DG +  + + P + G++ I V  +   + +SPF + V  +          S   +      +   F I+ + AG   L V++  P     D      ++E      + V Y P   G     VKYN     GSPFK               T+ V+   V K       ++P+           GA L       PA F ++T  AG N  ++VG+    G    + +  + +G Y C Y+  D     + +      +P SP+ ++
Sbjct: 1617 IEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGA--HKVRAAG-----QGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPS-KATLEFKDH-NDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAFTFT--VLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDA----YELEKG----YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNL-LMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAIE 2071          
BLAST of Filamin-A vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 528.094 bits (1359), Expect = 6.207e-155
Identity = 418/1399 (29.88%), Postives = 678/1399 (48.46%), Query Frame = 3
Query:  744 IHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKG-LLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQE-----SPLITEEPILSE------------QIKTLKAG----------NPH-NPM----QKANPGKSNKPYTALEEA-IKEMKESAVESSKWPQS----KPDQPS--SKVIVYGKGLEK-VAAKEKAIFTIDSKDAPSAPIGVTV-EGPGEAV-IDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKF----NDEDISDSPFHXXXXXXXXXXXXXSKGPIK-DAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCL---IDVKYNKSPISGSPFKTNVVQPAQVEKVKVDG--DGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEA-RPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVL----DSIKVK-VQEHPDGIASVH----YMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAV-KATQVGGNC------EINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            IH A    S         + G VN+PC F +     N +  D    V  P   +   +  ++ P G  +  + P  AG Y +    D   I+ SP  + V E      P  T    + E            ++ T   G          +P  NP+    ++  PG     YT + +A IK   + +V     P +    K  +P+  SK+ ++G G++  V +KE   FTID+  A    + V + +  GE V +D +DN DG+  V Y    PG Y +NV++    I  SPI + V P    N+D+S +   G  L  E +      + T++  ++    +G    L+   +GK+ N  +    +G Y       E G HK+ + ++ +P++++  +V+   G +     A GPGL    V EK  F +DLDGAG G+L + + GPA AE +  D  +G C VEY     GDY++++KF      E +  SPF   V  +  P ++   G  + + +L +P +F ID S+    P  VK + P      +PV  +    + P   +V +VP    P +   I++ Y+   I     K       Q+ K+  D   D +        AS       + +D G    +   +F P+G+    H+ +   NG+Y   + T   G++ +   ++G  +         +P       A K G+ + + + +E V   E  E     +T     I+ +K      I+VL    D+++++ +QE  D    V     +   + G   ++V YGG+ + + ++       ++ ++    + V  +  +       +   F +      P DL A V+ P+   E   I   DN    I + Y P   G H+L +   G  ++G+P +F+VD  G+G  T +GPGL +    E A FT+  K +    LS+ +EGP+K++IK  DN DGT   ++VP  PG Y + +K   + +  SPF   + GE  K+S ++VG++SE+ L I   +L  ++A + +P  I+ PC ++ ++ G LGVSFTP+E GEHL+ V   G  +P +PFK+ V   +VGDA+KV+VSG G  KG+  Q NE  +DT  AGYG L++S++GPSKAE+ CK+ ++G+  V Y PTEPG Y I + +A  +V  SP  V         C  +   RV + + K  +  G C       + LK+   +  D+   +  P G T+  ++ D G    ++KF  +  GIH +SV++KD H+ GSPFQFTVGS + GG+  V A+G G+ +G     N F IY REAG G ++V +EGPSKA ++F++  D G+C V Y+V+ PG+Y  ++KFN +HI +SPF + +
Sbjct:  407 IHVAPESSSKIRAFGAGLEGGIVNEPCVFDV---EMNGESKDLSFAVEGPSKAE---IGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVTGIDESKVYNVGEKIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFE--YTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKP----NVDVSGIRVEG--LENENLLIGSHLRPTINIGKLEPKSKGL--QLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEA--VVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITISGLDQPNYRLNQPINFVIDTSKTKDLP--VKATVPSDFAQLQPVVSRS--PSNPRHHNVRFVPSG-KPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEV------AARVPV-----MAEKIGRKEDV-IKEEIVFHPEIAEHSPTVLTYN-HPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEAIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEII--DNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQ--------CTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHND-GNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYI 1756          

HSP 2 Score: 293.123 bits (749), Expect = 1.731e-79
Identity = 309/1220 (25.33%), Postives = 517/1220 (42.38%), Query Frame = 3
Query: 1248 SKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLY----DNVHIPQSPIVVPV-YPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYV-VRYTPTEEGPH---KINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIE-------------GPADAEIQCH---DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRP------------NHFTIDCSEAGKAP-LEVKVSKPGSGISDRPVTIKQVEGAAPGTFD-VCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGII--PQNGAILASMPAVFHVNTKDAGVNP-DVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAV------------GNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNG-NLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVE 4733
            +K   YG GLE+    EKA+F +D   A    + + + GP +A     D G+G C V Y    PG Y + + +       H+  SP    V Y KD   + +S       GL       +    F +D S+        VKA V S   +    +  + +N ++  VR+ P+ + P+    I + Y+GL I +   +VK  P    QL+      LH  K +  T   +  + +  G +   +              GP   E   H     ++G   V +    AG+Y +    N ++++        V  +  +  + +  IK+  +  P            NH  ID  +    P ++V  +KP +    R   I+++        D + +   +LG   +DV Y    +    ++   +   + E+++ +   ++   ++          F  N +D G  P D+   +  P  +     I    +G    +Y     G H++S+  +GA L  +P        G+        G    + V + +  T+  K +   +++ +++   + ++              K+ ++ DG  S  ++P   GEY V VK GG+++ +  F        Q+ R  ++    ++++  +      G++  I +              P G  E   +   D  +  + + + P E G H + V   G+ +  +PF+  VD    G   +V   G G + G T +  E  + T  AG GGLS+ V+GPSK E+ C++   G  KV Y P  PG Y I IKF D  +  SP T   TG+   +    +               S + LK+ ++    +TA L  P        ++ +      + FTPK  G H ++V  K   + GSPF+  V +   G A KV+ +G+G+ +G     N F I  R+AG G++ ++IEGPSKA ++ KD+ +G C V Y    PG YV+ V +  +++P SPF V +        E +K+E  Q   +    G      + +   A   L+  V TP+   +  DI    +G +  ++FV +E+G H + V      +R SPF+  VG         ++ASG GL KG      EF I T  AGAG ++V M+GPSKA +   E + KG   V Y    PG Y  S+K+NG H   SPF I VE
Sbjct:  795 NKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITIS-------GLDQPNYRLNQPINFVIDTSKTKDL---PVKATVPSDFAQLQPVVSRSPSNPRHHNVRFVPSGK-PNVSIPIEIIYDGLKIDEK--LVKVLPEVEPQLIKI----LHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEVA------ARVPVMAEKIGRKEDVIKEEIVFHPEIAEHSPTVLTYNH-PIDAKKKKAHPAIQVLAAKPDAV---RLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEA--IGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAV-VGEPATFTVCAKGSQAKELSVSIEGPAKSQI--------------KIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQK-RSHLSVGSTSEVALPITQQELKGISASIKS--------------PGGIEEPCFVRLLDGGR--LGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAP---ATGEVRKLELAQFHGQGIPAGKAFTFTV-LTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELE-KG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVE 1947          

HSP 3 Score: 246.514 bits (628), Expect = 3.422e-65
Identity = 228/869 (26.24%), Postives = 391/869 (44.99%), Query Frame = 3
Query: 1647 TVKALVQSPSGKQTNGLIDNLNNGKYV---VRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGF------NAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAE--IQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPT--GNPEKCAIK-AGKDK--TIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKF-FQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI---TGEPVKKSQVAVGNSSEIPLK-------IPSSDLSTLTAELTTPS-KIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKV 4160
             ++ L   P   +   + + ++NG  V   + +T T+ G + ++V Y G  +    +    K  +       A++V      +   +   K QF V   G     L   +  P   +   +  DN DGT LV+YTP   G +++S+  N   +  +P    V              +++A +  P  FT+ C++  +A  E+ VS  G   S       ++     GT    +VP   G   + VK     +  SPF+           V V G+G    + ++ ++      +  ++      +   + +P G   P  +     G     +   + G+H I+V  DG  +PK+P+ +K   T  G+  K  +  +GK K  T+Q N+   + ++T +AG G ++ +V+   + ++                +E   G+  V Y P E G Y + +K+    + +     Q    S   V +T+ + V+ Q    L     H     +NT    P+D+ A+++ P G  +++ +   D  +   ++ + P   G H L V  +   + GSPFQF V +  EG   +V A G G+  G T     F I  ++AG G +++ +EGPSK  ++ +D++DG   V Y    PG Y + +KF DQ I  SPF   I   TGE V+K ++A  +   IP         +       L A++ TP+ ++    ++   +  +  + F PKETG H ++V   G  +  SPF++ V  +++ D T +  SG GL KG   Q  EF I+T +AG G L + ++GPSKA +D  + E G   V+Y P  PG+Y  +V Y G + PGSPF + VEG ++
Sbjct: 1129 AIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEAIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTV-CAKGSQAK-ELSVSIEGPAKSQI-----KIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFR-----------VLVMGEGQKRSHLSVGSTSEVALPITQQEL---KGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANE---LLVDTSKAGYGGLSVSVQGPSKAEL--------------TCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVE-QHGICLPDQESHLFLKLLNTS---PMDITARLMDPKGHTDDIEM--RDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGE-VRKLELAQFHGQGIPAGKAFTFTVLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKGY-KVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKEL 1951          

HSP 4 Score: 182.956 bits (463), Expect = 1.054e-45
Identity = 98/279 (35.13%), Postives = 151/279 (54.12%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQ-YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMV 5689
            LEA V TP+  ++   +  I DG+ Y ++F P+E G H + V  +  P+  SPFR+ VG     DP  + ASG+GL      +K +F +NT+NAG+G L V +DGPSK  ++ +E E GY+  Y   APG+Y  ++ Y G  H  GSPF   VEG +   N   E  H +++  A   +       +   +  K+  +G GL +       +F +D   AG  +L+VG+     PCEEVVV+H G+  +   Y + +     + +++GDK+IPGSPF +
Sbjct: 1795 LEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNG-IHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAI 2072          

HSP 5 Score: 170.629 bits (431), Expect = 5.598e-42
Identity = 234/898 (26.06%), Postives = 373/898 (41.54%), Query Frame = 3
Query: 1650 VKALVQSPS-GKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSP--FIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNV--VQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQV-----NKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSV-QNQISNELAS-NAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVD-TKGEGRVTAF----GPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDN---HDG-TFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITG----EPVKKS-------QVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEV-------------------------------GDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISI---EGPSKAEIDCKDNENG--VCTVKYLPTEPGNYVINVTYAGKNVPGSPFNV 4139
            ++A+V  P+  K+   +IDNL+ G  +V+YTP   G H++++   G  +Q +P  F V A   +     T  GPGL +  V E   F V   G+    L ++IEGPA ++I+ HDNKDGTC   + P   G+Y + VK   + + DSPF V V+ E +     S G   +  L          S + K+P          G  + P  ++ ++G   G   V + P E G  LI VK +   +  +PFK  V   Q     KV+V G G     G  L +   +  V+T  AG    + V +  P+     L  +   +GL    Y   + G + I++      +  SP TV+   TG      I+  +    Q      ++ES + ++        IT  +   +    G  + I++ D  +   Q        + + PK EG + + V Y    + NG  FQ    SF E      R+  Q  +  E  + NAF+  + E      V V +      PS    E      D+   N  +DY+ +  G + + V    + I  SPF+ ++    GE R        G G+ +G   +   FT++T  A  G L   V  P+  E+   D     DG ++ + +VP+  GN+ I +     P+  SPF   + G    +P   S       +   G   E  +   ++    LT ++  PSK  +     ++  G   V +TP   G +  +V   G   PGSPFK+ V+ +E+                               GDA KV   G GL K    +   F IDT  AG   L + +   +GP + E+  +   +G  VC+ + +P     +V  + Y  K +PGSPF +
Sbjct: 1234 LEAIVMPPTQKKEVAEIIDNLD-GTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDA---YGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSP----------GGIEEPCFVRLLDG---GRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSG--KAKGITLQANELL--VDTSKAGYG-GLSVSVQGPS--KAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQC--TGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPK----GHTDDIEMRDLGQQYYQ--------LKFTPKMEGIHTLSVMYKDAHV-NGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGV-GAVAVTIEG----PSKATLEF----KDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAG---KAFTFTVLTHRA-KGHLEAKVVTPN-NEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAY--ELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCE-EVVVRHQGSGHYVCSYR-IPDRVKGFVF-IKYGDKEIPGSPFAI 2072          

HSP 6 Score: 125.946 bits (315), Expect = 1.888e-28
Identity = 184/736 (25.00%), Postives = 299/736 (40.62%), Query Frame = 3
Query: 2193 EAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAG---VNPDVIVGLFNP-NGEPMPLHIEARPNGLYTCEYQTHDV--------GDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG-RVTAFGPGLSSGT-TNEVAEFTIITKDAGPGGLSLIVEGPS--KTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTAN---------ITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTP-KETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYA----GKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTE 4310
            +A + P+E  V  P +G   R V +   +G +PG     Y    +G   ++V + K P++GSPF    ++       KV G GI P+   I  +     HV + D      N ++ + +  P +G  +P+ +       Y  E Q+ D          D ++ V V G  +    + +   P  + +  A  AG +  I VN+  V  +E     K  ++  V+   + ++G               QE PDG A + Y P   G Y V V   G+ I +  F    T   + ++ + TR     I      N    + F ++T+    VDL  KV      +  +   + +      +    P     H++ V+  G  + G+PF   V    +  ++  FGPG+     + E   FTI    AGPG + + +        ++   DN DG+F V Y  Q PG Y + + F  + I  SP   N         I  E ++   + +G+     + I   +  +   +L      K   V  K+N      + TP  E GEH + +     +IP     V V      D  K K  G GLE+ +  +   F +D   AG G+L++ + GP+KAE   +D  NG C+V+Y+   PG+Y + + +      ++V GSPF   V+  K  P +       Q   +  Q      IN  ID    KDL V    PS F +
Sbjct:  247 DAIEGPVEAIVVDP-TGKEHRMVIL---DGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFP---LRGKPKNSFKVWGRGIAPE--GIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVG------YNDESQSMDFEYSPKQAPDDLEVLVKVAGEVI--ESHKIHVAPESSSKIRAFGAGLEGGI-VNEPCVFDVEMNGESK-DLSFAVEGPSKAEIG--------------CQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRV--TGIDESKVYNVGEKIPFRVDTR-LCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGLQLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLL--FDEIPVKEAVVEVIKGT--DVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKK-DPSQITISGLDQPNYRLNQ-----PINFVIDTSKTKDLPVKATVPSDFAQ 934          

HSP 7 Score: 118.242 bits (295), Expect = 5.249e-26
Identity = 102/353 (28.90%), Postives = 154/353 (43.63%), Query Frame = 2
Query: 4847 EIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQE-----EQH------------------SQVEIEAS-----------DKRCVSQ--YAEKSSSNVEKIICQGLGLKQARLN--------------------------------SVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            E+  + AS+++P G  EP  V+ +  G+ GV F+PRE G HL+ V+ + K +  +PF+I V   +  D   V  SG G +  I  +  +  V+TS AG G L+V++ GPSK  + C E + G  +  Y  T PG Y I I +  + H+  SP T    G KSA  V Q      EQH                  S ++I A            + R + Q  Y  K +  +E I    +  K A +N                                + N+F +   +AG G + V I GP +   E    + GN    VDY V   G +++ V++ D+ IP SPF V++
Sbjct: 1408 ELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKF-ADHHVKDSPLTVQCTG-KSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCH--VDYKVATPGEYVVAVKFNDQHIPDSPFKVYI 1756          

HSP 8 Score: 101.293 bits (251), Expect = 6.053e-21
Identity = 199/883 (22.54%), Postives = 326/883 (36.92%), Query Frame = 3
Query: 2292 GTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASM----PAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQ---IKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKF------FQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRV--TAFGPGLSSGTTNEVAEFTIITK--DAGPGGLSLIVEGPS--KTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI-------------TGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVK--NEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKD----NENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV--------------------------GSVT-----PGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAM---EGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            GT  V Y P+  G   + +  N + + G+P K  V            GDG     G  L +     PA F V  K +    ++ V +  P    + +H     +G  +  +     G++K+ V + G  +  SP+ V  M  G          K   + V   S + +   +     I+ ++K       G +E+   +++LD           G   V + P+E GE+L+ VK  G+ +P   F       Q    S  EV  +         +NEL           ++T       L+  V  PS    +  +T  +     IK+ Y P+E G + + +      +K SP       K  GRV  T        G      E  +  K  +  P  ++  +  P     +I+  D     +++ + P+  G + + + +KD  + GSPF   +              G+ V + +    N+  I  +   + +  +   +  PSK  +    K  N+G   V +     GE++V V      IP SPFKV +     EV      +  G+G+  G A     FT+ T  A  G L   +  P+  E+D  D     +     ++++P E GN+ I+VT  G  +  SPF + V G  +  C+   +    + +     G  CE  +         L V +  PS  T   D  +   G  ++++     G +  SV +   H  GSPF+  V                          G+V       G +  VTA G GL K F      F I T  AG   + V +   +GP   E      Q  G    +YR+         IK+  + I  SPF I
Sbjct: 1256 GTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYV---------DAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAK-ELSVSIEGPAKSQIKIH--DNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQ---------KRSHLSVGSTSEVALPITQQELKGISASIKS-----PGGIEEPCFVRLLDG----------GRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELL----------VDTSKAGYGGLSVSVQGPS----KAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHR--EAGVGAVAVTIEGPSKATLE--FKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAFT---FTVLTHRAK-GHLEAKVVTPNN-EVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDL--CDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKAT--LDAYELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGP--CEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAI 2072          

HSP 9 Score: 95.5153 bits (236), Expect = 3.591e-19
Identity = 114/465 (24.52%), Postives = 196/465 (42.15%), Query Frame = 3
Query: 1314 IDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQN-GQGTVKALVQSPSGKQ----TNGLIDNLNNGKYVVRYTPTEEGPHKINVTYE--GLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSE----AGKAPLEVKVSKPGSGISDR---------PVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISV 2648
            +D+ + P   I V   G    ++       G     Y++P  GL+++NV +  + +  SP  +   PK+       +    G G++PEG+ K+      V++ +  +N     +   V  PS       + G  D   +  +   Y+P ++ P  + V  +  G  I+     V  +   ++  + A G GL    VNE   F V+++G     L  A+EGP+ AEI C +  DG+ ++ YTP  AG Y + V  + + I DSPF + V +           PI+  K        ID S+      K P  V     G  +  +         P++    E   PG F+   +P+      IDV      + G+PF   V +P    K+K+ G G+   +G + +  P  F ++   AG    V V L +  GE + L +    +G +T +Y     G ++++V
Sbjct:  246 VDAIEGPVEAIVVDPTGKEHRMVILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFPLRGKPKN-------SFKVWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDF--EYSP-KQAPDDLEVLVKVAGEVIESHKIHVAPE---SSSKIRAFGAGLEGGIVNEPCVFDVEMNGESK-DLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTE-----------PIEGLKPSATRVTGIDESKVYNVGEKIPFRVDTRLCGVDLVPKVEILDPELNPISYGARE-ITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGV---DGPVYSKEPTRFTIDATQAGPGA-VEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNV 680          

HSP 10 Score: 82.4185 bits (202), Expect = 3.963e-15
Identity = 76/281 (27.05%), Postives = 121/281 (43.06%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            LEA V  P+   E A +    DG   VK++P+  G+H + +  N   + G+P +  V  Y    G     G GL +A+V + A F V    + +  L+V+I+GP+K  +  H+ +DG     +V   PG Y +++  GG   +  SPF  +V G        Q+  H  V                S+S V       L + Q  L  ++     AS    G       G   PC    V+ +   +  V +  +E+G H+I V+   K +P +PF + VD
Sbjct: 1234 LEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGD--GWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGK-AVKDSPFRVLVMGE------GQKRSHLSV---------------GSTSEV------ALPITQQELKGIS-----ASIKSPG-------GIEEPC---FVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVD 1469          

HSP 11 Score: 78.1814 bits (191), Expect = 6.530e-14
Identity = 117/476 (24.58%), Postives = 202/476 (42.44%), Query Frame = 3
Query: 3399 EFTIITKDAGPGGLSLIVEGPSKTE---IKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTP----SKIKVPCVIKKMNNGA--------------LGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNV----EGDKVVPCETQKMERVQEAVKATQVGGNCEINLKID-EMALKDL--KVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDIN-NEFAIYTREAGAGNISVAMEGPS--KAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVE 4733
            +F ++  DA  G +  IV  P+  E   +  +    G     Y     G +++ +  K  P+ GSPF   + G+P  K+   V      P  I  +D+  +  E   P    +   +   + K ++G+              +   ++PK+  + L  + +   ++  S  K++V  E    ++K++  G GLE G+ N+   F ++  +     L+ ++EGPSKAEI C++  +G   + Y PT  G Y + V   GK++  SPF + V    EG K  P  T ++  + E+ K   VG   +I  ++D  +   DL  KV +  P          +   G      +      H + V      + G+PF   V    P  +  +   GPG++          F I   +AG G + VA+        ++   ++QD GS  V Y   +PG Y+ ++ F GE I  SP  I V+
Sbjct:  242 KFAVV--DAIEGPVEAIVVDPTGKEHRMVILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFP--LRGKP--KNSFKVWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVIES-HKIHVAPES---SSKIRAFGAGLEGGIVNEPCVFDVEM-NGESKDLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLK--PSAT-RVTGIDES-KVYNVGE--KIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKE--PTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQD-GSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVK 695          

HSP 12 Score: 64.3142 bits (155), Expect = 1.031e-9
Identity = 44/144 (30.56%), Postives = 70/144 (48.61%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGN---FHIVGSPFTAVVEGNKSATNVN 5341
            DG Y       E G H + +  ++ P+  +   +  G    D     A G GL  A+V +KA F ++   AG G+L++ + GP+K      +  +G     YVA APG+Y + I +G +    H+ GSPF AVV+  K  + + 
Sbjct:  755 DGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVIKG---TDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQIT 895          

HSP 13 Score: 57.7658 bits (138), Expect = 1.194e-7
Identity = 40/109 (36.70%), Postives = 61/109 (55.96%), Query Frame = 3
Query: 4449 VTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAG--AGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVED--DSIKPVAAR 4763
            V P  S  + A G GLE G +   NE  ++  E    + ++S A+EGPSKAE+  QE  D GS  ++Y  +  G Y+  +  +G+HI +SPF + V +  + +KP A R
Sbjct:  409 VAPESSSKIRAFGAGLEGGIV---NEPCVFDVEMNGESKDLSFAVEGPSKAEIGCQERPD-GSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATR 513          

HSP 14 Score: 54.299 bits (129), Expect = 1.216e-6
Identity = 106/475 (22.32%), Postives = 175/475 (36.84%), Query Frame = 3
Query: 1380 IDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPG----FNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDG-TCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXX---XXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFK---------------TNVVQPAQVEKVKVDGDGIIPQ----------NGAILASM----PAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVK 2693
            I+  D G     + +   + G++T++V+Y + H+  SP    V            V A+G     +GV +     F        + G G V   ++ PS K T    D+ N+G   V Y     G + + V +    I DSPF V   P        +L    G G+ + K    T  V+     GH    +         I     +DG +  + + P + G++ I V  +   + +SPF + V  +          S   +      +   F I+ + AG   L V++  P     D      ++E      + V Y P   G     VKYN     GSPFK               T+ V+   V K       ++P+           GA L       PA F ++T  AG N  ++VG+    G    + +  + +G Y C Y+  D     + +      +P SP+ ++
Sbjct: 1619 IEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGA--HKVRAAG-----QGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPS-KATLEFKDH-NDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAFTFT--VLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDA----YELEKG----YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNL-LMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAIE 2073          
BLAST of Filamin-A vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 528.865 bits (1361), Expect = 1.140e-154
Identity = 373/1192 (31.29%), Postives = 607/1192 (50.92%), Query Frame = 3
Query: 1245 SSKVIVYGKGLEK-VAAKEKAIFTIDSKDAPSAPIGVTV-EGPGEAV-IDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKF----NDEDISDSPFHXXXXXXXXXXXXXSKGPIK-DAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCL---IDVKYNKSPISGSPFKTNVVQPAQVEKVKVDG--DGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEA-RPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVL----DSIKVK-VQEHPDGIASVH----YMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAV-KATQVGGNC------EINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            +SK+ ++G G++  V +KE   FTID+  A    + V + +  GE V +D +DN DG+  V Y    PG Y +NV++    I  SPI + V P    N+D+S +   G  L  E +      + T++  ++    +G    L+   +GK+ N  +    +G Y       E G HK+ + ++ +P++++  +V+   G +     A GPGL    V EK  F +DLDGAG G+L + + GPA AE +  D  +G C VEY     GDY++++KF      E +  SPF   V  +  P ++   G  + + +L +P +F ID S+    P  VK + P      +PV  +    + P   +V +VP    P +   I++ Y+   I     K       Q+ K+  D   D +        AS       + +D G    +   +F P+G+    H+ +   NG+Y   + T   G++ +   ++G  +         +P       A K G+ + + + +E V   E  E     +T     I+ +K      I+VL    D+++++ +QE  D    V     +   + G   ++V YGG+ + + ++       ++ ++    + V  +  +       +   F +      P DL A V+ P+   E   I   DN    I + Y P   G H+L +   G  ++G+P +F+VD  G+G  T +GPGL +    E A FT+  K +    LS+ +EGP+K++IK  DN DGT   ++VP  PG Y + +K   + +  SPF   + GE  K+S ++VG++SE+ L I   +L  ++A + +P  I+ PC ++ ++ G LGVSFTP+E GEHL+ V   G  +P +PFK+ V   +VGDA+KV+VSG G  KG+  Q NE  +DT  AGYG L++S++GPSKAE+ CK+ ++G+  V Y PTEPG Y I + +A  +V  SP  V         C  +   RV + + K  +  G C       + LK+   +  D+   +  P G T+  ++ D G    ++KF  +  GIH +SV++KD H+ GSPFQFTVGS + GG+  V A+G G+ +G     N F IY REAG G ++V +EGPSKA ++F++  D G+C V Y+V+ PG+Y  ++KFN +HI +SPF + +
Sbjct:  738 ASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKP----NVDVSGIRVEG--LENENLLIGSHLRPTINIGKLEPKSKGL--QLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEA--VVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITISGLDQPNYRLNQPINFVIDTSKTKDLP--VKATVPSDFAQLQPVVSRS--PSNPRHHNVRFVPSG-KPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEV------AARVPV-----MAEKIGRKEDV-IKEEIVFHPEIAEHSPTVLTYN-HPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEAIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEII--DNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQ--------CTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHND-GNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYI 1888          

HSP 2 Score: 293.508 bits (750), Expect = 1.778e-79
Identity = 310/1222 (25.37%), Postives = 518/1222 (42.39%), Query Frame = 3
Query: 1248 SKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLY----DNVHIPQSPIVVPV-YPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYV-VRYTPTEEGPH---KINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIE-------------GPADAEIQCH---DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRP------------NHFTIDCSEAGKAP-LEVKVSKPGSGISDRPVTIKQVEGAAPGTFD-VCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGII--PQNGAILASMPAVFHVNTKDAGVNP-DVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAV------------GNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPC--ETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNG-NLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVE 4733
            +K   YG GLE+    EKA+F +D   A    + + + GP +A     D G+G C V Y    PG Y + + +       H+  SP    V Y KD   + +S       GL       +    F +D S+        VKA V S   +    +  + +N ++  VR+ P+ + P+    I + Y+GL I +   +VK  P    QL+      LH  K +  T   +  + +  G +   +              GP   E   H     ++G   V +    AG+Y +    N ++++        V  +  +  + +  IK+  +  P            NH  ID  +    P ++V  +KP +    R   I+++        D + +   +LG   +DV Y    +    ++   +   + E+++ +   ++   ++          F  N +D G  P D+   +  P  +     I    +G    +Y     G H++S+  +GA L  +P        G+        G    + V + +  T+  K +   +++ +++   + ++              K+ ++ DG  S  ++P   GEY V VK GG+++ +  F        Q+ R  ++    ++++  +      G++  I +              P G  E   +   D  +  + + + P E G H + V   G+ +  +PF+  VD    G   +V   G G + G T +  E  + T  AG GGLS+ V+GPSK E+ C++   G  KV Y P  PG Y I IKF D  +  SP T   TG+   +    +               S + LK+ ++    +TA L  P        ++ +      + FTPK  G H ++V  K   + GSPF+  V +   G A KV+ +G+G+ +G     N F I  R+AG G++ ++IEGPSKA ++ KD+ +G C V Y    PG YV+ V +  +++P SPF V +      P   E +K+E  Q   +    G      + +   A   L+  V TP+   +  DI    +G +  ++FV +E+G H + V      +R SPF+  VG         ++ASG GL KG      EF I T  AGAG ++V M+GPSKA +   E + KG   V Y    PG Y  S+K+NG H   SPF I VE
Sbjct:  927 NKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITIS-------GLDQPNYRLNQPINFVIDTSKTKDL---PVKATVPSDFAQLQPVVSRSPSNPRHHNVRFVPSGK-PNVSIPIEIIYDGLKIDEK--LVKVLPEVEPQLIKI----LHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEVA------ARVPVMAEKIGRKEDVIKEEIVFHPEIAEHSPTVLTYNH-PIDAKKKKAHPAIQVLAAKPDAV---RLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEA--IGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAV-VGEPATFTVCAKGSQAKELSVSIEGPAKSQI--------------KIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQK-RSHLSVGSTSEVALPITQQELKGISASIKS--------------PGGIEEPCFVRLLDGGR--LGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYI-----APATGEVRKLELAQFHGQGIPAGKAFTFTV-LTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELE-KG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVE 2079          

HSP 3 Score: 246.899 bits (629), Expect = 3.203e-65
Identity = 228/869 (26.24%), Postives = 391/869 (44.99%), Query Frame = 3
Query: 1647 TVKALVQSPSGKQTNGLIDNLNNGKYV---VRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGF------NAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAE--IQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPT--GNPEKCAIK-AGKDK--TIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKF-FQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI---TGEPVKKSQVAVGNSSEIPLK-------IPSSDLSTLTAELTTPS-KIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKV 4160
             ++ L   P   +   + + ++NG  V   + +T T+ G + ++V Y G  +    +    K  +       A++V      +   +   K QF V   G     L   +  P   +   +  DN DGT LV+YTP   G +++S+  N   +  +P    V              +++A +  P  FT+ C++  +A  E+ VS  G   S       ++     GT    +VP   G   + VK     +  SPF+           V V G+G    + ++ ++      +  ++      +   + +P G   P  +     G     +   + G+H I+V  DG  +PK+P+ +K   T  G+  K  +  +GK K  T+Q N+   + ++T +AG G ++ +V+   + ++                +E   G+  V Y P E G Y + +K+    + +     Q    S   V +T+ + V+ Q    L     H     +NT    P+D+ A+++ P G  +++ +   D  +   ++ + P   G H L V  +   + GSPFQF V +  EG   +V A G G+  G T     F I  ++AG G +++ +EGPSK  ++ +D++DG   V Y    PG Y + +KF DQ I  SPF   I   TGE V+K ++A  +   IP         +       L A++ TP+ ++    ++   +  +  + F PKETG H ++V   G  +  SPF++ V  +++ D T +  SG GL KG   Q  EF I+T +AG G L + ++GPSKA +D  + E G   V+Y P  PG+Y  +V Y G + PGSPF + VEG ++
Sbjct: 1261 AIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEAIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTV-CAKGSQAK-ELSVSIEGPAKSQI-----KIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFR-----------VLVMGEGQKRSHLSVGSTSEVALPITQQEL---KGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANE---LLVDTSKAGYGGLSVSVQGPSKAEL--------------TCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVE-QHGICLPDQESHLFLKLLNTS---PMDITARLMDPKGHTDDIEM--RDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGE-VRKLELAQFHGQGIPAGKAFTFTVLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKEL 2083          

HSP 4 Score: 182.57 bits (462), Expect = 1.245e-45
Identity = 98/279 (35.13%), Postives = 151/279 (54.12%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQ-YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMV 5689
            LEA V TP+  ++   +  I DG+ Y ++F P+E G H + V  +  P+  SPFR+ VG     DP  + ASG+GL      +K +F +NT+NAG+G L V +DGPSK  ++ +E E GY+  Y   APG+Y  ++ Y G  H  GSPF   VEG +   N   E  H +++  A   +       +   +  K+  +G GL +       +F +D   AG  +L+VG+     PCEEVVV+H G+  +   Y + +     + +++GDK+IPGSPF +
Sbjct: 1927 LEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNG-IHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAI 2204          

HSP 5 Score: 170.629 bits (431), Expect = 6.203e-42
Identity = 234/898 (26.06%), Postives = 373/898 (41.54%), Query Frame = 3
Query: 1650 VKALVQSPS-GKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSP--FIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNV--VQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQV-----NKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSV-QNQISNELAS-NAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVD-TKGEGRVTAF----GPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDN---HDG-TFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITG----EPVKKS-------QVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEV-------------------------------GDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISI---EGPSKAEIDCKDNENG--VCTVKYLPTEPGNYVINVTYAGKNVPGSPFNV 4139
            ++A+V  P+  K+   +IDNL+ G  +V+YTP   G H++++   G  +Q +P  F V A   +     T  GPGL +  V E   F V   G+    L ++IEGPA ++I+ HDNKDGTC   + P   G+Y + VK   + + DSPF V V+ E +     S G   +  L          S + K+P          G  + P  ++ ++G   G   V + P E G  LI VK +   +  +PFK  V   Q     KV+V G G     G  L +   +  V+T  AG    + V +  P+     L  +   +GL    Y   + G + I++      +  SP TV+   TG      I+  +    Q      ++ES + ++        IT  +   +    G  + I++ D  +   Q        + + PK EG + + V Y    + NG  FQ    SF E      R+  Q  +  E  + NAF+  + E      V V +      PS    E      D+   N  +DY+ +  G + + V    + I  SPF+ ++    GE R        G G+ +G   +   FT++T  A  G L   V  P+  E+   D     DG ++ + +VP+  GN+ I +     P+  SPF   + G    +P   S       +   G   E  +   ++    LT ++  PSK  +     ++  G   V +TP   G +  +V   G   PGSPFK+ V+ +E+                               GDA KV   G GL K    +   F IDT  AG   L + +   +GP + E+  +   +G  VC+ + +P     +V  + Y  K +PGSPF +
Sbjct: 1366 LEAIVMPPTQKKEVAEIIDNLD-GTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDA---YGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSP----------GGIEEPCFVRLLDG---GRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSG--KAKGITLQANELL--VDTSKAGYG-GLSVSVQGPS--KAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQC--TGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPK----GHTDDIEMRDLGQQYYQ--------LKFTPKMEGIHTLSVMYKDAHV-NGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGV-GAVAVTIEG----PSKATLEF----KDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAG---KAFTFTVLTHRA-KGHLEAKVVTPN-NEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAY--ELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCE-EVVVRHQGSGHYVCSYR-IPDRVKGFVF-IKYGDKEIPGSPFAI 2204          

HSP 6 Score: 125.946 bits (315), Expect = 2.464e-28
Identity = 184/736 (25.00%), Postives = 299/736 (40.62%), Query Frame = 3
Query: 2193 EAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAG---VNPDVIVGLFNP-NGEPMPLHIEARPNGLYTCEYQTHDV--------GDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG-RVTAFGPGLSSGT-TNEVAEFTIITKDAGPGGLSLIVEGPS--KTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTAN---------ITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTP-KETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYA----GKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTE 4310
            +A + P+E  V  P +G   R V +   +G +PG     Y    +G   ++V + K P++GSPF    ++       KV G GI P+   I  +     HV + D      N ++ + +  P +G  +P+ +       Y  E Q+ D          D ++ V V G  +    + +   P  + +  A  AG +  I VN+  V  +E     K  ++  V+   + ++G               QE PDG A + Y P   G Y V V   G+ I +  F    T   + ++ + TR     I      N    + F ++T+    VDL  KV      +  +   + +      +    P     H++ V+  G  + G+PF   V    +  ++  FGPG+     + E   FTI    AGPG + + +        ++   DN DG+F V Y  Q PG Y + + F  + I  SP   N         I  E ++   + +G+     + I   +  +   +L      K   V  K+N      + TP  E GEH + +     +IP     V V      D  K K  G GLE+ +  +   F +D   AG G+L++ + GP+KAE   +D  NG C+V+Y+   PG+Y + + +      ++V GSPF   V+  K  P +       Q   +  Q      IN  ID    KDL V    PS F +
Sbjct:  379 DAIEGPVEAIVVDP-TGKEHRMVIL---DGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFP---LRGKPKNSFKVWGRGIAPE--GIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVG------YNDESQSMDFEYSPKQAPDDLEVLVKVAGEVI--ESHKIHVAPESSSKIRAFGAGLEGGI-VNEPCVFDVEMNGESK-DLSFAVEGPSKAEIG--------------CQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRV--TGIDESKVYNVGEKIPFRVDTR-LCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGLQLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLL--FDEIPVKEAVVEVIKGT--DVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKK-DPSQITISGLDQPNYRLNQ-----PINFVIDTSKTKDLPVKATVPSDFAQ 1066          

HSP 7 Score: 117.857 bits (294), Expect = 5.633e-26
Identity = 102/353 (28.90%), Postives = 154/353 (43.63%), Query Frame = 2
Query: 4847 EIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKA-DPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQE-----EQH------------------SQVEIEAS-----------DKRCVSQ--YAEKSSSNVEKIICQGLGLKQARLN--------------------------------SVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            E+  + AS+++P G  EP  V+ +  G+ GV F+PRE G HL+ V+ + K +  +PF+I V   +  D   V  SG G +  I  +  +  V+TS AG G L+V++ GPSK  + C E + G  +  Y  T PG Y I I +  + H+  SP T    G KSA  V Q      EQH                  S ++I A            + R + Q  Y  K +  +E I    +  K A +N                                + N+F +   +AG G + V I GP +   E    + GN    VDY V   G +++ V++ D+ IP SPF V++
Sbjct: 1540 ELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKF-ADHHVKDSPLTVQCTG-KSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCH--VDYKVATPGEYVVAVKFNDQHIPDSPFKVYI 1888          

HSP 8 Score: 100.908 bits (250), Expect = 9.529e-21
Identity = 199/883 (22.54%), Postives = 326/883 (36.92%), Query Frame = 3
Query: 2292 GTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASM----PAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQ---IKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKF------FQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRV--TAFGPGLSSGTTNEVAEFTIITK--DAGPGGLSLIVEGPS--KTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI-------------TGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVK--NEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKD----NENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV--------------------------GSVT-----PGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAM---EGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            GT  V Y P+  G   + +  N + + G+P K  V            GDG     G  L +     PA F V  K +    ++ V +  P    + +H     +G  +  +     G++K+ V + G  +  SP+ V  M  G          K   + V   S + +   +     I+ ++K       G +E+   +++LD           G   V + P+E GE+L+ VK  G+ +P   F       Q    S  EV  +         +NEL           ++T       L+  V  PS    +  +T  +     IK+ Y P+E G + + +      +K SP       K  GRV  T        G      E  +  K  +  P  ++  +  P     +I+  D     +++ + P+  G + + + +KD  + GSPF   +              G+ V + +    N+  I  +   + +  +   +  PSK  +    K  N+G   V +     GE++V V      IP SPFKV +     EV      +  G+G+  G A     FT+ T  A  G L   +  P+  E+D  D     +     ++++P E GN+ I+VT  G  +  SPF + V G  +  C+   +    + +     G  CE  +         L V +  PS  T   D  +   G  ++++     G +  SV +   H  GSPF+  V                          G+V       G +  VTA G GL K F      F I T  AG   + V +   +GP   E      Q  G    +YR+         IK+  + I  SPF I
Sbjct: 1388 GTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYV---------DAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAK-ELSVSIEGPAKSQIKIH--DNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQ---------KRSHLSVGSTSEVALPITQQELKGISASIKS-----PGGIEEPCFVRLLDG----------GRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELL----------VDTSKAGYGGLSVSVQGPS----KAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHR--EAGVGAVAVTIEGPSKATLE--FKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAFT---FTVLTHRAK-GHLEAKVVTPNN-EVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDL--CDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKAT--LDAYELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGP--CEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAI 2204          

HSP 9 Score: 95.9005 bits (237), Expect = 3.213e-19
Identity = 114/465 (24.52%), Postives = 196/465 (42.15%), Query Frame = 3
Query: 1314 IDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQN-GQGTVKALVQSPSGKQ----TNGLIDNLNNGKYVVRYTPTEEGPHKINVTYE--GLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSE----AGKAPLEVKVSKPGSGISDR---------PVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISV 2648
            +D+ + P   I V   G    ++       G     Y++P  GL+++NV +  + +  SP  +   PK+       +    G G++PEG+ K+      V++ +  +N     +   V  PS       + G  D   +  +   Y+P ++ P  + V  +  G  I+     V  +   ++  + A G GL    VNE   F V+++G     L  A+EGP+ AEI C +  DG+ ++ YTP  AG Y + V  + + I DSPF + V +           PI+  K        ID S+      K P  V     G  +  +         P++    E   PG F+   +P+      IDV      + G+PF   V +P    K+K+ G G+   +G + +  P  F ++   AG    V V L +  GE + L +    +G +T +Y     G ++++V
Sbjct:  378 VDAIEGPVEAIVVDPTGKEHRMVILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFPLRGKPKN-------SFKVWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDF--EYSP-KQAPDDLEVLVKVAGEVIESHKIHVAPE---SSSKIRAFGAGLEGGIVNEPCVFDVEMNGESK-DLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTE-----------PIEGLKPSATRVTGIDESKVYNVGEKIPFRVDTRLCGVDLVPKVEILDPELNPISYGARE-ITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGV---DGPVYSKEPTRFTIDATQAGPGA-VEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNV 812          

HSP 10 Score: 95.1301 bits (235), Expect = 5.646e-19
Identity = 241/1115 (21.61%), Postives = 433/1115 (38.83%), Query Frame = 3
Query: 1713 NGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASG-PGLHSCK---VNEKTQFVVDLDGAGHGSL-GLAIEGPADAEIQCHDNKDGTCLVEYT-----PVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLL--RPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNP-----------NGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKC-AIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYG----GQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVD-TKGEGRVTAFGPG--------LSSGTTNEVAEFTIITKDAGPGGLSLIVE-------------GPSKTEIKCEDNH------DGTFKVSYVPQAPGNYNIIIKFKDQPIAGS-PFTANITG--EPVKKSQVA----VGNSSEIPL----------KIPSSDLSTLTAELTTPSKIKVPCVIKKMNNG---ALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGN--------EFTIDTRDAGY--GSLNISIEGPS-KAEI-DCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSP--FNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDI--NNEFAIYTREAGAGNISVAMEGPSKAEMK-FQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAARAVSSS 4778
            +G  ++ YTPT  G +K+ V  +G  IQDSPF+++          +A+   G+   K   V EK  F VD    G   +  + I  P    I     +    L EYT     P+K   + I V      +  +PF V+V +     K+K  GP  D  +    P  FTID ++AG   +EV +        D  V   Q      G+F V Y  +  G   ++V +    I  SP + NV     V  ++V+G   +     ++ S             + P + +G   P           NG+   + ++  P+G Y+ +    +VG+HK+ +  D  P+ ++   V+ +   +  KC A   G ++ + V +++V  ++   AG+G ++     +E +   + E          ++Q+  +G  SV Y+ K  G+Y + +K+G     + +    F   A   +++    +T S  +Q +  L       +NF I+T      DL  K   PS   +  P+ S             PS    H ++    G+P    P +   D  K + ++    P         L     + +    I T  +  G +   V              GP   E     NH      +G + VS+     G Y ++     Q +A   P  A   G  E V K ++     +   S   L          K     +  L A+   P  +++  + + ++NG   A  + FT  + G + ++V+  G  +       +V+ E +G     ++  +  +  +  + +        +F  + RD GY    L   +  P+ K E+ +  DN +G   VKY P   G++ +++   G  + G+P  F V+  GD      T     +Q AV    VG      +       K+L V++  P+       I D  +G     +V    G + V V    + ++ SPF+             V   G G ++  + +   +E A+   +     IS +++ P   E   F    D G   V++   + G++  ++K +G+ +  +PF I V+   +   +   VS S
Sbjct:  597 DGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVTGIDESKVYNVGEKIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIK---HKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQ-----DGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNVDVSGIRVEG---LENENLLIGSH------------LRPTINIGKLEPKSKGLQLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEA--VVEVIKGTDVNKCKAYGPGLEQAV-VGEKAVFELDLDGAGEGALS-----MEMRGPAKAES---------RIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPF--KAVVDYKKDPSQITISGLDQPNYRLN----QPINFVIDTSK--TKDLPVKATVPSDFAQLQPVVSR-----------SPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKE---RLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEVAARVPVMAEKIGRKEDVIKEEIVFHPEIAEHSPTVLTYNHPIDAKKKKAHPAIQVLAAK---PDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVD------HVEYEAIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDG---WATVYGPGLQNAV----VGEPATFTVCAKGSQAKELSVSIEGPA--KSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFR-------------VLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGS 1616          

HSP 11 Score: 88.5817 bits (218), Expect = 5.135e-17
Identity = 86/297 (28.96%), Postives = 132/297 (44.44%), Query Frame = 3
Query: 1239 QPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFT-VDASEVSQNGQGTVKALVQSPSG----KQTNGLIDNLNNGKYVVR--------YTPTEEGP--HKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHS-CKVNEKTQFVVDLDGAGHGSLGLAIEGPA--DAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDIS 2075
            + SSK+  +G GLE     E  +F ++  +  S  +   VEGP +A I C +  DG+  + Y   V G+Y + VL D  HI  SP V+              VT    GL P         + T +D S+V   G+     +     G     +   L   LN   Y  R        YT   + P  HKI+V+  G+ +  +PF VK K   +A  +   GPG+       E T+F +D   AG G++ +A+      + ++   DN+DG+  V+YT  + G Y ++V F  E+IS
Sbjct:  544 ESSSKIRAFGAGLEGGIVNEPCVFDVEM-NGESKDLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVL-------------RVTEPIEGLKPSA------TRVTGIDESKVYNVGEKIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEIS 820          

HSP 12 Score: 82.0333 bits (201), Expect = 4.363e-15
Identity = 76/281 (27.05%), Postives = 121/281 (43.06%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            LEA V  P+   E A +    DG   VK++P+  G+H + +  N   + G+P +  V  Y    G     G GL +A+V + A F V    + +  L+V+I+GP+K  +  H+ +DG     +V   PG Y +++  GG   +  SPF  +V G        Q+  H  V                S+S V       L + Q  L  ++     AS    G       G   PC    V+ +   +  V +  +E+G H+I V+   K +P +PF + VD
Sbjct: 1366 LEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGD--GWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGK-AVKDSPFRVLVMGE------GQKRSHLSV---------------GSTSEV------ALPITQQELKGIS-----ASIKSPG-------GIEEPC---FVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVD 1601          

HSP 13 Score: 78.1814 bits (191), Expect = 7.948e-14
Identity = 113/479 (23.59%), Postives = 202/479 (42.17%), Query Frame = 3
Query: 3399 EFTIITKDAGPGGLSLIVEGPSKTE---IKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTP----SKIKVPCVIKKMNNGA--------------LGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNV---------EGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVN-VHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDIN-NEFAIYTREAGAGNISVAMEGPS--KAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVE 4733
            +F ++  DA  G +  IV  P+  E   +  +    G     Y     G +++ +  K  P+ GSPF   + G+P  K+   V      P  I  +D+  +  E   P    +   +   + K ++G+              +   ++PK+  + L  + +   ++  S  K++V  E    ++K++  G GLE G+ N+   F ++  +     L+ ++EGPSKAEI C++  +G   + Y PT  G Y + V   GK++  SPF + V            +V   +  K+  V E +        C ++L + ++ + D ++N +   +    P   E T   +  IK        H + V      + G+PF   V    P  +  +   GPG++          F I   +AG G + VA+        ++   ++QD GS  V Y   +PG Y+ ++ F GE I  SP  I V+
Sbjct:  374 KFAVV--DAIEGPVEAIVVDPTGKEHRMVILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFP--LRGKP--KNSFKVWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVIES-HKIHVAPES---SSKIRAFGAGLEGGIVNEPCVFDVEM-NGESKDLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVTGIDESKVYNVGEKIPFRVDTRLCGVDL-VPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIK--------HKIDVSVAGVSVPGAPFSVKVKE--PTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQD-GSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVK 827          

HSP 14 Score: 64.6994 bits (156), Expect = 9.319e-10
Identity = 44/144 (30.56%), Postives = 70/144 (48.61%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGN---FHIVGSPFTAVVEGNKSATNVN 5341
            DG Y       E G H + +  ++ P+  +   +  G    D     A G GL  A+V +KA F ++   AG G+L++ + GP+K      +  +G     YVA APG+Y + I +G +    H+ GSPF AVV+  K  + + 
Sbjct:  887 DGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVIKG---TDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQIT 1027          

HSP 15 Score: 57.7658 bits (138), Expect = 1.043e-7
Identity = 40/109 (36.70%), Postives = 61/109 (55.96%), Query Frame = 3
Query: 4449 VTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAG--AGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVED--DSIKPVAAR 4763
            V P  S  + A G GLE G +   NE  ++  E    + ++S A+EGPSKAE+  QE  D GS  ++Y  +  G Y+  +  +G+HI +SPF + V +  + +KP A R
Sbjct:  541 VAPESSSKIRAFGAGLEGGIV---NEPCVFDVEMNGESKDLSFAVEGPSKAEIGCQERPD-GSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATR 645          

HSP 16 Score: 54.299 bits (129), Expect = 1.145e-6
Identity = 106/475 (22.32%), Postives = 175/475 (36.84%), Query Frame = 3
Query: 1380 IDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGF----NAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDG-TCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXX---XXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFK---------------TNVVQPAQVEKVKVDGDGIIPQ----------NGAILASM----PAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVK 2693
            I+  D G     + +   + G++T++V+Y + H+  SP    V            V A+G     +GV +     F        + G G V   ++ PS K T    D+ N+G   V Y     G + + V +    I DSPF V   P        +L    G G+ + K    T  V+     GH    +         I     +DG +  + + P + G++ I V  +   + +SPF + V  +          S   +      +   F I+ + AG   L V++  P     D      ++E      + V Y P   G     VKYN     GSPFK               T+ V+   V K       ++P+           GA L       PA F ++T  AG N  ++VG+    G    + +  + +G Y C Y+  D     + +      +P SP+ ++
Sbjct: 1751 IEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGA--HKVRAAG-----QGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPS-KATLEFKDH-NDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAFTFT--VLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDA----YELEKG----YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNL-LMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAIE 2205          
BLAST of Filamin-A vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 528.48 bits (1360), Expect = 1.321e-154
Identity = 373/1192 (31.29%), Postives = 607/1192 (50.92%), Query Frame = 3
Query: 1245 SSKVIVYGKGLEK-VAAKEKAIFTIDSKDAPSAPIGVTV-EGPGEAV-IDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKF----NDEDISDSPFHXXXXXXXXXXXXXSKGPIK-DAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCL---IDVKYNKSPISGSPFKTNVVQPAQVEKVKVDG--DGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEA-RPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVL----DSIKVK-VQEHPDGIASVH----YMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAV-KATQVGGNC------EINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            +SK+ ++G G++  V +KE   FTID+  A    + V + +  GE V +D +DN DG+  V Y    PG Y +NV++    I  SPI + V P    N+D+S +   G  L  E +      + T++  ++    +G    L+   +GK+ N  +    +G Y       E G HK+ + ++ +P++++  +V+   G +     A GPGL    V EK  F +DLDGAG G+L + + GPA AE +  D  +G C VEY     GDY++++KF      E +  SPF   V  +  P ++   G  + + +L +P +F ID S+    P  VK + P      +PV  +    + P   +V +VP    P +   I++ Y+   I     K       Q+ K+  D   D +        AS       + +D G    +   +F P+G+    H+ +   NG+Y   + T   G++ +   ++G  +         +P       A K G+ + + + +E V   E  E     +T     I+ +K      I+VL    D+++++ +QE  D    V     +   + G   ++V YGG+ + + ++       ++ ++    + V  +  +       +   F +      P DL A V+ P+   E   I   DN    I + Y P   G H+L +   G  ++G+P +F+VD  G+G  T +GPGL +    E A FT+  K +    LS+ +EGP+K++IK  DN DGT   ++VP  PG Y + +K   + +  SPF   + GE  K+S ++VG++SE+ L I   +L  ++A + +P  I+ PC ++ ++ G LGVSFTP+E GEHL+ V   G  +P +PFK+ V   +VGDA+KV+VSG G  KG+  Q NE  +DT  AGYG L++S++GPSKAE+ CK+ ++G+  V Y PTEPG Y I + +A  +V  SP  V         C  +   RV + + K  +  G C       + LK+   +  D+   +  P G T+  ++ D G    ++KF  +  GIH +SV++KD H+ GSPFQFTVGS + GG+  V A+G G+ +G     N F IY REAG G ++V +EGPSKA ++F++  D G+C V Y+V+ PG+Y  ++KFN +HI +SPF + +
Sbjct:  740 ASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKP----NVDVSGIRVEG--LENENLLIGSHLRPTINIGKLEPKSKGL--QLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEA--VVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITISGLDQPNYRLNQPINFVIDTSKTKDLP--VKATVPSDFAQLQPVVSRS--PSNPRHHNVRFVPSG-KPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEV------AARVPV-----MAEKIGRKEDV-IKEEIVFHPEIAEHSPTVLTYN-HPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEAIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEII--DNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQ--------CTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHND-GNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYI 1890          

HSP 2 Score: 293.123 bits (749), Expect = 1.955e-79
Identity = 310/1222 (25.37%), Postives = 518/1222 (42.39%), Query Frame = 3
Query: 1248 SKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLY----DNVHIPQSPIVVPV-YPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYV-VRYTPTEEGPH---KINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIE-------------GPADAEIQCH---DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRP------------NHFTIDCSEAGKAP-LEVKVSKPGSGISDRPVTIKQVEGAAPGTFD-VCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGII--PQNGAILASMPAVFHVNTKDAGVNP-DVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAV------------GNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPC--ETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNG-NLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVE 4733
            +K   YG GLE+    EKA+F +D   A    + + + GP +A     D G+G C V Y    PG Y + + +       H+  SP    V Y KD   + +S       GL       +    F +D S+        VKA V S   +    +  + +N ++  VR+ P+ + P+    I + Y+GL I +   +VK  P    QL+      LH  K +  T   +  + +  G +   +              GP   E   H     ++G   V +    AG+Y +    N ++++        V  +  +  + +  IK+  +  P            NH  ID  +    P ++V  +KP +    R   I+++        D + +   +LG   +DV Y    +    ++   +   + E+++ +   ++   ++          F  N +D G  P D+   +  P  +     I    +G    +Y     G H++S+  +GA L  +P        G+        G    + V + +  T+  K +   +++ +++   + ++              K+ ++ DG  S  ++P   GEY V VK GG+++ +  F        Q+ R  ++    ++++  +      G++  I +              P G  E   +   D  +  + + + P E G H + V   G+ +  +PF+  VD    G   +V   G G + G T +  E  + T  AG GGLS+ V+GPSK E+ C++   G  KV Y P  PG Y I IKF D  +  SP T   TG+   +    +               S + LK+ ++    +TA L  P        ++ +      + FTPK  G H ++V  K   + GSPF+  V +   G A KV+ +G+G+ +G     N F I  R+AG G++ ++IEGPSKA ++ KD+ +G C V Y    PG YV+ V +  +++P SPF V +      P   E +K+E  Q   +    G      + +   A   L+  V TP+   +  DI    +G +  ++FV +E+G H + V      +R SPF+  VG         ++ASG GL KG      EF I T  AGAG ++V M+GPSKA +   E + KG   V Y    PG Y  S+K+NG H   SPF I VE
Sbjct:  929 NKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITIS-------GLDQPNYRLNQPINFVIDTSKTKDL---PVKATVPSDFAQLQPVVSRSPSNPRHHNVRFVPSGK-PNVSIPIEIIYDGLKIDEK--LVKVLPEVEPQLIKI----LHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEVA------ARVPVMAEKIGRKEDVIKEEIVFHPEIAEHSPTVLTYNH-PIDAKKKKAHPAIQVLAAKPDAV---RLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEA--IGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAV-VGEPATFTVCAKGSQAKELSVSIEGPAKSQI--------------KIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQK-RSHLSVGSTSEVALPITQQELKGISASIKS--------------PGGIEEPCFVRLLDGGR--LGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYI-----APATGEVRKLELAQFHGQGIPAGKAFTFTV-LTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELE-KG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVE 2081          

HSP 3 Score: 246.899 bits (629), Expect = 3.402e-65
Identity = 228/869 (26.24%), Postives = 391/869 (44.99%), Query Frame = 3
Query: 1647 TVKALVQSPSGKQTNGLIDNLNNGKYV---VRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGF------NAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAE--IQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPT--GNPEKCAIK-AGKDK--TIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKF-FQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI---TGEPVKKSQVAVGNSSEIPLK-------IPSSDLSTLTAELTTPS-KIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKV 4160
             ++ L   P   +   + + ++NG  V   + +T T+ G + ++V Y G  +    +    K  +       A++V      +   +   K QF V   G     L   +  P   +   +  DN DGT LV+YTP   G +++S+  N   +  +P    V              +++A +  P  FT+ C++  +A  E+ VS  G   S       ++     GT    +VP   G   + VK     +  SPF+           V V G+G    + ++ ++      +  ++      +   + +P G   P  +     G     +   + G+H I+V  DG  +PK+P+ +K   T  G+  K  +  +GK K  T+Q N+   + ++T +AG G ++ +V+   + ++                +E   G+  V Y P E G Y + +K+    + +     Q    S   V +T+ + V+ Q    L     H     +NT    P+D+ A+++ P G  +++ +   D  +   ++ + P   G H L V  +   + GSPFQF V +  EG   +V A G G+  G T     F I  ++AG G +++ +EGPSK  ++ +D++DG   V Y    PG Y + +KF DQ I  SPF   I   TGE V+K ++A  +   IP         +       L A++ TP+ ++    ++   +  +  + F PKETG H ++V   G  +  SPF++ V  +++ D T +  SG GL KG   Q  EF I+T +AG G L + ++GPSKA +D  + E G   V+Y P  PG+Y  +V Y G + PGSPF + VEG ++
Sbjct: 1263 AIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEAIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTV-CAKGSQAK-ELSVSIEGPAKSQI-----KIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFR-----------VLVMGEGQKRSHLSVGSTSEVALPITQQEL---KGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANE---LLVDTSKAGYGGLSVSVQGPSKAEL--------------TCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVE-QHGICLPDQESHLFLKLLNTS---PMDITARLMDPKGHTDDIEM--RDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGE-VRKLELAQFHGQGIPAGKAFTFTVLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKEL 2085          

HSP 4 Score: 182.57 bits (462), Expect = 1.235e-45
Identity = 98/279 (35.13%), Postives = 151/279 (54.12%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQ-YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMV 5689
            LEA V TP+  ++   +  I DG+ Y ++F P+E G H + V  +  P+  SPFR+ VG     DP  + ASG+GL      +K +F +NT+NAG+G L V +DGPSK  ++ +E E GY+  Y   APG+Y  ++ Y G  H  GSPF   VEG +   N   E  H +++  A   +       +   +  K+  +G GL +       +F +D   AG  +L+VG+     PCEEVVV+H G+  +   Y + +     + +++GDK+IPGSPF +
Sbjct: 1929 LEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNG-IHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAI 2206          

HSP 5 Score: 170.244 bits (430), Expect = 6.528e-42
Identity = 234/898 (26.06%), Postives = 373/898 (41.54%), Query Frame = 3
Query: 1650 VKALVQSPS-GKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSP--FIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNV--VQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQV-----NKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSV-QNQISNELAS-NAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVD-TKGEGRVTAF----GPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDN---HDG-TFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITG----EPVKKS-------QVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEV-------------------------------GDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISI---EGPSKAEIDCKDNENG--VCTVKYLPTEPGNYVINVTYAGKNVPGSPFNV 4139
            ++A+V  P+  K+   +IDNL+ G  +V+YTP   G H++++   G  +Q +P  F V A   +     T  GPGL +  V E   F V   G+    L ++IEGPA ++I+ HDNKDGTC   + P   G+Y + VK   + + DSPF V V+ E +     S G   +  L          S + K+P          G  + P  ++ ++G   G   V + P E G  LI VK +   +  +PFK  V   Q     KV+V G G     G  L +   +  V+T  AG    + V +  P+     L  +   +GL    Y   + G + I++      +  SP TV+   TG      I+  +    Q      ++ES + ++        IT  +   +    G  + I++ D  +   Q        + + PK EG + + V Y    + NG  FQ    SF E      R+  Q  +  E  + NAF+  + E      V V +      PS    E      D+   N  +DY+ +  G + + V    + I  SPF+ ++    GE R        G G+ +G   +   FT++T  A  G L   V  P+  E+   D     DG ++ + +VP+  GN+ I +     P+  SPF   + G    +P   S       +   G   E  +   ++    LT ++  PSK  +     ++  G   V +TP   G +  +V   G   PGSPFK+ V+ +E+                               GDA KV   G GL K    +   F IDT  AG   L + +   +GP + E+  +   +G  VC+ + +P     +V  + Y  K +PGSPF +
Sbjct: 1368 LEAIVMPPTQKKEVAEIIDNLD-GTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDA---YGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSP----------GGIEEPCFVRLLDG---GRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSG--KAKGITLQANELL--VDTSKAGYG-GLSVSVQGPS--KAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQC--TGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPK----GHTDDIEMRDLGQQYYQ--------LKFTPKMEGIHTLSVMYKDAHV-NGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGV-GAVAVTIEG----PSKATLEF----KDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAG---KAFTFTVLTHRA-KGHLEAKVVTPN-NEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAY--ELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCE-EVVVRHQGSGHYVCSYR-IPDRVKGFVF-IKYGDKEIPGSPFAI 2206          

HSP 6 Score: 125.561 bits (314), Expect = 2.704e-28
Identity = 184/736 (25.00%), Postives = 299/736 (40.62%), Query Frame = 3
Query: 2193 EAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAG---VNPDVIVGLFNP-NGEPMPLHIEARPNGLYTCEYQTHDV--------GDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG-RVTAFGPGLSSGT-TNEVAEFTIITKDAGPGGLSLIVEGPS--KTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTAN---------ITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTP-KETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYA----GKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTE 4310
            +A + P+E  V  P +G   R V +   +G +PG     Y    +G   ++V + K P++GSPF    ++       KV G GI P+   I  +     HV + D      N ++ + +  P +G  +P+ +       Y  E Q+ D          D ++ V V G  +    + +   P  + +  A  AG +  I VN+  V  +E     K  ++  V+   + ++G               QE PDG A + Y P   G Y V V   G+ I +  F    T   + ++ + TR     I      N    + F ++T+    VDL  KV      +  +   + +      +    P     H++ V+  G  + G+PF   V    +  ++  FGPG+     + E   FTI    AGPG + + +        ++   DN DG+F V Y  Q PG Y + + F  + I  SP   N         I  E ++   + +G+     + I   +  +   +L      K   V  K+N      + TP  E GEH + +     +IP     V V      D  K K  G GLE+ +  +   F +D   AG G+L++ + GP+KAE   +D  NG C+V+Y+   PG+Y + + +      ++V GSPF   V+  K  P +       Q   +  Q      IN  ID    KDL V    PS F +
Sbjct:  381 DAIEGPVEAIVVDP-TGKEHRMVIL---DGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFP---LRGKPKNSFKVWGRGIAPE--GIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVG------YNDESQSMDFEYSPKQAPDDLEVLVKVAGEVI--ESHKIHVAPESSSKIRAFGAGLEGGI-VNEPCVFDVEMNGESK-DLSFAVEGPSKAEIG--------------CQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRV--TGIDESKVYNVGEKIPFRVDTR-LCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGLQLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLL--FDEIPVKEAVVEVIKGT--DVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKK-DPSQITISGLDQPNYRLNQ-----PINFVIDTSKTKDLPVKATVPSDFAQ 1068          

HSP 7 Score: 117.857 bits (294), Expect = 5.730e-26
Identity = 102/353 (28.90%), Postives = 154/353 (43.63%), Query Frame = 2
Query: 4847 EIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKA-DPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQE-----EQH------------------SQVEIEAS-----------DKRCVSQ--YAEKSSSNVEKIICQGLGLKQARLN--------------------------------SVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            E+  + AS+++P G  EP  V+ +  G+ GV F+PRE G HL+ V+ + K +  +PF+I V   +  D   V  SG G +  I  +  +  V+TS AG G L+V++ GPSK  + C E + G  +  Y  T PG Y I I +  + H+  SP T    G KSA  V Q      EQH                  S ++I A            + R + Q  Y  K +  +E I    +  K A +N                                + N+F +   +AG G + V I GP +   E    + GN    VDY V   G +++ V++ D+ IP SPF V++
Sbjct: 1542 ELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKF-ADHHVKDSPLTVQCTG-KSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCH--VDYKVATPGEYVVAVKFNDQHIPDSPFKVYI 1890          

HSP 8 Score: 100.908 bits (250), Expect = 1.011e-20
Identity = 199/883 (22.54%), Postives = 326/883 (36.92%), Query Frame = 3
Query: 2292 GTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASM----PAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQ---IKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKF------FQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRV--TAFGPGLSSGTTNEVAEFTIITK--DAGPGGLSLIVEGPS--KTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI-------------TGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVK--NEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKD----NENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV--------------------------GSVT-----PGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAM---EGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            GT  V Y P+  G   + +  N + + G+P K  V            GDG     G  L +     PA F V  K +    ++ V +  P    + +H     +G  +  +     G++K+ V + G  +  SP+ V  M  G          K   + V   S + +   +     I+ ++K       G +E+   +++LD           G   V + P+E GE+L+ VK  G+ +P   F       Q    S  EV  +         +NEL           ++T       L+  V  PS    +  +T  +     IK+ Y P+E G + + +      +K SP       K  GRV  T        G      E  +  K  +  P  ++  +  P     +I+  D     +++ + P+  G + + + +KD  + GSPF   +              G+ V + +    N+  I  +   + +  +   +  PSK  +    K  N+G   V +     GE++V V      IP SPFKV +     EV      +  G+G+  G A     FT+ T  A  G L   +  P+  E+D  D     +     ++++P E GN+ I+VT  G  +  SPF + V G  +  C+   +    + +     G  CE  +         L V +  PS  T   D  +   G  ++++     G +  SV +   H  GSPF+  V                          G+V       G +  VTA G GL K F      F I T  AG   + V +   +GP   E      Q  G    +YR+         IK+  + I  SPF I
Sbjct: 1390 GTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYV---------DAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAK-ELSVSIEGPAKSQIKIH--DNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQ---------KRSHLSVGSTSEVALPITQQELKGISASIKS-----PGGIEEPCFVRLLDG----------GRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELL----------VDTSKAGYGGLSVSVQGPS----KAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHR--EAGVGAVAVTIEGPSKATLE--FKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAFT---FTVLTHRAK-GHLEAKVVTPNN-EVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDL--CDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKAT--LDAYELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGP--CEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAI 2206          

HSP 9 Score: 95.9005 bits (237), Expect = 3.351e-19
Identity = 114/465 (24.52%), Postives = 196/465 (42.15%), Query Frame = 3
Query: 1314 IDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQN-GQGTVKALVQSPSGKQ----TNGLIDNLNNGKYVVRYTPTEEGPHKINVTYE--GLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSE----AGKAPLEVKVSKPGSGISDR---------PVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISV 2648
            +D+ + P   I V   G    ++       G     Y++P  GL+++NV +  + +  SP  +   PK+       +    G G++PEG+ K+      V++ +  +N     +   V  PS       + G  D   +  +   Y+P ++ P  + V  +  G  I+     V  +   ++  + A G GL    VNE   F V+++G     L  A+EGP+ AEI C +  DG+ ++ YTP  AG Y + V  + + I DSPF + V +           PI+  K        ID S+      K P  V     G  +  +         P++    E   PG F+   +P+      IDV      + G+PF   V +P    K+K+ G G+   +G + +  P  F ++   AG    V V L +  GE + L +    +G +T +Y     G ++++V
Sbjct:  380 VDAIEGPVEAIVVDPTGKEHRMVILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFPLRGKPKN-------SFKVWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDF--EYSP-KQAPDDLEVLVKVAGEVIESHKIHVAPE---SSSKIRAFGAGLEGGIVNEPCVFDVEMNGESK-DLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTE-----------PIEGLKPSATRVTGIDESKVYNVGEKIPFRVDTRLCGVDLVPKVEILDPELNPISYGARE-ITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGV---DGPVYSKEPTRFTIDATQAGPGA-VEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNV 814          

HSP 10 Score: 94.7449 bits (234), Expect = 5.890e-19
Identity = 241/1115 (21.61%), Postives = 433/1115 (38.83%), Query Frame = 3
Query: 1713 NGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASG-PGLHSCK---VNEKTQFVVDLDGAGHGSL-GLAIEGPADAEIQCHDNKDGTCLVEYT-----PVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLL--RPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNP-----------NGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKC-AIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYG----GQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVD-TKGEGRVTAFGPG--------LSSGTTNEVAEFTIITKDAGPGGLSLIVE-------------GPSKTEIKCEDNH------DGTFKVSYVPQAPGNYNIIIKFKDQPIAGS-PFTANITG--EPVKKSQVA----VGNSSEIPL----------KIPSSDLSTLTAELTTPSKIKVPCVIKKMNNG---ALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGN--------EFTIDTRDAGY--GSLNISIEGPS-KAEI-DCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSP--FNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDI--NNEFAIYTREAGAGNISVAMEGPSKAEMK-FQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAARAVSSS 4778
            +G  ++ YTPT  G +K+ V  +G  IQDSPF+++          +A+   G+   K   V EK  F VD    G   +  + I  P    I     +    L EYT     P+K   + I V      +  +PF V+V +     K+K  GP  D  +    P  FTID ++AG   +EV +        D  V   Q      G+F V Y  +  G   ++V +    I  SP + NV     V  ++V+G   +     ++ S             + P + +G   P           NG+   + ++  P+G Y+ +    +VG+HK+ +  D  P+ ++   V+ +   +  KC A   G ++ + V +++V  ++   AG+G ++     +E +   + E          ++Q+  +G  SV Y+ K  G+Y + +K+G     + +    F   A   +++    +T S  +Q +  L       +NF I+T      DL  K   PS   +  P+ S             PS    H ++    G+P    P +   D  K + ++    P         L     + +    I T  +  G +   V              GP   E     NH      +G + VS+     G Y ++     Q +A   P  A   G  E V K ++     +   S   L          K     +  L A+   P  +++  + + ++NG   A  + FT  + G + ++V+  G  +       +V+ E +G     ++  +  +  +  + +        +F  + RD GY    L   +  P+ K E+ +  DN +G   VKY P   G++ +++   G  + G+P  F V+  GD      T     +Q AV    VG      +       K+L V++  P+       I D  +G     +V    G + V V    + ++ SPF+             V   G G ++  + +   +E A+   +     IS +++ P   E   F    D G   V++   + G++  ++K +G+ +  +PF I V+   +   +   VS S
Sbjct:  599 DGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVTGIDESKVYNVGEKIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIK---HKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQ-----DGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNVDVSGIRVEG---LENENLLIGSH------------LRPTINIGKLEPKSKGLQLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEA--VVEVIKGTDVNKCKAYGPGLEQAV-VGEKAVFELDLDGAGEGALS-----MEMRGPAKAES---------RIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPF--KAVVDYKKDPSQITISGLDQPNYRLN----QPINFVIDTSK--TKDLPVKATVPSDFAQLQPVVSR-----------SPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKE---RLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEVAARVPVMAEKIGRKEDVIKEEIVFHPEIAEHSPTVLTYNHPIDAKKKKAHPAIQVLAAK---PDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVD------HVEYEAIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDG---WATVYGPGLQNAV----VGEPATFTVCAKGSQAKELSVSIEGPA--KSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFR-------------VLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGS 1618          

HSP 11 Score: 88.5817 bits (218), Expect = 5.267e-17
Identity = 86/297 (28.96%), Postives = 132/297 (44.44%), Query Frame = 3
Query: 1239 QPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFT-VDASEVSQNGQGTVKALVQSPSG----KQTNGLIDNLNNGKYVVR--------YTPTEEGP--HKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHS-CKVNEKTQFVVDLDGAGHGSLGLAIEGPA--DAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDIS 2075
            + SSK+  +G GLE     E  +F ++  +  S  +   VEGP +A I C +  DG+  + Y   V G+Y + VL D  HI  SP V+              VT    GL P         + T +D S+V   G+     +     G     +   L   LN   Y  R        YT   + P  HKI+V+  G+ +  +PF VK K   +A  +   GPG+       E T+F +D   AG G++ +A+      + ++   DN+DG+  V+YT  + G Y ++V F  E+IS
Sbjct:  546 ESSSKIRAFGAGLEGGIVNEPCVFDVEM-NGESKDLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVL-------------RVTEPIEGLKPSA------TRVTGIDESKVYNVGEKIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEIS 822          

HSP 12 Score: 82.0333 bits (201), Expect = 4.364e-15
Identity = 76/281 (27.05%), Postives = 121/281 (43.06%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            LEA V  P+   E A +    DG   VK++P+  G+H + +  N   + G+P +  V  Y    G     G GL +A+V + A F V    + +  L+V+I+GP+K  +  H+ +DG     +V   PG Y +++  GG   +  SPF  +V G        Q+  H  V                S+S V       L + Q  L  ++     AS    G       G   PC    V+ +   +  V +  +E+G H+I V+   K +P +PF + VD
Sbjct: 1368 LEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGD--GWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGK-AVKDSPFRVLVMGE------GQKRSHLSV---------------GSTSEV------ALPITQQELKGIS-----ASIKSPG-------GIEEPC---FVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVD 1603          

HSP 13 Score: 77.7962 bits (190), Expect = 8.084e-14
Identity = 113/479 (23.59%), Postives = 202/479 (42.17%), Query Frame = 3
Query: 3399 EFTIITKDAGPGGLSLIVEGPSKTE---IKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTP----SKIKVPCVIKKMNNGA--------------LGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNV---------EGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVN-VHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDIN-NEFAIYTREAGAGNISVAMEGPS--KAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVE 4733
            +F ++  DA  G +  IV  P+  E   +  +    G     Y     G +++ +  K  P+ GSPF   + G+P  K+   V      P  I  +D+  +  E   P    +   +   + K ++G+              +   ++PK+  + L  + +   ++  S  K++V  E    ++K++  G GLE G+ N+   F ++  +     L+ ++EGPSKAEI C++  +G   + Y PT  G Y + V   GK++  SPF + V            +V   +  K+  V E +        C ++L + ++ + D ++N +   +    P   E T   +  IK        H + V      + G+PF   V    P  +  +   GPG++          F I   +AG G + VA+        ++   ++QD GS  V Y   +PG Y+ ++ F GE I  SP  I V+
Sbjct:  376 KFAVV--DAIEGPVEAIVVDPTGKEHRMVILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFP--LRGKP--KNSFKVWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVIES-HKIHVAPES---SSKIRAFGAGLEGGIVNEPCVFDVEM-NGESKDLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVTGIDESKVYNVGEKIPFRVDTRLCGVDL-VPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIK--------HKIDVSVAGVSVPGAPFSVKVKE--PTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQD-GSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVK 829          

HSP 14 Score: 64.6994 bits (156), Expect = 9.478e-10
Identity = 44/144 (30.56%), Postives = 70/144 (48.61%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGN---FHIVGSPFTAVVEGNKSATNVN 5341
            DG Y       E G H + +  ++ P+  +   +  G    D     A G GL  A+V +KA F ++   AG G+L++ + GP+K      +  +G     YVA APG+Y + I +G +    H+ GSPF AVV+  K  + + 
Sbjct:  889 DGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVIKG---TDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQIT 1029          

HSP 15 Score: 57.7658 bits (138), Expect = 1.052e-7
Identity = 40/109 (36.70%), Postives = 61/109 (55.96%), Query Frame = 3
Query: 4449 VTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAG--AGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVED--DSIKPVAAR 4763
            V P  S  + A G GLE G +   NE  ++  E    + ++S A+EGPSKAE+  QE  D GS  ++Y  +  G Y+  +  +G+HI +SPF + V +  + +KP A R
Sbjct:  543 VAPESSSKIRAFGAGLEGGIV---NEPCVFDVEMNGESKDLSFAVEGPSKAEIGCQERPD-GSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATR 647          

HSP 16 Score: 54.299 bits (129), Expect = 1.194e-6
Identity = 106/475 (22.32%), Postives = 175/475 (36.84%), Query Frame = 3
Query: 1380 IDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGF----NAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDG-TCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXX---XXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFK---------------TNVVQPAQVEKVKVDGDGIIPQ----------NGAILASM----PAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVK 2693
            I+  D G     + +   + G++T++V+Y + H+  SP    V            V A+G     +GV +     F        + G G V   ++ PS K T    D+ N+G   V Y     G + + V +    I DSPF V   P        +L    G G+ + K    T  V+     GH    +         I     +DG +  + + P + G++ I V  +   + +SPF + V  +          S   +      +   F I+ + AG   L V++  P     D      ++E      + V Y P   G     VKYN     GSPFK               T+ V+   V K       ++P+           GA L       PA F ++T  AG N  ++VG+    G    + +  + +G Y C Y+  D     + +      +P SP+ ++
Sbjct: 1753 IEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGA--HKVRAAG-----QGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPS-KATLEFKDH-NDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAFTFT--VLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDA----YELEKG----YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNL-LMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAIE 2207          
BLAST of Filamin-A vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 525.783 bits (1353), Expect = 3.498e-154
Identity = 420/1401 (29.98%), Postives = 682/1401 (48.68%), Query Frame = 3
Query:  744 IHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKG-LLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQE-----SPLITEEPILSE------------QIKTLKAG----------NPH-NPM----QKANPGKSNKPYTALEEA-IKEMKESAVESSKWPQS----KPDQPS--SKVIVYGKGLEK-VAAKEKAIFTIDSKDAPSAPIGVTV-EGPGEAV-IDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKF----NDEDISDSPFHXXXXXXXXXXXXXSKGPIK-DAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCL---IDVKYNKSPISGSPFKTNVVQPAQVEKVKVDG--DGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEA-RPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVL----DSIKVK-VQEHPDGIASVH----YMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKD--GVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAV-KATQVGGNC------EINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            IH A    S         + G VN+PC F +     N +  D    V  P   +   +  ++ P G  +  + P  AG Y +    D   I+ SP  + V E      P  T    + E            ++ T   G          +P  NP+    ++  PG     YT + +A IK   + +V     P +    K  +P+  SK+ ++G G++  V +KE   FTID+  A    + V + +  GE V +D +DN DG+  V Y    PG Y +NV++    I  SPI + V P    N+D+S +   G  L  E +      + T++  ++    +G    L+   +GK+ N  +    +G Y       E G HK+ + ++ +P++++  +V+   G +     A GPGL    V EK  F +DLDGAG G+L + + GPA AE +  D  +G C VEY     GDY++++KF      E +  SPF   V  +  P ++   G  + + +L +P +F ID S+    P  VK + P      +PV  +    + P   +V +VP    P +   I++ Y+   I     K       Q+ K+  D   D +        AS       + +D G    +   +F P+G+    H+ +   NG+Y   + T   G++ +   ++G  +         +P       A K G+ + + + +E V   E  E     +T     I+ +K      I+VL    D+++++ +QE  D    V     +   + G   ++V YGG+ + + ++       ++ ++    + V   +  E   + +    ++ N +D    P DL A V+ P+   E   I   DN    I + Y P   G H+L +   G  ++G+P +F+VD  G+G  T +GPGL +    E A FT+  K +    LS+ +EGP+K++IK  DN DGT   ++VP  PG Y + +K   + +  SPF   + GE  K+S ++VG++SE+ L I   +L  ++A + +P  I+ PC ++ ++ G LGVSFTP+E GEHL+ V   G  +P +PFK+ V   +VGDA+KV+VSG G  KG+  Q NE  +DT  AGYG L++S++GPSKAE+ CK+ ++G+  V Y PTEPG Y I + +A  +V  SP  V         C  +   RV + + K  +  G C       + LK+   +  D+   +  P G T+  ++ D G    ++KF  +  GIH +SV++KD H+ GSPFQFTVGS + GG+  V A+G G+ +G     N F IY REAG G ++V +EGPSKA ++F++  D G+C V Y+V+ PG+Y  ++KFN +HI +SPF + +
Sbjct:  407 IHVAPESSSKIRAFGAGLEGGIVNEPCVFDV---EMNGESKDLSFAVEGPSKAE---IGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVTGIDESKVYNVGEKIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFE--YTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKP----NVDVSGIRVEG--LENENLLIGSHLRPTINIGKLEPKSKGL--QLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEA--VVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITISGLDQPNYRLNQPINFVIDTSKTKDLP--VKATVPSDFAQLQPVVSRS--PSNPRHHNVRFVPSG-KPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEV------AARVPV-----MAEKIGRKEDV-IKEEIVFHPEIAEHSPTVLTYN-HPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEAIGKLEYERIQAERAKVV---VEKEDDVDKYEK-QYKFNVRDLGYQPKDLEAIVMPPTQKKEVAEII--DNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQ--------CTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHND-GNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYI 1754          

HSP 2 Score: 295.819 bits (756), Expect = 2.627e-80
Identity = 308/1218 (25.29%), Postives = 517/1218 (42.45%), Query Frame = 3
Query: 1248 SKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLY----DNVHIPQSPIVVPV-YPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYV-VRYTPTEEGPH---KINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIE-------------GPADAEIQCH---DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRP------------NHFTIDCSEAGKAP-LEVKVSKPGSGISDRPVTIKQVEGAAPGTFD-VCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNP-DVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAV------------GNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNG-NLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVE 4733
            +K   YG GLE+    EKA+F +D   A    + + + GP +A     D G+G C V Y    PG Y + + +       H+  SP    V Y KD   + +S       GL       +    F +D S+        VKA V S   +    +  + +N ++  VR+ P+ + P+    I + Y+GL I +   +VK  P    QL+      LH  K +  T   +  + +  G +   +              GP   E   H     ++G   V +    AG+Y +    N ++++        V  +  +  + +  IK+  +  P            NH  ID  +    P ++V  +KP +    R   I+++        D + +   +LG   +DV Y    +    ++   +   + E+++ +   ++ +    +      +  N +D G  P D+   +  P  +     I    +G    +Y     G H++S+  +GA L  +P        G+        G    + V + +  T+  K +   +++ +++   + ++              K+ ++ DG  S  ++P   GEY V VK GG+++ +  F        Q+ R  ++    ++++  +      G++  I +              P G  E   +   D  +  + + + P E G H + V   G+ +  +PF+  VD    G   +V   G G + G T +  E  + T  AG GGLS+ V+GPSK E+ C++   G  KV Y P  PG Y I IKF D  +  SP T   TG+   +    +               S + LK+ ++    +TA L  P        ++ +      + FTPK  G H ++V  K   + GSPF+  V +   G A KV+ +G+G+ +G     N F I  R+AG G++ ++IEGPSKA ++ KD+ +G C V Y    PG YV+ V +  +++P SPF V +        E +K+E  Q   +    G      + +   A   L+  V TP+   +  DI    +G +  ++FV +E+G H + V      +R SPF+  VG         ++ASG GL KG      EF I T  AGAG ++V M+GPSKA +   E + KG   V Y    PG Y  S+K+NG H   SPF I VE
Sbjct:  795 NKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITIS-------GLDQPNYRLNQPINFVIDTSKTKDL---PVKATVPSDFAQLQPVVSRSPSNPRHHNVRFVPSGK-PNVSIPIEIIYDGLKIDEK--LVKVLPEVEPQLIKI----LHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEVA------ARVPVMAEKIGRKEDVIKEEIVFHPEIAEHSPTVLTYNH-PIDAKKKKAHPAIQVLAAKPDAV---RLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEA--IGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAV-VGEPATFTVCAKGSQAKELSVSIEGPAKSQI--------------KIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQK-RSHLSVGSTSEVALPITQQELKGISASIKS--------------PGGIEEPCFVRLLDGGR--LGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAP---ATGEVRKLELAQFHGQGIPAGKAFTFTV-LTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELE-KG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVE 1945          

HSP 3 Score: 245.358 bits (625), Expect = 9.617e-65
Identity = 207/746 (27.75%), Postives = 347/746 (46.51%), Query Frame = 3
Query: 1983 DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPT--GNPEKCAIK-AGKDK--TIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKF-FQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI---TGEPVKKSQVAVGNSSEIPLK-------IPSSDLSTLTAELTTPS-KIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKV 4160
            DN DGT LV+YTP   G +++S+  N   +  +P    V              +++A +  P  FT+ C++  +A  E+ VS  G   S       ++     GT    +VP   G   + VK     +  SPF+           V V G+G    + ++ ++      +  ++      +   + +P G   P  +     G     +   + G+H I+V  DG  +PK+P+ +K   T  G+  K  +  +GK K  T+Q N+   + ++T +AG G ++ +V+   + ++                +E   G+  V Y P E G Y + +K+    + +     Q    S   V +T+ + V+ Q    L     H     +NT    P+D+ A+++ P G  +++ +   D  +   ++ + P   G H L V  +   + GSPFQF V +  EG   +V A G G+  G T     F I  ++AG G +++ +EGPSK  ++ +D++DG   V Y    PG Y + +KF DQ I  SPF   I   TGE V+K ++A  +   IP         +       L A++ TP+ ++    ++   +  +  + F PKETG H ++V   G  +  SPF++ V  +++ D T +  SG GL KG   Q  EF I+T +AG G L + ++GPSKA +D  + E G   V+Y P  PG+Y  +V Y G + PGSPF + VEG ++
Sbjct: 1250 DNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTV-CAKGSQAK-ELSVSIEGPAKSQI-----KIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFR-----------VLVMGEGQKRSHLSVGSTSEVALPITQQEL---KGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANE---LLVDTSKAGYGGLSVSVQGPSKAEL--------------TCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVE-QHGICLPDQESHLFLKLLNTS---PMDITARLMDPKGHTDDIEM--RDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGE-VRKLELAQFHGQGIPAGKAFTFTVLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKGY-KVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKEL 1949          

HSP 4 Score: 182.956 bits (463), Expect = 9.930e-46
Identity = 98/279 (35.13%), Postives = 151/279 (54.12%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQ-YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMV 5689
            LEA V TP+  ++   +  I DG+ Y ++F P+E G H + V  +  P+  SPFR+ VG     DP  + ASG+GL      +K +F +NT+NAG+G L V +DGPSK  ++ +E E GY+  Y   APG+Y  ++ Y G  H  GSPF   VEG +   N   E  H +++  A   +       +   +  K+  +G GL +       +F +D   AG  +L+VG+     PCEEVVV+H G+  +   Y + +     + +++GDK+IPGSPF +
Sbjct: 1793 LEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNG-IHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAI 2070          

HSP 5 Score: 170.629 bits (431), Expect = 5.985e-42
Identity = 234/898 (26.06%), Postives = 373/898 (41.54%), Query Frame = 3
Query: 1650 VKALVQSPS-GKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSP--FIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNV--VQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQV-----NKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSV-QNQISNELAS-NAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVD-TKGEGRVTAF----GPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDN---HDG-TFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITG----EPVKKS-------QVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEV-------------------------------GDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISI---EGPSKAEIDCKDNENG--VCTVKYLPTEPGNYVINVTYAGKNVPGSPFNV 4139
            ++A+V  P+  K+   +IDNL+ G  +V+YTP   G H++++   G  +Q +P  F V A   +     T  GPGL +  V E   F V   G+    L ++IEGPA ++I+ HDNKDGTC   + P   G+Y + VK   + + DSPF V V+ E +     S G   +  L          S + K+P          G  + P  ++ ++G   G   V + P E G  LI VK +   +  +PFK  V   Q     KV+V G G     G  L +   +  V+T  AG    + V +  P+     L  +   +GL    Y   + G + I++      +  SP TV+   TG      I+  +    Q      ++ES + ++        IT  +   +    G  + I++ D  +   Q        + + PK EG + + V Y    + NG  FQ    SF E      R+  Q  +  E  + NAF+  + E      V V +      PS    E      D+   N  +DY+ +  G + + V    + I  SPF+ ++    GE R        G G+ +G   +   FT++T  A  G L   V  P+  E+   D     DG ++ + +VP+  GN+ I +     P+  SPF   + G    +P   S       +   G   E  +   ++    LT ++  PSK  +     ++  G   V +TP   G +  +V   G   PGSPFK+ V+ +E+                               GDA KV   G GL K    +   F IDT  AG   L + +   +GP + E+  +   +G  VC+ + +P     +V  + Y  K +PGSPF +
Sbjct: 1232 LEAIVMPPTQKKEVAEIIDNLD-GTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDA---YGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSP----------GGIEEPCFVRLLDG---GRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSG--KAKGITLQANELL--VDTSKAGYG-GLSVSVQGPS--KAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQC--TGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPK----GHTDDIEMRDLGQQYYQ--------LKFTPKMEGIHTLSVMYKDAHV-NGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGV-GAVAVTIEG----PSKATLEF----KDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAG---KAFTFTVLTHRA-KGHLEAKVVTPN-NEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAY--ELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCE-EVVVRHQGSGHYVCSYR-IPDRVKGFVF-IKYGDKEIPGSPFAI 2070          

HSP 6 Score: 126.331 bits (316), Expect = 1.825e-28
Identity = 184/736 (25.00%), Postives = 299/736 (40.62%), Query Frame = 3
Query: 2193 EAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAG---VNPDVIVGLFNP-NGEPMPLHIEARPNGLYTCEYQTHDV--------GDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG-RVTAFGPGLSSGT-TNEVAEFTIITKDAGPGGLSLIVEGPS--KTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTAN---------ITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTP-KETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYA----GKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTE 4310
            +A + P+E  V  P +G   R V +   +G +PG     Y    +G   ++V + K P++GSPF    ++       KV G GI P+   I  +     HV + D      N ++ + +  P +G  +P+ +       Y  E Q+ D          D ++ V V G  +    + +   P  + +  A  AG +  I VN+  V  +E     K  ++  V+   + ++G               QE PDG A + Y P   G Y V V   G+ I +  F    T   + ++ + TR     I      N    + F ++T+    VDL  KV      +  +   + +      +    P     H++ V+  G  + G+PF   V    +  ++  FGPG+     + E   FTI    AGPG + + +        ++   DN DG+F V Y  Q PG Y + + F  + I  SP   N         I  E ++   + +G+     + I   +  +   +L      K   V  K+N      + TP  E GEH + +     +IP     V V      D  K K  G GLE+ +  +   F +D   AG G+L++ + GP+KAE   +D  NG C+V+Y+   PG+Y + + +      ++V GSPF   V+  K  P +       Q   +  Q      IN  ID    KDL V    PS F +
Sbjct:  247 DAIEGPVEAIVVDP-TGKEHRMVIL---DGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFP---LRGKPKNSFKVWGRGIAPE--GIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVG------YNDESQSMDFEYSPKQAPDDLEVLVKVAGEVI--ESHKIHVAPESSSKIRAFGAGLEGGI-VNEPCVFDVEMNGESK-DLSFAVEGPSKAEIG--------------CQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRV--TGIDESKVYNVGEKIPFRVDTR-LCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGLQLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLL--FDEIPVKEAVVEVIKGT--DVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKK-DPSQITISGLDQPNYRLNQ-----PINFVIDTSKTKDLPVKATVPSDFAQ 934          

HSP 7 Score: 118.242 bits (295), Expect = 5.204e-26
Identity = 102/353 (28.90%), Postives = 154/353 (43.63%), Query Frame = 2
Query: 4847 EIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQE-----EQH------------------SQVEIEAS-----------DKRCVSQ--YAEKSSSNVEKIICQGLGLKQARLN--------------------------------SVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            E+  + AS+++P G  EP  V+ +  G+ GV F+PRE G HL+ V+ + K +  +PF+I V   +  D   V  SG G +  I  +  +  V+TS AG G L+V++ GPSK  + C E + G  +  Y  T PG Y I I +  + H+  SP T    G KSA  V Q      EQH                  S ++I A            + R + Q  Y  K +  +E I    +  K A +N                                + N+F +   +AG G + V I GP +   E    + GN    VDY V   G +++ V++ D+ IP SPF V++
Sbjct: 1406 ELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKF-ADHHVKDSPLTVQCTG-KSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCH--VDYKVATPGEYVVAVKFNDQHIPDSPFKVYI 1754          

HSP 8 Score: 101.293 bits (251), Expect = 6.311e-21
Identity = 199/883 (22.54%), Postives = 326/883 (36.92%), Query Frame = 3
Query: 2292 GTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASM----PAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQ---IKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKF------FQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRV--TAFGPGLSSGTTNEVAEFTIITK--DAGPGGLSLIVEGPS--KTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI-------------TGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVK--NEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKD----NENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV--------------------------GSVT-----PGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAM---EGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            GT  V Y P+  G   + +  N + + G+P K  V            GDG     G  L +     PA F V  K +    ++ V +  P    + +H     +G  +  +     G++K+ V + G  +  SP+ V  M  G          K   + V   S + +   +     I+ ++K       G +E+   +++LD           G   V + P+E GE+L+ VK  G+ +P   F       Q    S  EV  +         +NEL           ++T       L+  V  PS    +  +T  +     IK+ Y P+E G + + +      +K SP       K  GRV  T        G      E  +  K  +  P  ++  +  P     +I+  D     +++ + P+  G + + + +KD  + GSPF   +              G+ V + +    N+  I  +   + +  +   +  PSK  +    K  N+G   V +     GE++V V      IP SPFKV +     EV      +  G+G+  G A     FT+ T  A  G L   +  P+  E+D  D     +     ++++P E GN+ I+VT  G  +  SPF + V G  +  C+   +    + +     G  CE  +         L V +  PS  T   D  +   G  ++++     G +  SV +   H  GSPF+  V                          G+V       G +  VTA G GL K F      F I T  AG   + V +   +GP   E      Q  G    +YR+         IK+  + I  SPF I
Sbjct: 1254 GTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYV---------DAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAK-ELSVSIEGPAKSQIKIH--DNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQ---------KRSHLSVGSTSEVALPITQQELKGISASIKS-----PGGIEEPCFVRLLDG----------GRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELL----------VDTSKAGYGGLSVSVQGPS----KAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHR--EAGVGAVAVTIEGPSKATLE--FKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAFT---FTVLTHRAK-GHLEAKVVTPNN-EVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDL--CDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKAT--LDAYELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGP--CEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAI 2070          

HSP 9 Score: 95.5153 bits (236), Expect = 3.776e-19
Identity = 114/465 (24.52%), Postives = 196/465 (42.15%), Query Frame = 3
Query: 1314 IDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQN-GQGTVKALVQSPSGKQ----TNGLIDNLNNGKYVVRYTPTEEGPHKINVTYE--GLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSE----AGKAPLEVKVSKPGSGISDR---------PVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISV 2648
            +D+ + P   I V   G    ++       G     Y++P  GL+++NV +  + +  SP  +   PK+       +    G G++PEG+ K+      V++ +  +N     +   V  PS       + G  D   +  +   Y+P ++ P  + V  +  G  I+     V  +   ++  + A G GL    VNE   F V+++G     L  A+EGP+ AEI C +  DG+ ++ YTP  AG Y + V  + + I DSPF + V +           PI+  K        ID S+      K P  V     G  +  +         P++    E   PG F+   +P+      IDV      + G+PF   V +P    K+K+ G G+   +G + +  P  F ++   AG    V V L +  GE + L +    +G +T +Y     G ++++V
Sbjct:  246 VDAIEGPVEAIVVDPTGKEHRMVILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFPLRGKPKN-------SFKVWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDF--EYSP-KQAPDDLEVLVKVAGEVIESHKIHVAPE---SSSKIRAFGAGLEGGIVNEPCVFDVEMNGESK-DLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTE-----------PIEGLKPSATRVTGIDESKVYNVGEKIPFRVDTRLCGVDLVPKVEILDPELNPISYGARE-ITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGV---DGPVYSKEPTRFTIDATQAGPGA-VEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNV 680          

HSP 10 Score: 82.4185 bits (202), Expect = 3.704e-15
Identity = 76/281 (27.05%), Postives = 121/281 (43.06%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            LEA V  P+   E A +    DG   VK++P+  G+H + +  N   + G+P +  V  Y    G     G GL +A+V + A F V    + +  L+V+I+GP+K  +  H+ +DG     +V   PG Y +++  GG   +  SPF  +V G        Q+  H  V                S+S V       L + Q  L  ++     AS    G       G   PC    V+ +   +  V +  +E+G H+I V+   K +P +PF + VD
Sbjct: 1232 LEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGD--GWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGK-AVKDSPFRVLVMGE------GQKRSHLSV---------------GSTSEV------ALPITQQELKGIS-----ASIKSPG-------GIEEPC---FVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVD 1467          

HSP 11 Score: 78.1814 bits (191), Expect = 6.696e-14
Identity = 117/476 (24.58%), Postives = 202/476 (42.44%), Query Frame = 3
Query: 3399 EFTIITKDAGPGGLSLIVEGPSKTE---IKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTP----SKIKVPCVIKKMNNGA--------------LGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNV----EGDKVVPCETQKMERVQEAVKATQVGGNCEINLKID-EMALKDL--KVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDIN-NEFAIYTREAGAGNISVAMEGPS--KAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVE 4733
            +F ++  DA  G +  IV  P+  E   +  +    G     Y     G +++ +  K  P+ GSPF   + G+P  K+   V      P  I  +D+  +  E   P    +   +   + K ++G+              +   ++PK+  + L  + +   ++  S  K++V  E    ++K++  G GLE G+ N+   F ++  +     L+ ++EGPSKAEI C++  +G   + Y PT  G Y + V   GK++  SPF + V    EG K  P  T ++  + E+ K   VG   +I  ++D  +   DL  KV +  P          +   G      +      H + V      + G+PF   V    P  +  +   GPG++          F I   +AG G + VA+        ++   ++QD GS  V Y   +PG Y+ ++ F GE I  SP  I V+
Sbjct:  242 KFAVV--DAIEGPVEAIVVDPTGKEHRMVILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFP--LRGKP--KNSFKVWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVIES-HKIHVAPES---SSKIRAFGAGLEGGIVNEPCVFDVEM-NGESKDLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLK--PSAT-RVTGIDES-KVYNVGE--KIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKE--PTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQD-GSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVK 695          

HSP 12 Score: 64.3142 bits (155), Expect = 9.880e-10
Identity = 44/144 (30.56%), Postives = 70/144 (48.61%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGN---FHIVGSPFTAVVEGNKSATNVN 5341
            DG Y       E G H + +  ++ P+  +   +  G    D     A G GL  A+V +KA F ++   AG G+L++ + GP+K      +  +G     YVA APG+Y + I +G +    H+ GSPF AVV+  K  + + 
Sbjct:  755 DGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVIKG---TDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQIT 895          

HSP 13 Score: 57.7658 bits (138), Expect = 1.184e-7
Identity = 40/109 (36.70%), Postives = 61/109 (55.96%), Query Frame = 3
Query: 4449 VTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAG--AGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVED--DSIKPVAAR 4763
            V P  S  + A G GLE G +   NE  ++  E    + ++S A+EGPSKAE+  QE  D GS  ++Y  +  G Y+  +  +G+HI +SPF + V +  + +KP A R
Sbjct:  409 VAPESSSKIRAFGAGLEGGIV---NEPCVFDVEMNGESKDLSFAVEGPSKAEIGCQERPD-GSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATR 513          

HSP 14 Score: 54.299 bits (129), Expect = 1.334e-6
Identity = 106/475 (22.32%), Postives = 175/475 (36.84%), Query Frame = 3
Query: 1380 IDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGF----NAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDG-TCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXX---XXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFK---------------TNVVQPAQVEKVKVDGDGIIPQ----------NGAILASM----PAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVK 2693
            I+  D G     + +   + G++T++V+Y + H+  SP    V            V A+G     +GV +     F        + G G V   ++ PS K T    D+ N+G   V Y     G + + V +    I DSPF V   P        +L    G G+ + K    T  V+     GH    +         I     +DG +  + + P + G++ I V  +   + +SPF + V  +          S   +      +   F I+ + AG   L V++  P     D      ++E      + V Y P   G     VKYN     GSPFK               T+ V+   V K       ++P+           GA L       PA F ++T  AG N  ++VG+    G    + +  + +G Y C Y+  D     + +      +P SP+ ++
Sbjct: 1617 IEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGA--HKVRAAG-----QGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPS-KATLEFKDH-NDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAFTFT--VLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDA----YELEKG----YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNL-LMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAIE 2071          
BLAST of Filamin-A vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0337101)

HSP 1 Score: 785.023 bits (2026), Expect = 0.000e+0
Identity = 470/1194 (39.36%), Postives = 683/1194 (57.20%), Query Frame = 3
Query: 1245 SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHI---PQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQN-GQGTVKALVQSPSG-----KQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLR---PNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLI-DVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQE------VRETMTRSVQNQISNELASN----AFHGVNFE---INTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEI--PLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDS 4742
            S+KV  +G GLE+    + A F ID++ A    +GVTVEGP EA I+C DNGDGTC V Y     G YT+N+ ++  HI   P  P++VPV        +L     SG G+ P GV  +    F VD S+V  N   G +   +  P G     K   G  D++    + + YTP E G H I + Y+ +P+  SPF+V  K G +     A GPGL     N+K +F V+  GAG+G L LAIEGP++A++ C DN+DG+C V+Y     G+YDI+++F D+ I  SPF V V + V P KVK  GP  +   +R   P  F +D  EAG   + VK++    GI   PV   +VE      + V YVP + G  L   VK+++  +  SPF   V   ++  KVKV G   + +     AS+PA F ++TK AG   D+ V + NP G+ M   +E    G Y   +   + G ++ S+      +  SP+ +++ PTG  +KC +     K      +S + ++ +EAG G +TC   KI  +   ++  I V++          DG   + Y   + G+Y + VK+GG+ IPNG F   A  S ++      + E  T+ VQ    +EL +      +  V FE   + T  G   ++ A+V  PSG +++  I   DN    + + Y P E G H+L V   G P++GSPF+F VD+   G VTA+GPGL+ G T E A FTI TK A  GGL++ VEGPSK +I   DN DGT  V Y+P APG Y + ++F D+ I GSP+ A ITGE  K++Q++VG+ SE+  P  I   DL  L A +  PS ++ PC +K+M  G +G+SFTP+E GEHLV+V   G  I  SPFKV V   EVGDA KVKVSG GL++G  +  N F++DTR+AG+G L++SIEGPSKAEI C D ++G   + Y PTEPG Y++N+ +A  +V GSPF V V G+     + +K++R ++AV  T++G  C++  K+  +   DL   V +PS  TE  +I++  +G   + FV +E G+H VSV + + HI GSPFQFTVG +   GS  V A G GLE+G +    EF ++TREAG G++++++EGPSKA+++F++ +D GSC V+Y+V++PG+Y   +KFN  HI +SPF + V  D+
Sbjct:  959 SNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPV-------PNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDI----FRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTN-SEGI---PVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKG---VNEKKKTPASLPAEFEIDTKQAG-QADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTC---KITNKAGSEIVDIDVIEK---------DGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGG---NVTAEVRMPSGKVDKPVI--QDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEG-SNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKD-GSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA 2114          

HSP 2 Score: 224.172 bits (570), Expect = 0.000e+0
Identity = 120/283 (42.40%), Postives = 163/283 (57.60%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEI---EASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            +L+A +  PSG  +   +Q I    Y V+F PRE G H + V+ N   I  SPFRI VG   ADP  VHASG GL       KA F +NT NAG G+L V+IDGPSKV M+C E E+GY+  Y    PG + I + Y  N HIVGSPF     G+K A    QE     VE     A   +    +     S+  K++ +G+GLK+A +   N F + A+ AG  IL VG+ GP  PCEE  VKH G+N + V Y+V++ G ++++++WG++ IPGSPF + V
Sbjct: 2148 ELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKY-NNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2429          

HSP 3 Score: 448.358 bits (1152), Expect = 1.208e-127
Identity = 466/1682 (27.71%), Postives = 706/1682 (41.97%), Query Frame = 3
Query:   42 EVTYRPQECPNSKALHP-KVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLL-CEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPILSEQIKTLKAGNPH-------------------------------NPMQKANPGK------------SNKPYTALEEAIKEMKESA-VESSKWPQS-KPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGL-IDNLNNGKYVVRYTPTEEGP-HKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEK--------TQFVVDLDGAGHGSLGLAIEGPADAEIQ--CHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRP----------NHFTIDCSEAGKAPLEVKVS-KPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVV----QPAQVEKVKVDGDGIIPQ-------NGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYT--VKSMPTGNPEKCAIKAGKDKTIQVNKE-SVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQ------------VAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALK-----DLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAARAVSS 4775
            +VTY     P S   H  +V  GG   P SP  +      + +K       L+P V+      F V   +   +E  V +  +      P  +     NTY     P   G +  T +  G+   + P+   VV E   +V KIKV+GL P   + + Q F++++   +   DL  V + +P    I  H     +G  V F P + G + +       PI   P  ++ L  +D ++   +   P       + G V +P  F I  D          V V  P       +  +    G     ++P +AG Y++  + +   I GSP        PLI   P L     +     PH                               +PM    P K               P+ A    I+ M ++  V  S +  + K     ++   YG GLEK    +K  FT+++K A +  + + +EGP EA + C DN DG+C V Y    PG Y I + + + HIP SP  V V     + +D S V   GPG+    V +     F VD  E    G G +   + +  G   + L +++  N  Y V Y P + G      V +  + +  SPF++   P      V   G       VNEK         +F +D   AG   + +AI+ P    +Q    +   GT +V + P + G Y  S+K+ D++I  SPF +E             G  K  KL+            +H  +D  EAG   +  K++ K GS I D  V  K       G FD+ Y   + G   I+VK+    I    F    V    Q +  E ++     ++ Q       NG    +  +V            +V   +  P+G+     I+   +G  + +Y   + G H++ V  +G P+  SP+   V S+ +G         G   T  V  E +  TI TK A  G +T  V+   +  +                 ++ DG  SV Y+P   GEY V V++G + I    +F   T    E R+      +NQIS    S     V    +  D     LNA +  PSG  E  P         NI I + P E G H + V   G+ I  SPF+  V  +  G   +V   G GL  G T+    F++ T++AG GGLS+ +EGPSK EI+C D  DGT  +SY P  PG Y + +KF D  + GSPFT  + GE   + +              +G+  ++  K+P      L A +T+PS +     I+++ +G   V F PKE G H V+V      IPGSPF+  V       +  VK  G GLE+G+  +  EF + TR+AG GSL IS+EGPSKA+I+ KD ++G C V Y  TEPG Y + + +  +++P SPF V V  D     +  K+E VQ+  +     GN + +     M  K     +L   +  PSG  + C I+        ++F  RE+GIH + V     HI  SPF+  VG      +  V ASG GL++       +F I T  AG G ++V+++GPSK  M   E ++     V Y    PG++  ++K+N  HIV SPF +    D +    A+  S+
Sbjct:  733 KVTY----TPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQ---RVPLGEKVVVEQTVDVSKIKVDGLEPTAPLNSLQQFRIIT-HGLPKADLA-VTITSPSGNRIKAHIIPTAEGFLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKV--QAFGPGL-----ERGIVGQPAEFMI--DTRGAGQGGLGVTVEGPCE---AAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPF------QPLIVPVPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLV----EETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEA---GPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKG-------VNEKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPT---------GEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKD------GFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSG----YVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADI--------------NYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKIT---GEGRK------RNQISVGSCSE----VTMPGDITDDDLRALNASIQAPSGLEE--PCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA---GDAHKLE-VQQFPQ-----GNIQADAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAA-VHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEE--GYKVRYTPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETST 2313          

HSP 4 Score: 411.764 bits (1057), Expect = 5.111e-116
Identity = 451/1677 (26.89%), Postives = 724/1677 (43.17%), Query Frame = 3
Query:   45 VTYRPQECPNSKALHP-KVTVGGEDIPGSPFTIPFTKKDED-SKYIGTLEDLKPN-VKLQQPQTFKVKLNDGIKSEPCVTVSD-KNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGL---APMIEVCAPQTFKVLS-------PE-KVINPDLVDVQVLNPENKIIPIHKEAAPDGT--KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKG-LLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPILSEQIKTLKAGNPHNPMQ-------KANPGKS-NKPYTALEEAI------KEMKES-----------------AVESSKWPQSKPDQP----------SSKVIVYGKGLE-KVAAKEKAIFTIDSKDAPSAPIGVTV---EGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFH-------XXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISD---RPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVIT---IETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLV-EVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSG-----CMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCED--NHDGTFKVSYVPQAPGNYNIIIKF--KDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLKIPSSDL-----------------------STLTAELTTPS-KIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINL--KIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            +TY     P S+  H   V   G DIP SPF +       D SK   T   ++PN V +++P  F +   D  +  P V + D  N        V+++  +T++  Y     G H +     G P+  +P  V V      +  K++  G    A  + V     FK+ +       PE +VI P  ++  V+           ++  DG   +  + P + G + I      Q + ++P  VK  PK        K+SS          G +  P +F +    TN +       V  P   +   ++      G  L ++ P   G Y++    DN  I  SP   + Q  P     P   E +K    G   N +          +P K+ N P   + + +       E+K +                  VE +    S P+ P          ++KV  +G  L+  V       F +D+++A  A + V +   E   E     +DN D T  V    P  G YT  + Y    +P    VV       + +D+S +     GL P     +   +F +    +    +  +   + SPSG +    I     G ++V +TPT+ G + +++ + G PI   PF ++   G ++  V A GPGL    V +  +F++D  GAG G LG+ +EGP +A I C DN DGTC V Y P +AGDY +++ FN+  I+ SPF              V    ++  G I +A       F +D S+ G     +   K    I D     +  K V+G     F + Y P E G   I++ Y+  P+ GSPF  NV       + K  G G+  + G  L +    F V TK AG N  + + +  P+   M        +G    +Y   D G++ I++      +P SP+ V    T +P K  +     +  QV +ESV T   ++  EAG G+I          K+   E I V +   ++V++  + I +VHY+P + G  L  +VK+    +P   F  T  +   E  +   + V  +     +  A     FEI+TK     D+N  +  P G      +EEV   S   Y     + + P E G +Q  +    + I+GSPF+      GE    ++    P +   T+   +   +  ++AG G ++  +   + +EI   D    DG F + Y    PG+Y+I +KF  KD P       A  + E    S+    +++++  +   S+L                         +TAE+  PS K+  P VI+   +G + V + P+E G H + V   G  + GSPFK +V +   G    V   G GL  G+  +   FTI T+ A  G L +++EGPSKA+I+  DN++G  +V+YLPT PG Y ++V +  K++ GSP+   + G      E +K  ++        VG   E+ +   I +  L+ L  ++  PSG  EPC ++    GN+ I F  RE G H VSV    +HI  SPF+ TV     G +K V  SG GL++G    +N F++ TR AG G +SV++EGPSKAE++  + +D G+  ++Y+ ++PG Y  ++KF   H+  SPF + V
Sbjct:  343 LTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPL--SDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVM-----------QSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPK--------KESSIVAYGPGLSSGVIGYPAAFVV---ETNGETGALGFTVAGPSQAE---IECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSP--FIAQILPRTDFHP---ELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGEKVVV-----EQTVDVSKIKVD--GLEPTAPL-NSLQQFRIITHGLP---KADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKNTRVSGIGIQPHGVIMNAA----TDFMVDMSKVGS---NIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGL--EKG--LTNQKNKFTVETKGAG-NGGLSLAIEGPSEAKMTC--TDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQV-RESVPTFFNVDVGEAGPGRIAV--------KLTNSEGIPVDN---LRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMT-VFPKSEPTKVKVKGVNEKKKTPASLPA----EFEIDTKQAGQADINVAIKNPKGKAMQPRLEEV---STGTY----VVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQ--TSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKP-VIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSG---YVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITG------EGRKRNQI-------SVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTD-KDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKV 1917          

HSP 5 Score: 310.457 bits (794), Expect = 1.348e-84
Identity = 412/1671 (24.66%), Postives = 669/1671 (40.04%), Query Frame = 3
Query:   18 PTKTPDLYEVTYRPQECPNSK-ALHPKVTVGGEDIP-GSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIE---VCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTI--VKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKG--LLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQES--PLITE------EPILSEQ-----IKTLKAGNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKW-------PQSKPDQPS----------SKVIVYGKGLEKVAAKEK--AIFTIDSKDAPSAPIGVTVEGPGEAVIDCV---DNGDGTCGVVYEVPVPG-LYTINVLYDNVHIPQSPIVVPVYPKDN------KNLDLSTVT-ASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQ--LVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHD--NKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLR----------PNHFTIDCSEAGKAPL-------EVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVK-------------------------------------SMPTGNPEKCAIKAGKDKTIQVN------KESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASV----------------------------------HYMPKEEGEYLVEVKYGGQSIPNGKF-FQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFV---DTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANIT-----GEPVKKSQVAVGN-SSEIPLKI---PSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQK-----MERVQEAVKATQVGGNCEINLKIDE-------MALKD--------------------LKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV 4442
            P +  D  + TY  +  P SK A    +T GG+ +P G    +  T      K    ++ L+P   L   Q F++  +   K++  VT++  +G  ++  ++   +   +   +TPT+LG+++++    G P+   P  +  +     N    KV+   P +E   V  P  F + +  +      + V V  P    I        DGT  V ++P E G +++     ++ I  +P     +P  ++     K +  + + ++     +N    F +   K  +N D       +  P  H  +P K  + P        + P +AG +++    DN P+ GSP  + V+    P   +      E  L+ Q     ++T  AGN    +    P ++    T   +   ++   A +  ++        +  P  P           SKV VYG G+E    +E     F +D  +A    I V +       +D +   D G+    V Y  P  G + T  V +  V +P SP V+ V+PK        K ++    T AS P            A+F +D     Q GQ  +   +++P GK     ++ ++ G YVV + P E G ++ ++ Y    I+ SPF ++A P   A+   +    P + +     ++   VD   AG G++   I   A +EI   D   KDG   + Y     GDYDI+VKF  +DI +  F ++ V+ ++             K+++           +  T       K PL         +V  P SG  D+PV    ++    GT  V Y P E G   + VKYN  P+ GSPFK + V       V   G G+       +   PA F ++TK A     + + +  P+   +  H     +G  + +Y     G++++SV      +  SPY  K                                       P+G  E C +K      I ++       E +++++            V   ER+ VG  +++KV  +   + Q H D I SV                                   Y P E G Y+V +K+    +    F  + A       RE + R        E+ S                  DL A V  PS   E+  I   ++  +   + + P E G H + V      I GSPFQF V      G   V A G GL  G   E AEF + T++AG G L++ VEGPSK +I+ +D  DG+  VSY    PG Y + +KF D+ I  SPF   ++        ++  Q   GN  ++ P +     +     L A++  PS     C I+ ++     V F P+E G H ++V   G  IP SPF++ V  ++V D   V  SG GL++       +F I+T +AG G+L +SI+GPSK  +DC + E G   V+Y P  PG + I V Y   ++ GSPF VN  GDK+     Q+     +E VQ+  K  +  G      K D        M LK                     L V ++ P G  E   ++  G+ N  ++++ R+ G + + +   + HI GSPFQ  V
Sbjct:  818 PCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGEKVVVEQTVDVSKIK----VDGLEPTAPLNSLQQFRIITHGLPKADLAVTITSPSGNRIKAHIIP--TAEGFLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSN----KVQAFGPGLERGIVGQPAEFMIDT--RGAGQGGLGVTVEGPCEAAINCRDNG--DGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNL-----KNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHV-LPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKKTPASLP------------AEFEIDT---KQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTS--GSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMP-SGKVDKPV----IQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFH-VDSITSGYVTAYGPGLTHG----VTGEPANFTISTKGASAG-GLTMAVEGPSKADINYH--DNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCERE-VGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQC----KLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLY--AVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKV-GKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGY-KVRYTPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2429          

HSP 6 Score: 216.468 bits (550), Expect = 8.065e-56
Identity = 286/1130 (25.31%), Postives = 471/1130 (41.68%), Query Frame = 3
Query: 1503 PVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGK--QTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAK-PGFNAQLVTASGPGL--HSCKVNEKTQFVVDLDGAGHGSLGLAIEGPAD------AEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPN---HFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTK-DAGVNPDVIVGLFNPNGEPMPLHIEARPN--GLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKA---GKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLS-SGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCE--DNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTAN-ITGEPVKKSQV--------AVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFK------VNVKNEEVGDATKVKVSGKGLEKG--LANQGNEFTIDTRDAG----YGSLNISIEGPSKAEIDCKDNE---NGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV-GSVTPGGSKDVTASGPGLEKGFI--DINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSC--AVTYRVSQPGD-YECSIKFNGEHIVNSPFHIIV 4730
            P+ PK N N     V A GPG+ P G      A FTV   E    G+G+V   +Q P+G+  + +   +N  N  Y V Y P  EG HK+ V + G  I  SPF VK +    +A  V  +GPG+  +   + + T F +    AG G   + I  PA+      A+++  +N    C  EY     G + ++V +    I +SPF V+V       KV++ G    A  +R      F I    AG+   EV+V  PG    ++ V   +V+G    T++  Y P + G  +I V +    ++ SPF+   V P +   +   G G+   +G I    PA F V T  + G     + G       P    IE   N  G    +Y    VG++ + +  D   +PKSP+  + +P  +     +KA   G +K  + +N+ +  T++  +AG   +   V+ +   K            + V+++ +PDG   V Y P     + VEV YGG S PN        Y    V     ++    +   +  NA    +F ++ ++    +L  K++     + EVP    DN  +   ++  P  +G +   +   G+ +          T    ++     GL  +   N + +F IIT       L++ +  PS   IK       +G F V++ P   G Y + I F   PI   PF    +TG    K Q          VG  +E  +    +    L   +  P +  + C  +   +G   V++ P E G++ VN+      I GSPF+       N+KN         +VSG G++    + N   +F +D    G     G L+ +I  P    +  K  +   + +  + Y P E G + I + Y    VPGSPF VNV+      C+  + +     ++        +  ++        L + +  PS     C   D  +G+  + ++A + G + +++   D+HI GSPF+  V  +V P     V   GPG+E G +   +   F +   EAG G I+V +       +     +DKG+C  AV Y   + G    C +KF+   +  SPF + V
Sbjct:  277 PLRPKTNPN----RVRAYGPGIEPIGPVVGAPANFTV---ETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRC--EYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGG--MNQNVMQSKVDG---NTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVK-VGPKKESSIVAYGPGL--SSGVI--GYPAAFVVETNGETGALGFTVAG-------PSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTK------------LPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPH---RVYVGVPVDAAKVQAFGPWLQPGVRPNA--ATHFNVDAREAGDAELKVKIIHEETKI-EVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGEKVVVEQTVDVSKIKV--DGLEPTAPLNSLQQFRIITHGLPKADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINC--RDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKN--------TRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSG----CDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTC--TDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDP---SKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTV 1340          

HSP 7 Score: 137.502 bits (345), Expect = 8.704e-32
Identity = 96/309 (31.07%), Postives = 147/309 (47.57%), Query Frame = 2
Query: 4784 RENHREDAGGLISITVRAE--DGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQ-GLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            R+ ++   G    +T+  +  D ++  L AS+Q PSG  EP  ++++  G  G+ F+PRE G HLV V+   K IN SPF++ V   +  D   V  SG GL          F V+T NAG G L+V+I+GPSK  + C + +DG    +Y  T PG YI+N+ +  + H+ GSPFT  V G                  E S+++      E+ +  + +I  Q  L  K   + S +             L   +  P    E+  ++ V +  + V +V KE G H + VR+ +  IPGSPF   V
Sbjct: 1739 RKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKF-ADHHVEGSPFTVKVAG------------------EGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFD-------------LAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTV 2015          

HSP 8 Score: 112.849 bits (281), Expect = 2.652e-24
Identity = 60/160 (37.50%), Postives = 95/160 (59.38%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATN 5335
            + A V+ PSG ++  ++Q   DG   VK+ PRE G+H + V+ N +P+ GSPF+  V    +  G V A G GL+H +  + A F ++T  A +G L +A++GPSK ++N H+ +DG     Y+ TAPG Y +++ + G+ HI GSP+ A + G     N
Sbjct: 1586 VTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITS--GYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRF-GDKHIKGSPYFAKITGEGRKRN 1742          

HSP 9 Score: 111.694 bits (278), Expect = 6.049e-24
Identity = 89/286 (31.12%), Postives = 140/286 (48.95%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPA-IVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLN-SVNSFF-VDASQAGYGILLVGIAGPVR-PCEEVVVKHVGNNQFTVDYVVKESGTHII-MVRWGDKDIPGSPFMVHV 5695
            KL  ++  P G++ P+ IVQ   D  + + ++P E G H + +  +  P+ GSPF + V     DP    A G GL   + ++K KF V T  AG+G L++AI+GPS+  M C +  DG  +  Y+AT PG Y I I +  + HI GSPF  +VE                   E  D   V  Y              G G++  ++  SV +FF VD  +AG G + V +      P + + V+  GN  + V YV  ++G+ +   V++ + ++P SPF++ V
Sbjct: 1090 KLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNV-KSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRF-ADKHIPGSPFRVLVE-------------------ETVDPSKVKVY--------------GPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTV 1340          

HSP 10 Score: 108.997 bits (271), Expect = 3.662e-23
Identity = 83/282 (29.43%), Postives = 131/282 (46.45%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPG--MVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            L A V +PS   E A +Q++ DG Y V F P+E G H V V  ++  I GSPF+  VG  + D G  +V A G GL   +V + A+F V T  AG GSL ++++GPSK ++   + +DG  + +Y  T PG Y + + +  + HI  SPF   V  +    +  + +Q  Q  I+A                                ++   F V  + A  G L   I  P    ++  ++ +    ++V +  +E+G H I V++    IP SPF + V
Sbjct: 1959 LAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLR-DSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKF-NDRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQA--------------------------------DAPYQFMVRKNGA-KGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKV 2205          

HSP 11 Score: 102.834 bits (255), Expect = 2.790e-21
Identity = 83/294 (28.23%), Postives = 133/294 (45.24%), Query Frame = 2
Query: 4850 IPK--LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQ--ARLNSVNSFFVDASQAGYGI----LLVGIAGP---VRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            +PK  L  ++ +PSGN   A +    +G + V F+P + G +L+ +     PI   PFR+      +D   V A G GL   IV + A+F ++T  AG G L V ++GP +  +NC +  DG     Y+ T  G+Y +NIT+    HI GSPF  ++                                     N++     G+G++     +N+   F VD S+ G  I    L   I  P   V P +  +V+   ++ F + Y   E+G H I + + +  +PGSPF+V+V
Sbjct:  893 LPKADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQC-LTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITF-NERHITGSPFQPLI---------------------------------VPVPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSK--IVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNV 1148          

HSP 12 Score: 76.6406 bits (187), Expect = 2.957e-13
Identity = 82/290 (28.28%), Postives = 117/290 (40.34%), Query Frame = 2
Query: 4877 TPSGNMEPAI-VQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFR---IPVGHYKADPGMVHASGEGLSH--AIVDKKAKFFVNTSNAGS----GSLNVAIDGP------SKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            T  G  E AI  +  GDG   V + P E G + V +  N++ I GSPF+   +PV + K        SG G+     I++    F V+ S  GS    G L+ AI  P      SK+      T+D +   Y     G + I + Y  N  + GSPF   V                                 KS  +  +    G GL++   N  N F V+   AG G L + I GP     ++      +    VDY+  + G + I +R+ DK IPGSPF V V+
Sbjct:  995 TVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKN----TRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQG--PTDDIFRIMYTPFEAGRHTIELMYD-NIPVPGSPFVVNV---------------------------------KSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSE--AKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVE 1242          

HSP 13 Score: 71.2478 bits (173), Expect = 1.090e-11
Identity = 68/291 (23.37%), Postives = 125/291 (42.96%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRI---PVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAID---GPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVE-IEASDKRCVSQYAEKSSSN-VEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD*LT 5707
            +  +++ P G      ++++  G Y V F P E GT+   ++   K I GSPF++   P G  K    +  A     S +    ++   V+   AG G++   I    G   V+++  E +  ++  Y    PG+Y IN+ +GG           +  G+ S   V   EQ+S  E IE    + V Q  +    N   +I  + +  ++  L +             G +   +  P    ++ V++   +   +V Y  +E G+H ++V++  + + GSPF  HVD +T
Sbjct: 1380 INVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGS----QSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGK---------DIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTG-----------GNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSIT 1646          

HSP 14 Score: 67.0106 bits (162), Expect = 2.325e-10
Identity = 72/274 (26.28%), Postives = 110/274 (40.15%), Query Frame = 2
Query: 4886 GNMEPAIVQQIGDGQ-YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFT-YVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQ--ARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            G M   ++Q   DG  Y   + P + G +++ V    + +  SPF + VG  K     + A G GLS  ++   A F V T N  +G+L   + GPS+  + CH+  DG     Y  TA G Y ++I    N  I  SPF                               ++Q   ++  + E +   G GL++    +N   SF VD S+AG   L V +         V +K+  +    V Y       H + V +G    P SP  V+V
Sbjct:  526 GGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKE--SSIVAYGPGLSSGVIGYPAAFVVET-NGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHI-LCDNEDIPKSPF-------------------------------IAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYV 764          

HSP 15 Score: 65.0846 bits (157), Expect = 9.228e-10
Identity = 92/346 (26.59%), Postives = 143/346 (41.33%), Query Frame = 3
Query:   24 KTPDLYEVTYRPQECPNSKALHP-KVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPN-VKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVE--GLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGTK-VTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEG-QVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGL-LCEFIPKKAGPYSLVASVDNNPIKGSPQTIVV 1040
            K   L   T+R +     + LH   V   G  IP SPF +      +  K   +   L+   V++     FK+      + EP V V    G+  + V+  KV  NTY+  Y PTK G+++I  +  G+ VAK+P  V V    P+    I     GL+  + +  P  F V   E       +   V  P    I  H     DG+  V + P   G +++     ++ I ++P I + LP+ D H  + K S P      EK G  +N+P SFT+  D +       DVVV      + +PV+ K  P G     + P    P+++  +        SP  + V
Sbjct:  436 KVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMN-QNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVG---PKKESSIVAYGPGLSSGV-IGYPAAFVV---ETNGETGALGFTVAGPSQAEIECHDNG--DGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGL----EKNGVTINQPTSFTV--DPSKAGNAPLDVVVQDVFGTK-LPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYV 764          

HSP 16 Score: 63.5438 bits (153), Expect = 2.595e-9
Identity = 73/290 (25.17%), Postives = 115/290 (39.66%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQ--YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLS-HAIVDKKAKFF-VNTSNAGSGSLNVAIDGP----SKVNMNCHETE-DGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQA--RLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++  +Q P+G +E A V+   D    Y V + P+  G+H V V+ + + I  SPF + V  +  D   V  +G G+  + +  KK  FF +   +AG G   V I  P    + V     + E D +   YV    G + +N+ Y G   I  SPF   V                                    S+  K+   G GL+    R+     F +    AG G   V + GP    + V+   V  N +   Y   + G ++IMV +  +++  SPF V V
Sbjct:  319 VDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGT-PIPNSPFPVKV---------------------------------APLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKV 574          

HSP 17 Score: 62.003 bits (149), Expect = 7.056e-9
Identity = 70/270 (25.93%), Postives = 107/270 (39.63%), Query Frame = 2
Query: 4901 AIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGL--SHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETE-DG--YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            A V+Q+ +  +  ++     G H V V     PI  SPF + V    +D   V ASG GL  +   V   A F + T  AG G   V + GP  +N N  +++ DG  YE  Y  T  G Y+I +T+ G   +  SPF   V   K ++                                  I+  G GL    +    +F V+ +    G L   +AGP +   E+     G+    V Y     G + + +   ++DIP SPF+  +
Sbjct:  435 AKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPL-SDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQ-EVAKSPFEVKVGPKKESS----------------------------------IVAYGPGLSSGVIGYPAAFVVE-TNGETGALGFTVAGPSQ--AEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQI 665          

HSP 18 Score: 58.9214 bits (141), Expect = 5.674e-8
Identity = 62/264 (23.48%), Postives = 97/264 (36.74%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTS--NAGSGSLNVAIDGPSKVNMNCHETEDG----YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFF-VDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVH 5692
            DG   V +   + G + + +    K I GSPFR+ V     DP  V   G G+ H  V +    F N     AG G + V +     + ++    ED     Y   YV    G+ +          +  SPF   V      T                                 K+  +G+  K+    S+ + F +D  QAG   + V I  P     +  ++ V    + V +V  E GT+   +++GDK+I GSPF + 
Sbjct: 1206 DGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLV-EETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPT---------------------------------KVKVKGVNEKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLE 1435          

HSP 19 Score: 55.0694 bits (131), Expect = 9.400e-7
Identity = 64/248 (25.81%), Postives = 97/248 (39.11%), Query Frame = 2
Query: 4988 NKKPINGSPFRIPVGHYKADPGMVHASGEGLSH--AIVDKKAKFFVNTSNAGSGSLNVAIDGP------SKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVD--ASQAGYGILLVGIAGPVRPCEEVV--VKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            N K   G+P R      K +P  V A G G+     +V   A F V T +AG GS++V I GP      + V  N ++    Y  +Y+  + G++ + + + G   I  SPF   VEG+                                + +  K+   G G++   +      F D  A  AG G+  V I  P      V   V+ + N+ +  +YV    G H + V +    IP SPF V V
Sbjct:  269 NSKLKTGAPLRP-----KTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFN-NDKNLTYTVSYIPKSEGSHKVAVKFSGR-DIPKSPFPVKVEGH--------------------------------AGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKV 477          
BLAST of Filamin-A vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0337102)

HSP 1 Score: 784.252 bits (2024), Expect = 0.000e+0
Identity = 470/1194 (39.36%), Postives = 683/1194 (57.20%), Query Frame = 3
Query: 1245 SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHI---PQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQN-GQGTVKALVQSPSG-----KQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLR---PNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLI-DVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQE------VRETMTRSVQNQISNELASN----AFHGVNFE---INTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEI--PLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDS 4742
            S+KV  +G GLE+    + A F ID++ A    +GVTVEGP EA I+C DNGDGTC V Y     G YT+N+ ++  HI   P  P++VPV        +L     SG G+ P GV  +    F VD S+V  N   G +   +  P G     K   G  D++    + + YTP E G H I + Y+ +P+  SPF+V  K G +     A GPGL     N+K +F V+  GAG+G L LAIEGP++A++ C DN+DG+C V+Y     G+YDI+++F D+ I  SPF V V + V P KVK  GP  +   +R   P  F +D  EAG   + VK++    GI   PV   +VE      + V YVP + G  L   VK+++  +  SPF   V   ++  KVKV G   + +     AS+PA F ++TK AG   D+ V + NP G+ M   +E    G Y   +   + G ++ S+      +  SP+ +++ PTG  +KC +     K      +S + ++ +EAG G +TC   KI  +   ++  I V++          DG   + Y   + G+Y + VK+GG+ IPNG F   A  S ++      + E  T+ VQ    +EL +      +  V FE   + T  G   ++ A+V  PSG +++  I   DN    + + Y P E G H+L V   G P++GSPF+F VD+   G VTA+GPGL+ G T E A FTI TK A  GGL++ VEGPSK +I   DN DGT  V Y+P APG Y + ++F D+ I GSP+ A ITGE  K++Q++VG+ SE+  P  I   DL  L A +  PS ++ PC +K+M  G +G+SFTP+E GEHLV+V   G  I  SPFKV V   EVGDA KVKVSG GL++G  +  N F++DTR+AG+G L++SIEGPSKAEI C D ++G   + Y PTEPG Y++N+ +A  +V GSPF V V G+     + +K++R ++AV  T++G  C++  K+  +   DL   V +PS  TE  +I++  +G   + FV +E G+H VSV + + HI GSPFQFTVG +   GS  V A G GLE+G +    EF ++TREAG G++++++EGPSKA+++F++ +D GSC V+Y+V++PG+Y   +KFN  HI +SPF + V  D+
Sbjct:  934 SNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPV-------PNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDI----FRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTN-SEGI---PVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKG---VNEKKKTPASLPAEFEIDTKQAG-QADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTC---KITNKAGSEIVDIDVIEK---------DGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGG---NVTAEVRMPSGKVDKPVI--QDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEG-SNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKD-GSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA 2089          

HSP 2 Score: 224.172 bits (570), Expect = 0.000e+0
Identity = 120/283 (42.40%), Postives = 163/283 (57.60%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEI---EASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            +L+A +  PSG  +   +Q I    Y V+F PRE G H + V+ N   I  SPFRI VG   ADP  VHASG GL       KA F +NT NAG G+L V+IDGPSKV M+C E E+GY+  Y    PG + I + Y  N HIVGSPF     G+K A    QE     VE     A   +    +     S+  K++ +G+GLK+A +   N F + A+ AG  IL VG+ GP  PCEE  VKH G+N + V Y+V++ G ++++++WG++ IPGSPF + V
Sbjct: 2123 ELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKY-NNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2404          

HSP 3 Score: 447.203 bits (1149), Expect = 2.537e-127
Identity = 466/1682 (27.71%), Postives = 706/1682 (41.97%), Query Frame = 3
Query:   42 EVTYRPQECPNSKALHP-KVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLL-CEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPILSEQIKTLKAGNPH-------------------------------NPMQKANPGK------------SNKPYTALEEAIKEMKESA-VESSKWPQS-KPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGL-IDNLNNGKYVVRYTPTEEGP-HKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEK--------TQFVVDLDGAGHGSLGLAIEGPADAEIQ--CHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRP----------NHFTIDCSEAGKAPLEVKVS-KPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVV----QPAQVEKVKVDGDGIIPQ-------NGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYT--VKSMPTGNPEKCAIKAGKDKTIQVNKE-SVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQ------------VAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALK-----DLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAARAVSS 4775
            +VTY     P S   H  +V  GG   P SP  +      + +K       L+P V+      F V   +   +E  V +  +      P  +     NTY     P   G +  T +  G+   + P+   VV E   +V KIKV+GL P   + + Q F++++   +   DL  V + +P    I  H     +G  V F P + G + +       PI   P  ++ L  +D ++   +   P       + G V +P  F I  D          V V  P       +  +    G     ++P +AG Y++  + +   I GSP        PLI   P L     +     PH                               +PM    P K               P+ A    I+ M ++  V  S +  + K     ++   YG GLEK    +K  FT+++K A +  + + +EGP EA + C DN DG+C V Y    PG Y I + + + HIP SP  V V     + +D S V   GPG+    V +     F VD  E    G G +   + +  G   + L +++  N  Y V Y P + G      V +  + +  SPF++   P      V   G       VNEK         +F +D   AG   + +AI+ P    +Q    +   GT +V + P + G Y  S+K+ D++I  SPF +E             G  K  KL+            +H  +D  EAG   +  K++ K GS I D  V  K       G FD+ Y   + G   I+VK+    I    F    V    Q +  E ++     ++ Q       NG    +  +V            +V   +  P+G+     I+   +G  + +Y   + G H++ V  +G P+  SP+   V S+ +G         G   T  V  E +  TI TK A  G +T  V+   +  +                 ++ DG  SV Y+P   GEY V V++G + I    +F   T    E R+      +NQIS    S     V    +  D     LNA +  PSG  E  P         NI I + P E G H + V   G+ I  SPF+  V  +  G   +V   G GL  G T+    F++ T++AG GGLS+ +EGPSK EI+C D  DGT  +SY P  PG Y + +KF D  + GSPFT  + GE   + +              +G+  ++  K+P      L A +T+PS +     I+++ +G   V F PKE G H V+V      IPGSPF+  V       +  VK  G GLE+G+  +  EF + TR+AG GSL IS+EGPSKA+I+ KD ++G C V Y  TEPG Y + + +  +++P SPF V V  D     +  K+E VQ+  +     GN + +     M  K     +L   +  PSG  + C I+        ++F  RE+GIH + V     HI  SPF+  VG      +  V ASG GL++       +F I T  AG G ++V+++GPSK  M   E ++     V Y    PG++  ++K+N  HIV SPF +    D +    A+  S+
Sbjct:  708 KVTY----TPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQ---RVPLGEKVVVEQTVDVSKIKVDGLEPTAPLNSLQQFRIIT-HGLPKADLA-VTITSPSGNRIKAHIIPTAEGFLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKV--QAFGPGL-----ERGIVGQPAEFMI--DTRGAGQGGLGVTVEGPCEAA---INCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPF------QPLIVPVPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLV----EETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEA---GPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKG-------VNEKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPT---------GEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKD------GFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSG----YVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADI--------------NYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKIT---GEGRK------RNQISVGSCSE----VTMPGDITDDDLRALNASIQAPSGLEE--PCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA---GDAHKLE-VQQFPQ-----GNIQADAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAA-VHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEE--GYKVRYTPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETST 2288          

HSP 4 Score: 410.994 bits (1055), Expect = 7.850e-116
Identity = 451/1677 (26.89%), Postives = 724/1677 (43.17%), Query Frame = 3
Query:   45 VTYRPQECPNSKALHP-KVTVGGEDIPGSPFTIPFTKKDED-SKYIGTLEDLKPN-VKLQQPQTFKVKLNDGIKSEPCVTVSD-KNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGL---APMIEVCAPQTFKVLS-------PE-KVINPDLVDVQVLNPENKIIPIHKEAAPDGT--KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKG-LLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPILSEQIKTLKAGNPHNPMQ-------KANPGKS-NKPYTALEEAI------KEMKES-----------------AVESSKWPQSKPDQP----------SSKVIVYGKGLE-KVAAKEKAIFTIDSKDAPSAPIGVTV---EGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFH-------XXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISD---RPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVIT---IETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLV-EVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSG-----CMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCED--NHDGTFKVSYVPQAPGNYNIIIKF--KDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLKIPSSDL-----------------------STLTAELTTPS-KIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINL--KIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            +TY     P S+  H   V   G DIP SPF +       D SK   T   ++PN V +++P  F +   D  +  P V + D  N        V+++  +T++  Y     G H +     G P+  +P  V V      +  K++  G    A  + V     FK+ +       PE +VI P  ++  V+           ++  DG   +  + P + G + I      Q + ++P  VK  PK        K+SS          G +  P +F +    TN +       V  P   +   ++      G  L ++ P   G Y++    DN  I  SP   + Q  P     P   E +K    G   N +          +P K+ N P   + + +       E+K +                  VE +    S P+ P          ++KV  +G  L+  V       F +D+++A  A + V +   E   E     +DN D T  V    P  G YT  + Y    +P    VV       + +D+S +     GL P     +   +F +    +    +  +   + SPSG +    I     G ++V +TPT+ G + +++ + G PI   PF ++   G ++  V A GPGL    V +  +F++D  GAG G LG+ +EGP +A I C DN DGTC V Y P +AGDY +++ FN+  I+ SPF              V    ++  G I +A       F +D S+ G     +   K    I D     +  K V+G     F + Y P E G   I++ Y+  P+ GSPF  NV       + K  G G+  + G  L +    F V TK AG N  + + +  P+   M        +G    +Y   D G++ I++      +P SP+ V    T +P K  +     +  QV +ESV T   ++  EAG G+I          K+   E I V +   ++V++  + I +VHY+P + G  L  +VK+    +P   F  T  +   E  +   + V  +     +  A     FEI+TK     D+N  +  P G      +EEV   S   Y     + + P E G +Q  +    + I+GSPF+      GE    ++    P +   T+   +   +  ++AG G ++  +   + +EI   D    DG F + Y    PG+Y+I +KF  KD P       A  + E    S+    +++++  +   S+L                         +TAE+  PS K+  P VI+   +G + V + P+E G H + V   G  + GSPFK +V +   G    V   G GL  G+  +   FTI T+ A  G L +++EGPSKA+I+  DN++G  +V+YLPT PG Y ++V +  K++ GSP+   + G      E +K  ++        VG   E+ +   I +  L+ L  ++  PSG  EPC ++    GN+ I F  RE G H VSV    +HI  SPF+ TV     G +K V  SG GL++G    +N F++ TR AG G +SV++EGPSKAE++  + +D G+  ++Y+ ++PG Y  ++KF   H+  SPF + V
Sbjct:  318 LTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPL--SDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVM-----------QSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPK--------KESSIVAYGPGLSSGVIGYPAAFVV---ETNGETGALGFTVAGPSQAE---IECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSP--FIAQILPRTDFHP---ELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGEKVVV-----EQTVDVSKIKVD--GLEPTAPL-NSLQQFRIITHGLP---KADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKNTRVSGIGIQPHGVIMNAA----TDFMVDMSKVGS---NIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGL--EKG--LTNQKNKFTVETKGAG-NGGLSLAIEGPSEAKMTC--TDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQV-RESVPTFFNVDVGEAGPGRIAV--------KLTNSEGIPVDN---LRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMT-VFPKSEPTKVKVKGVNEKKKTPASLPA----EFEIDTKQAGQADINVAIKNPKGKAMQPRLEEV---STGTY----VVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQ--TSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKP-VIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSG---YVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITG------EGRKRNQI-------SVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTD-KDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKV 1892          

HSP 5 Score: 309.686 bits (792), Expect = 2.454e-84
Identity = 412/1671 (24.66%), Postives = 669/1671 (40.04%), Query Frame = 3
Query:   18 PTKTPDLYEVTYRPQECPNSK-ALHPKVTVGGEDIP-GSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIE---VCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTI--VKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKG--LLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQES--PLITE------EPILSEQ-----IKTLKAGNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKW-------PQSKPDQPS----------SKVIVYGKGLEKVAAKEK--AIFTIDSKDAPSAPIGVTVEGPGEAVIDCV---DNGDGTCGVVYEVPVPG-LYTINVLYDNVHIPQSPIVVPVYPKDN------KNLDLSTVT-ASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQ--LVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHD--NKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLR----------PNHFTIDCSEAGKAPL-------EVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVK-------------------------------------SMPTGNPEKCAIKAGKDKTIQVN------KESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASV----------------------------------HYMPKEEGEYLVEVKYGGQSIPNGKF-FQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFV---DTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANIT-----GEPVKKSQVAVGN-SSEIPLKI---PSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQK-----MERVQEAVKATQVGGNCEINLKIDE-------MALKD--------------------LKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV 4442
            P +  D  + TY  +  P SK A    +T GG+ +P G    +  T      K    ++ L+P   L   Q F++  +   K++  VT++  +G  ++  ++   +   +   +TPT+LG+++++    G P+   P  +  +     N    KV+   P +E   V  P  F + +  +      + V V  P    I        DGT  V ++P E G +++     ++ I  +P     +P  ++     K +  + + ++     +N    F +   K  +N D       +  P  H  +P K  + P        + P +AG +++    DN P+ GSP  + V+    P   +      E  L+ Q     ++T  AGN    +    P ++    T   +   ++   A +  ++        +  P  P           SKV VYG G+E    +E     F +D  +A    I V +       +D +   D G+    V Y  P  G + T  V +  V +P SP V+ V+PK        K ++    T AS P            A+F +D     Q GQ  +   +++P GK     ++ ++ G YVV + P E G ++ ++ Y    I+ SPF ++A P   A+   +    P + +     ++   VD   AG G++   I   A +EI   D   KDG   + Y     GDYDI+VKF  +DI +  F ++ V+ ++             K+++           +  T       K PL         +V  P SG  D+PV    ++    GT  V Y P E G   + VKYN  P+ GSPFK + V       V   G G+       +   PA F ++TK A     + + +  P+   +  H     +G  + +Y     G++++SV      +  SPY  K                                       P+G  E C +K      I ++       E +++++            V   ER+ VG  +++KV  +   + Q H D I SV                                   Y P E G Y+V +K+    +    F  + A       RE + R        E+ S                  DL A V  PS   E+  I   ++  +   + + P E G H + V      I GSPFQF V      G   V A G GL  G   E AEF + T++AG G L++ VEGPSK +I+ +D  DG+  VSY    PG Y + +KF D+ I  SPF   ++        ++  Q   GN  ++ P +     +     L A++  PS     C I+ ++     V F P+E G H ++V   G  IP SPF++ V  ++V D   V  SG GL++       +F I+T +AG G+L +SI+GPSK  +DC + E G   V+Y P  PG + I V Y   ++ GSPF VN  GDK+     Q+     +E VQ+  K  +  G      K D        M LK                     L V ++ P G  E   ++  G+ N  ++++ R+ G + + +   + HI GSPFQ  V
Sbjct:  793 PCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGEKVVVEQTVDVSKIK----VDGLEPTAPLNSLQQFRIITHGLPKADLAVTITSPSGNRIKAHIIP--TAEGFLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSN----KVQAFGPGLERGIVGQPAEFMIDT--RGAGQGGLGVTVEGPCEAAINCRDNG--DGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNL-----KNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHV-LPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKKTPASLP------------AEFEIDT---KQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTS--GSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMP-SGKVDKPV----IQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFH-VDSITSGYVTAYGPGLTHG----VTGEPANFTISTKGASAG-GLTMAVEGPSKADINYH--DNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCERE-VGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQC----KLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLY--AVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKV-GKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGY-KVRYTPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2404          

HSP 6 Score: 215.312 bits (547), Expect = 1.848e-55
Identity = 286/1131 (25.29%), Postives = 472/1131 (41.73%), Query Frame = 3
Query: 1503 PVYPKDNKN-LDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGK--QTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAK-PGFNAQLVTASGPGL--HSCKVNEKTQFVVDLDGAGHGSLGLAIEGPAD------AEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPN---HFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTK-DAGVNPDVIVGLFNPNGEPMPLHIEARPN--GLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKA---GKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLS-SGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCE--DNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTAN-ITGEPVKKSQV--------AVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFK------VNVKNEEVGDATKVKVSGKGLEKG--LANQGNEFTIDTRDAG----YGSLNISIEGPSKAEIDCKDNE---NGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV-GSVTPGGSKDVTASGPGLEKGFI--DINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSC--AVTYRVSQPGD-YECSIKFNGEHIVNSPFHIIV 4730
            P+ PK N N +    V A GPG+ P G      A FTV   E    G+G+V   +Q P+G+  + +   +N  N  Y V Y P  EG HK+ V + G  I  SPF VK +    +A  V  +GPG+  +   + + T F +    AG G   + I  PA+      A+++  +N    C  EY     G + ++V +    I +SPF V+V       KV++ G    A  +R      F I    AG+   EV+V  PG    ++ V   +V+G    T++  Y P + G  +I V +    ++ SPF+   V P +   +   G G+   +G I    PA F V T  + G     + G       P    IE   N  G    +Y    VG++ + +  D   +PKSP+  + +P  +     +KA   G +K  + +N+ +  T++  +AG   +   V+ +   K            + V+++ +PDG   V Y P     + VEV YGG S PN        Y    V     ++    +   +  NA    +F ++ ++    +L  K++     + EVP    DN  +   ++  P  +G +   +   G+ +          T    ++     GL  +   N + +F IIT       L++ +  PS   IK       +G F V++ P   G Y + I F   PI   PF    +TG    K Q          VG  +E  +    +    L   +  P +  + C  +   +G   V++ P E G++ VN+      I GSPF+       N+KN         +VSG G++    + N   +F +D    G     G L+ +I  P    +  K  +   + +  + Y P E G + I + Y    VPGSPF VNV+      C+  + +     ++        +  ++        L + +  PS     C   D  +G+  + ++A + G + +++   D+HI GSPF+  V  +V P     V   GPG+E G +   +   F +   EAG G I+V +       +     +DKG+C  AV Y   + G    C +KF+   +  SPF + V
Sbjct:  247 PLRPKTNPNSIPPPRVRAYGPGIEPIGPVVGAPANFTV---ETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRC--EYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGG--MNQNVMQSKVDG---NTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVK-VGPKKESSIVAYGPGL--SSGVI--GYPAAFVVETNGETGALGFTVAG-------PSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTK------------LPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPH---RVYVGVPVDAAKVQAFGPWLQPGVRPNA--ATHFNVDAREAGDAELKVKIIHEETKI-EVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGEKVVVEQTVDVSKIKV--DGLEPTAPLNSLQQFRIITHGLPKADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINC--RDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKN--------TRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSG----CDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTC--TDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDP---SKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTV 1315          

HSP 7 Score: 137.117 bits (344), Expect = 1.174e-31
Identity = 96/309 (31.07%), Postives = 147/309 (47.57%), Query Frame = 2
Query: 4784 RENHREDAGGLISITVRAE--DGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQ-GLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            R+ ++   G    +T+  +  D ++  L AS+Q PSG  EP  ++++  G  G+ F+PRE G HLV V+   K IN SPF++ V   +  D   V  SG GL          F V+T NAG G L+V+I+GPSK  + C + +DG    +Y  T PG YI+N+ +  + H+ GSPFT  V G                  E S+++      E+ +  + +I  Q  L  K   + S +             L   +  P    E+  ++ V +  + V +V KE G H + VR+ +  IPGSPF   V
Sbjct: 1714 RKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKF-ADHHVEGSPFTVKVAG------------------EGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFD-------------LAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTV 1990          

HSP 8 Score: 112.849 bits (281), Expect = 3.103e-24
Identity = 60/160 (37.50%), Postives = 95/160 (59.38%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATN 5335
            + A V+ PSG ++  ++Q   DG   VK+ PRE G+H + V+ N +P+ GSPF+  V    +  G V A G GL+H +  + A F ++T  A +G L +A++GPSK ++N H+ +DG     Y+ TAPG Y +++ + G+ HI GSP+ A + G     N
Sbjct: 1561 VTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITS--GYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRF-GDKHIKGSPYFAKITGEGRKRN 1717          

HSP 9 Score: 111.309 bits (277), Expect = 7.508e-24
Identity = 89/286 (31.12%), Postives = 140/286 (48.95%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPA-IVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLN-SVNSFF-VDASQAGYGILLVGIAGPVR-PCEEVVVKHVGNNQFTVDYVVKESGTHII-MVRWGDKDIPGSPFMVHV 5695
            KL  ++  P G++ P+ IVQ   D  + + ++P E G H + +  +  P+ GSPF + V     DP    A G GL   + ++K KF V T  AG+G L++AI+GPS+  M C +  DG  +  Y+AT PG Y I I +  + HI GSPF  +VE                   E  D   V  Y              G G++  ++  SV +FF VD  +AG G + V +      P + + V+  GN  + V YV  ++G+ +   V++ + ++P SPF++ V
Sbjct: 1065 KLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNV-KSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRF-ADKHIPGSPFRVLVE-------------------ETVDPSKVKVY--------------GPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTV 1315          

HSP 10 Score: 108.997 bits (271), Expect = 4.144e-23
Identity = 83/282 (29.43%), Postives = 131/282 (46.45%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPG--MVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            L A V +PS   E A +Q++ DG Y V F P+E G H V V  ++  I GSPF+  VG  + D G  +V A G GL   +V + A+F V T  AG GSL ++++GPSK ++   + +DG  + +Y  T PG Y + + +  + HI  SPF   V  +    +  + +Q  Q  I+A                                ++   F V  + A  G L   I  P    ++  ++ +    ++V +  +E+G H I V++    IP SPF + V
Sbjct: 1934 LAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLR-DSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKF-NDRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQA--------------------------------DAPYQFMVRKNGA-KGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKV 2180          

HSP 11 Score: 102.834 bits (255), Expect = 3.028e-21
Identity = 83/294 (28.23%), Postives = 133/294 (45.24%), Query Frame = 2
Query: 4850 IPK--LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQ--ARLNSVNSFFVDASQAGYGI----LLVGIAGP---VRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            +PK  L  ++ +PSGN   A +    +G + V F+P + G +L+ +     PI   PFR+      +D   V A G GL   IV + A+F ++T  AG G L V ++GP +  +NC +  DG     Y+ T  G+Y +NIT+    HI GSPF  ++                                     N++     G+G++     +N+   F VD S+ G  I    L   I  P   V P +  +V+   ++ F + Y   E+G H I + + +  +PGSPF+V+V
Sbjct:  868 LPKADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQC-LTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITF-NERHITGSPFQPLI---------------------------------VPVPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSK--IVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNV 1123          

HSP 12 Score: 76.2554 bits (186), Expect = 3.736e-13
Identity = 82/290 (28.28%), Postives = 117/290 (40.34%), Query Frame = 2
Query: 4877 TPSGNMEPAI-VQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFR---IPVGHYKADPGMVHASGEGLSH--AIVDKKAKFFVNTSNAGS----GSLNVAIDGP------SKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            T  G  E AI  +  GDG   V + P E G + V +  N++ I GSPF+   +PV + K        SG G+     I++    F V+ S  GS    G L+ AI  P      SK+      T+D +   Y     G + I + Y  N  + GSPF   V                                 KS  +  +    G GL++   N  N F V+   AG G L + I GP     ++      +    VDY+  + G + I +R+ DK IPGSPF V V+
Sbjct:  970 TVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKN----TRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQG--PTDDIFRIMYTPFEAGRHTIELMYD-NIPVPGSPFVVNV---------------------------------KSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSE--AKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVE 1217          

HSP 13 Score: 71.2478 bits (173), Expect = 1.174e-11
Identity = 68/291 (23.37%), Postives = 125/291 (42.96%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRI---PVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAID---GPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVE-IEASDKRCVSQYAEKSSSN-VEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD*LT 5707
            +  +++ P G      ++++  G Y V F P E GT+   ++   K I GSPF++   P G  K    +  A     S +    ++   V+   AG G++   I    G   V+++  E +  ++  Y    PG+Y IN+ +GG           +  G+ S   V   EQ+S  E IE    + V Q  +    N   +I  + +  ++  L +             G +   +  P    ++ V++   +   +V Y  +E G+H ++V++  + + GSPF  HVD +T
Sbjct: 1355 INVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGS----QSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGK---------DIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTG-----------GNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSIT 1621          

HSP 14 Score: 66.6254 bits (161), Expect = 2.568e-10
Identity = 72/274 (26.28%), Postives = 110/274 (40.15%), Query Frame = 2
Query: 4886 GNMEPAIVQQIGDGQ-YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFT-YVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQ--ARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            G M   ++Q   DG  Y   + P + G +++ V    + +  SPF + VG  K     + A G GLS  ++   A F V T N  +G+L   + GPS+  + CH+  DG     Y  TA G Y ++I    N  I  SPF                               ++Q   ++  + E +   G GL++    +N   SF VD S+AG   L V +         V +K+  +    V Y       H + V +G    P SP  V+V
Sbjct:  501 GGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKES--SIVAYGPGLSSGVIGYPAAFVVET-NGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILC-DNEDIPKSPF-------------------------------IAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYV 739          

HSP 15 Score: 64.6994 bits (156), Expect = 1.137e-9
Identity = 90/344 (26.16%), Postives = 143/344 (41.57%), Query Frame = 3
Query:   24 KTPDLYEVTYRPQECPNSKALHP-KVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPN-VKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGTK-VTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEG-QVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGL-LCEFIPKKAGPYSLVASVDNNPIKGSPQTIVV 1040
            K   L   T+R +     + LH   V   G  IP SPF +      +  K   +   L+   V++     FK+      + EP V V    G+  + V+  KV  NTY+  Y PTK G+++I  +  G+ VAK+P  V V  +   ++      GL+  + +  P  F V   E       +   V  P    I  H     DG+  V + P   G +++     ++ I ++P I + LP+ D H  + K S P      EK G  +N+P SFT+  D +       DVVV      + +PV+ K  P G     + P    P+++  +        SP  + V
Sbjct:  411 KVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMN-QNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYG-PGLSSGV-IGYPAAFVV---ETNGETGALGFTVAGPSQAEIECHDNG--DGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGL----EKNGVTINQPTSFTV--DPSKAGNAPLDVVVQDVFGTK-LPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYV 739          

HSP 16 Score: 63.1586 bits (152), Expect = 3.145e-9
Identity = 73/290 (25.17%), Postives = 115/290 (39.66%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQ--YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLS-HAIVDKKAKFF-VNTSNAGSGSLNVAIDGP----SKVNMNCHETE-DGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQA--RLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++  +Q P+G +E A V+   D    Y V + P+  G+H V V+ + + I  SPF + V  +  D   V  +G G+  + +  KK  FF +   +AG G   V I  P    + V     + E D +   YV    G + +N+ Y G   I  SPF   V                                    S+  K+   G GL+    R+     F +    AG G   V + GP    + V+   V  N +   Y   + G ++IMV +  +++  SPF V V
Sbjct:  294 VDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGT-PIPNSPFPVKV---------------------------------APLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKV 549          

HSP 17 Score: 61.6178 bits (148), Expect = 8.993e-9
Identity = 70/270 (25.93%), Postives = 107/270 (39.63%), Query Frame = 2
Query: 4901 AIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGL--SHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETE-DG--YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            A V+Q+ +  +  ++     G H V V     PI  SPF + V    +D   V ASG GL  +   V   A F + T  AG G   V + GP  +N N  +++ DG  YE  Y  T  G Y+I +T+ G   +  SPF   V   K ++                                  I+  G GL    +    +F V+ +    G L   +AGP +   E+     G+    V Y     G + + +   ++DIP SPF+  +
Sbjct:  410 AKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPL-SDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQ-EVAKSPFEVKVGPKKESS----------------------------------IVAYGPGLSSGVIGYPAAFVVE-TNGETGALGFTVAGPSQ--AEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQI 640          

HSP 18 Score: 58.5362 bits (140), Expect = 7.233e-8
Identity = 62/264 (23.48%), Postives = 98/264 (37.12%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFF--VNTSNAGSGSLNVAIDGPSKVNMNCHETEDG----YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFF-VDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVH 5692
            DG   V +   + G + + +    K I GSPFR+ V     DP  V   G G+ H  V +    F  V+   AG G + V +     + ++    ED     Y   YV    G+ +          +  SPF   V      T                                 K+  +G+  K+    S+ + F +D  QAG   + V I  P     +  ++ V    + V +V  E GT+   +++GDK+I GSPF + 
Sbjct: 1181 DGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLV-EETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPT---------------------------------KVKVKGVNEKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLE 1410          

HSP 19 Score: 54.299 bits (129), Expect = 1.691e-6
Identity = 63/248 (25.40%), Postives = 95/248 (38.31%), Query Frame = 2
Query: 4988 NKKPINGSPFRIPVGHYKADPGMVHASGEGLSH--AIVDKKAKFFVNTSNAGSGSLNVAIDGP------SKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVD--ASQAGYGILLVGIAGPVRPCEEVV--VKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            N K   G+P R         P  V A G G+     +V   A F V T +AG GS++V I GP      + V  N ++    Y  +Y+  + G++ + + + G   I  SPF   VEG+                                + +  K+   G G++   +      F D  A  AG G+  V I  P      V   V+ + N+ +  +YV    G H + V +    IP SPF V V
Sbjct:  239 NSKLKTGAPLRPKTNPNSIPPPRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFN-NDKNLTYTVSYIPKSEGSHKVAVKFSGR-DIPKSPFPVKVEGH--------------------------------AGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKV 452          
BLAST of Filamin-A vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0290014)

HSP 1 Score: 784.252 bits (2024), Expect = 0.000e+0
Identity = 470/1194 (39.36%), Postives = 683/1194 (57.20%), Query Frame = 3
Query: 1245 SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHI---PQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQN-GQGTVKALVQSPSG-----KQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLR---PNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLI-DVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQE------VRETMTRSVQNQISNELASN----AFHGVNFE---INTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEI--PLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDS 4742
            S+KV  +G GLE+    + A F ID++ A    +GVTVEGP EA I+C DNGDGTC V Y     G YT+N+ ++  HI   P  P++VPV        +L     SG G+ P GV  +    F VD S+V  N   G +   +  P G     K   G  D++    + + YTP E G H I + Y+ +P+  SPF+V  K G +     A GPGL     N+K +F V+  GAG+G L LAIEGP++A++ C DN+DG+C V+Y     G+YDI+++F D+ I  SPF V V + V P KVK  GP  +   +R   P  F +D  EAG   + VK++    GI   PV   +VE      + V YVP + G  L   VK+++  +  SPF   V   ++  KVKV G   + +     AS+PA F ++TK AG   D+ V + NP G+ M   +E    G Y   +   + G ++ S+      +  SP+ +++ PTG  +KC +     K      +S + ++ +EAG G +TC   KI  +   ++  I V++          DG   + Y   + G+Y + VK+GG+ IPNG F   A  S ++      + E  T+ VQ    +EL +      +  V FE   + T  G   ++ A+V  PSG +++  I   DN    + + Y P E G H+L V   G P++GSPF+F VD+   G VTA+GPGL+ G T E A FTI TK A  GGL++ VEGPSK +I   DN DGT  V Y+P APG Y + ++F D+ I GSP+ A ITGE  K++Q++VG+ SE+  P  I   DL  L A +  PS ++ PC +K+M  G +G+SFTP+E GEHLV+V   G  I  SPFKV V   EVGDA KVKVSG GL++G  +  N F++DTR+AG+G L++SIEGPSKAEI C D ++G   + Y PTEPG Y++N+ +A  +V GSPF V V G+     + +K++R ++AV  T++G  C++  K+  +   DL   V +PS  TE  +I++  +G   + FV +E G+H VSV + + HI GSPFQFTVG +   GS  V A G GLE+G +    EF ++TREAG G++++++EGPSKA+++F++ +D GSC V+Y+V++PG+Y   +KFN  HI +SPF + V  D+
Sbjct:  929 SNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPV-------PNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDI----FRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTN-SEGI---PVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKG---VNEKKKTPASLPAEFEIDTKQAG-QADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTC---KITNKAGSEIVDIDVIEK---------DGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGG---NVTAEVRMPSGKVDKPVI--QDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEG-SNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKD-GSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA 2084          

HSP 2 Score: 224.172 bits (570), Expect = 0.000e+0
Identity = 120/283 (42.40%), Postives = 163/283 (57.60%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEI---EASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            +L+A +  PSG  +   +Q I    Y V+F PRE G H + V+ N   I  SPFRI VG   ADP  VHASG GL       KA F +NT NAG G+L V+IDGPSKV M+C E E+GY+  Y    PG + I + Y  N HIVGSPF     G+K A    QE     VE     A   +    +     S+  K++ +G+GLK+A +   N F + A+ AG  IL VG+ GP  PCEE  VKH G+N + V Y+V++ G ++++++WG++ IPGSPF + V
Sbjct: 2118 ELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKY-NNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2399          

HSP 3 Score: 447.588 bits (1150), Expect = 1.718e-127
Identity = 466/1682 (27.71%), Postives = 706/1682 (41.97%), Query Frame = 3
Query:   42 EVTYRPQECPNSKALHP-KVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLL-CEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPILSEQIKTLKAGNPH-------------------------------NPMQKANPGK------------SNKPYTALEEAIKEMKESA-VESSKWPQS-KPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGL-IDNLNNGKYVVRYTPTEEGP-HKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEK--------TQFVVDLDGAGHGSLGLAIEGPADAEIQ--CHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRP----------NHFTIDCSEAGKAPLEVKVS-KPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVV----QPAQVEKVKVDGDGIIPQ-------NGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYT--VKSMPTGNPEKCAIKAGKDKTIQVNKE-SVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQ------------VAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALK-----DLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAARAVSS 4775
            +VTY     P S   H  +V  GG   P SP  +      + +K       L+P V+      F V   +   +E  V +  +      P  +     NTY     P   G +  T +  G+   + P+   VV E   +V KIKV+GL P   + + Q F++++   +   DL  V + +P    I  H     +G  V F P + G + +       PI   P  ++ L  +D ++   +   P       + G V +P  F I  D          V V  P       +  +    G     ++P +AG Y++  + +   I GSP        PLI   P L     +     PH                               +PM    P K               P+ A    I+ M ++  V  S +  + K     ++   YG GLEK    +K  FT+++K A +  + + +EGP EA + C DN DG+C V Y    PG Y I + + + HIP SP  V V     + +D S V   GPG+    V +     F VD  E    G G +   + +  G   + L +++  N  Y V Y P + G      V +  + +  SPF++   P      V   G       VNEK         +F +D   AG   + +AI+ P    +Q    +   GT +V + P + G Y  S+K+ D++I  SPF +E             G  K  KL+            +H  +D  EAG   +  K++ K GS I D  V  K       G FD+ Y   + G   I+VK+    I    F    V    Q +  E ++     ++ Q       NG    +  +V            +V   +  P+G+     I+   +G  + +Y   + G H++ V  +G P+  SP+   V S+ +G         G   T  V  E +  TI TK A  G +T  V+   +  +                 ++ DG  SV Y+P   GEY V V++G + I    +F   T    E R+      +NQIS    S     V    +  D     LNA +  PSG  E  P         NI I + P E G H + V   G+ I  SPF+  V  +  G   +V   G GL  G T+    F++ T++AG GGLS+ +EGPSK EI+C D  DGT  +SY P  PG Y + +KF D  + GSPFT  + GE   + +              +G+  ++  K+P      L A +T+PS +     I+++ +G   V F PKE G H V+V      IPGSPF+  V       +  VK  G GLE+G+  +  EF + TR+AG GSL IS+EGPSKA+I+ KD ++G C V Y  TEPG Y + + +  +++P SPF V V  D     +  K+E VQ+  +     GN + +     M  K     +L   +  PSG  + C I+        ++F  RE+GIH + V     HI  SPF+  VG      +  V ASG GL++       +F I T  AG G ++V+++GPSK  M   E ++     V Y    PG++  ++K+N  HIV SPF +    D +    A+  S+
Sbjct:  703 KVTY----TPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQ---RVPLGEKVVVEQTVDVSKIKVDGLEPTAPLNSLQQFRIIT-HGLPKADLA-VTITSPSGNRIKAHIIPTAEGFLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKV--QAFGPGL-----ERGIVGQPAEFMI--DTRGAGQGGLGVTVEGPCEAA---INCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPF------QPLIVPVPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLV----EETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEA---GPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKG-------VNEKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPT---------GEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKD------GFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSG----YVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADI--------------NYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKIT---GEGRK------RNQISVGSCSE----VTMPGDITDDDLRALNASIQAPSGLEE--PCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA---GDAHKLE-VQQFPQ-----GNIQADAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAA-VHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEE--GYKVRYTPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETST 2283          

HSP 4 Score: 431.024 bits (1107), Expect = 3.966e-122
Identity = 446/1628 (27.40%), Postives = 708/1628 (43.49%), Query Frame = 3
Query:   24 KTPDLYEVTYRPQECPNSKALHP-KVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPN-VKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGTK-VTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEG-QVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPILSEQIKTLKAGNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTV---EGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFH-------XXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISD---RPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVIT---IETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLV-EVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSG-----CMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCED--NHDGTFKVSYVPQAPGNYNIIIKF--KDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLKIPSSDL-----------------------STLTAELTTPS-KIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINL--KIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            K   L   T+R +     + LH   V   G  IP SPF +      +  K   +   L+   V++     FK+      + EP V V    G+  + V+  KV  NTY+  Y PTK G+++I  +  G+ VAK+P  V V  +   ++      GL+  + +  P  F V   E       +   V  P    I  H     DG+  V + P   G +++     ++ I ++P I + LP+ D H  + K S P      EK G  +N+P SFT+  D +       DVVV      + +PV+ K  P G                  V   P  G P T+ V    + T                         P   ++ Y  +   +   K  A      P  +P+  +                    F +D+++A  A + V +   E   E     +DN D T  V    P  G YT  + Y    +P    VV       + +D+S +     GL P     +   +F +    +    +  +   + SPSG +    I     G ++V +TPT+ G + +++ + G PI   PF ++   G ++  V A GPGL    V +  +F++D  GAG G LG+ +EGP +A I C DN DGTC V Y P +AGDY +++ FN+  I+ SPF              V    ++  G I +A       F +D S+ G     +   K    I D     +  K V+G     F + Y P E G   I++ Y+  P+ GSPF  NV       + K  G G+  + G  L +    F V TK AG N  + + +  P+   M        +G    +Y   D G++ I++      +P SP+ V    T +P K  +     +  QV +ESV T   ++  EAG G+I          K+   E I V +   ++V++  + I +VHY+P + G  L  +VK+    +P   F  T  +   E  +   + V  +     +  A     FEI+TK     D+N  +  P G      +EEV   S   Y     + + P E G +Q  +    + I+GSPF+      GE    ++    P +   T+   +   +  ++AG G ++  +   + +EI   D    DG F + Y    PG+Y+I +KF  KD P       A  + E    S+    +++++  +   S+L                         +TAE+  PS K+  P VI+   +G + V + P+E G H + V   G  + GSPFK +V +   G    V   G GL  G+  +   FTI T+ A  G L +++EGPSKA+I+  DN++G  +V+YLPT PG Y ++V +  K++ GSP+   + G      E +K  ++        VG   E+ +   I +  L+ L  ++  PSG  EPC ++    GN+ I F  RE G H VSV    +HI  SPF+ TV     G +K V  SG GL++G    +N F++ TR AG G +SV++EGPSKAE++  + +D G+  ++Y+ ++PG Y  ++KF   H+  SPF + V
Sbjct:  406 KVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMN-QNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYG-PGLSSGV-IGYPAAFVV---ETNGETGALGFTVAGPSQAEIECHDNG--DGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGL----EKNGVTINQPTSFTV--DPSKAGNAPLDVVVQDVFGTK-LPVELKNNPDG---------------TKKVTYTPTSGVPHTVEVNYGGVST-------------------------PNSPHRVYVGV--PVDAAKVQAFGPWLQPGVRPNAATH-------------------FNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGEKVVV-----EQTVDVSKIKVD--GLEPTAPL-NSLQQFRIITHGLP---KADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKNTRVSGIGIQPHGVIMNAA----TDFMVDMSKVGS---NIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGL--EKG--LTNQKNKFTVETKGAG-NGGLSLAIEGPSEAKMTC--TDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQV-RESVPTFFNVDVGEAGPGRIAV--------KLTNSEGIPVDN---LRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMT-VFPKSEPTKVKVKGVNEKKKTPASLPA----EFEIDTKQAGQADINVAIKNPKGKAMQPRLEEV---STGTY----VVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQ--TSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKP-VIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSG---YVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITG------EGRKRNQI-------SVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTD-KDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKV 1887          

HSP 5 Score: 310.071 bits (793), Expect = 1.816e-84
Identity = 412/1671 (24.66%), Postives = 669/1671 (40.04%), Query Frame = 3
Query:   18 PTKTPDLYEVTYRPQECPNSK-ALHPKVTVGGEDIP-GSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIE---VCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTI--VKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKG--LLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQES--PLITE------EPILSEQ-----IKTLKAGNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKW-------PQSKPDQPS----------SKVIVYGKGLEKVAAKEK--AIFTIDSKDAPSAPIGVTVEGPGEAVIDCV---DNGDGTCGVVYEVPVPG-LYTINVLYDNVHIPQSPIVVPVYPKDN------KNLDLSTVT-ASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQ--LVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHD--NKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLR----------PNHFTIDCSEAGKAPL-------EVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVK-------------------------------------SMPTGNPEKCAIKAGKDKTIQVN------KESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASV----------------------------------HYMPKEEGEYLVEVKYGGQSIPNGKF-FQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFV---DTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANIT-----GEPVKKSQVAVGN-SSEIPLKI---PSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQK-----MERVQEAVKATQVGGNCEINLKIDE-------MALKD--------------------LKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV 4442
            P +  D  + TY  +  P SK A    +T GG+ +P G    +  T      K    ++ L+P   L   Q F++  +   K++  VT++  +G  ++  ++   +   +   +TPT+LG+++++    G P+   P  +  +     N    KV+   P +E   V  P  F + +  +      + V V  P    I        DGT  V ++P E G +++     ++ I  +P     +P  ++     K +  + + ++     +N    F +   K  +N D       +  P  H  +P K  + P        + P +AG +++    DN P+ GSP  + V+    P   +      E  L+ Q     ++T  AGN    +    P ++    T   +   ++   A +  ++        +  P  P           SKV VYG G+E    +E     F +D  +A    I V +       +D +   D G+    V Y  P  G + T  V +  V +P SP V+ V+PK        K ++    T AS P            A+F +D     Q GQ  +   +++P GK     ++ ++ G YVV + P E G ++ ++ Y    I+ SPF ++A P   A+   +    P + +     ++   VD   AG G++   I   A +EI   D   KDG   + Y     GDYDI+VKF  +DI +  F ++ V+ ++             K+++           +  T       K PL         +V  P SG  D+PV    ++    GT  V Y P E G   + VKYN  P+ GSPFK + V       V   G G+       +   PA F ++TK A     + + +  P+   +  H     +G  + +Y     G++++SV      +  SPY  K                                       P+G  E C +K      I ++       E +++++            V   ER+ VG  +++KV  +   + Q H D I SV                                   Y P E G Y+V +K+    +    F  + A       RE + R        E+ S                  DL A V  PS   E+  I   ++  +   + + P E G H + V      I GSPFQF V      G   V A G GL  G   E AEF + T++AG G L++ VEGPSK +I+ +D  DG+  VSY    PG Y + +KF D+ I  SPF   ++        ++  Q   GN  ++ P +     +     L A++  PS     C I+ ++     V F P+E G H ++V   G  IP SPF++ V  ++V D   V  SG GL++       +F I+T +AG G+L +SI+GPSK  +DC + E G   V+Y P  PG + I V Y   ++ GSPF VN  GDK+     Q+     +E VQ+  K  +  G      K D        M LK                     L V ++ P G  E   ++  G+ N  ++++ R+ G + + +   + HI GSPFQ  V
Sbjct:  788 PCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGEKVVVEQTVDVSKIK----VDGLEPTAPLNSLQQFRIITHGLPKADLAVTITSPSGNRIKAHIIP--TAEGFLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSN----KVQAFGPGLERGIVGQPAEFMIDT--RGAGQGGLGVTVEGPCEAAINCRDNG--DGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNL-----KNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHV-LPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKKTPASLP------------AEFEIDT---KQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTS--GSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMP-SGKVDKPV----IQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFH-VDSITSGYVTAYGPGLTHG----VTGEPANFTISTKGASAG-GLTMAVEGPSKADINYH--DNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCERE-VGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQC----KLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLY--AVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKV-GKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGY-KVRYTPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2399          

HSP 6 Score: 281.182 bits (718), Expect = 1.548e-75
Identity = 321/1211 (26.51%), Postives = 507/1211 (41.87%), Query Frame = 3
Query: 1245 SSKVIVYGKGLE--KVAAKEKAIFTIDSKDAPSAPIGVTVEGPGE------AVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPF--HXXXXXXXXXXXXXSKGPIKD---AKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGE-PMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSI-PNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFF---VDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAG----PGGLSL-------------IVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITG--EPVKKSQVAVG-------NSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQG--NEFTIDTRDAGYGSLNISI---EGPSKAEIDCKDNENGVCTVKYLPTEPGNYVI-NVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDK-GSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            +SKV V G G++   V  K+   F I +KDA      V +  P        A +  ++N    C   Y   + GL+++NV Y    IP SP  V V P      D   V ASG GL   GV     A F +        G+G  +  V  P G   N +   ++   Y   Y PT+EG + I VT+ G  +  SPF VK  P   + +V A GPGL S  +     FVV+ +G   G+LG  + GP+ AEI+CHDN DG+ LV+Y P   G+Y + +  ++EDI  SPF   +    +  PE VK+ GP  +     + +P  FT+D S+AG APL+V V       +  PV +K       GT  V Y P    P  ++V Y       SP +  V  P    KV+  G  + P    +  +    F+V+ ++AG + ++ V + +   +  +P  I    +  Y+ E      G +  ++   G  +P     V    T +  K  +  G + T  +N      I T    K  +  T+      +            IK  +    +G   V++ P + GEYL+ + +GG  I P     Q  T S     +     ++  I  + A        F I+T+      L   V  P     E  I   DN      + Y P+E G + + +    R I GSPFQ     V      RV+  G        N   +F +     G     G LS              IV+GP+          D  F++ Y P   G + I + + + P+ GSPF  N+    +P +      G         ++  ++   +    L+  +  PS+ K+ C   +  +G+  V +   + GE+ + +      IPGSPF+V V  EE  D +KVKV G G+E G   +     F +D  +AG G + + +   EG     +  +D  N +  V Y+P + G+ +   V ++   VP SPF + V   K  P +  K++ V E  K T      E  +   +    D+ V +  P G      +E+   G   + FV  E G +  S+ + D+ I GSPF+             +    P ++       +   +  REAG G ++  +   + +E+   +  +K G   + Y ++ PGDY+ ++KF G+ I N  F I
Sbjct:  354 ASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRC--EYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLS----DARKVRASGRGLQATGVRVGDDADFKI---YTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIV-AYGPGLSSGVIGYPAAFVVETNGE-TGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFG--TKLPVELKN---NPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQP---GVRPNAATHFNVDAREAG-DAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGEKVVVEQ-TVDVSKIKVD-GLEPTAPLNSLQQFRIITHGLPKADLAVTITSPSGNR------------IKAHIIPTAEGFL-VNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAE-------FMIDTRGAGQGGLGVTVEGPC----EAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPT----------DDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNR--DGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLV--EETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVF-PKSEPTKV-KVKGVNEK-KKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTS--GSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSI 1499          

HSP 7 Score: 253.447 bits (646), Expect = 3.849e-67
Identity = 373/1564 (23.85%), Postives = 634/1564 (40.54%), Query Frame = 3
Query:  336 TYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVE--GLAPM-IEVCAPQTFKVLSPEKVIN-PDLVDVQVLNPENKIIPIHKEAAPDGTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVV---QESPLITEEPILSEQIKTLKAG--------------NPHNPMQKANPGKSNKPYTALEE----AIKEMKESAV-ESSKWPQS--------KPDQPSSKVIVYGKGLEK--VAAKEKAIFTIDSKDAPSAPIGVTVEG--PGEAVIDCVDNGDGTCGVVYEVPVPGL-YTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH-SCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPD---VIVGLFNPNGEPMPLHIEARP-NGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKC-AIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFF----------QTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGP-HQLQVNSQGRPIKGSPFQFFVDTKGE-GRVTAFGPGLSSGTTNEV-AEFTIITKDAGPGGLSLIVEGPSKTEI--KCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFT--ANITGEPVKKSQV-------AVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNV-------KNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGY---------GSLNISIEGPSKAEID---CKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV-------GSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMK-FQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            TY  +Y P   G H +     G+ + K+P  V V      +  K+KV   G+ P  + +  P  F +L+ +     P+++ +   N +  +    ++   D  +  +V    G HS+  +    PI  +P  VK  P +D      +K   +   ++    +V     F I  +   +   + +V V+ P       ++SK       C + P K G Y ++ +     +  SP  + V   +ES ++   P LS  +    A                   P Q       N   +AL +    A+ E     + ++   P+S        + D     V   G GLEK  V   +   FT+D   A +AP+ V V+     +  ++  +N DGT  V Y  P  G+ +T+ V Y  V  P SP  V V       +D + V A GP L P GV  +    F VDA E   + +  VK + +    +    +IDN +N  Y V   P  +G +   +TY G   Q  P   K        +      GL  +  +N   QF +   G     L + I  P+   I+ H     +G  LV +TP + G+Y +S+ F    I+  PF ++ +      KV++ GP ++   + +P  F ID   AG+  L V V  P     +             GT +V Y+P E G   +++ +N+  I+GSPF+  +V    ++  +V G GI P    ++ +    F V+    G N D   +   +F+P G  +P  I   P + ++   Y   + G H I +  D  P+P SP+ V      +P +C A   G +K +  N+++  T+ETK AG G ++  ++       G  E        K+   ++ DG   V Y+  + GEY + +++  + IP   F           +   Y        +  SV    + ++       +  ++   +G+PVD N +V     C+  V               Y P + G     QV      +  SPF   V  K E  +V   G      T   + AEF I TK AG   +++ ++ P    +  + E+   GT+ VS+VP   G Y   IK+ D+ I GSPF   A  TGE  K   V         G+ S + +    +    +T ++T  +  ++  +     +G   + +   + G++ +NV   G DIP   F +          + E  +    KV  +  +  L N  +E T   R   +         G++   +  PS  ++D    +DN +G  +VKY P E G++ + V Y G+ V GSPF  +V+        +  +      +     G      +     +   L + V  PS      +  D  +G + ++++    G + VSV   D+HI+GSP+   +         ++ G   +VT  G        DI ++      +  A N S+  + PS  E   F +    G+  +++   + G++  S+K  G+HI NSPF + V
Sbjct:  314 TYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGH-AGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDA-----RKVRASGRGLQATGVRVGDDADFKIYTEGAGEG--EPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTY-TPTSGVPHTVEVNYGGVSTPNSPHRVYV----GVPVDAAKVQAFGPWLQP-GVRPNAATHFNVDAREAG-DAELKVKIIHEETKIEVPCRIIDNEDN-TYSVEVIPPSKGAYTTTMTYGG---QRVPLGEKVVVEQTVDVSKIKVDGLEPTAPLNSLQQFRIITHGLPKADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAIN-------CRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKNTRVSGIGIQPH--GVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGL-TNQKNKFTVETKGAGNGGLSLAIE-------GPSEA-------KMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVD-NLRVEDKGNCIYAV--------------HYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITY--RSVAFEKLPLPTTGGNVTAEVRMPS-GKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDS-----ITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPS--KADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPG--------DITDD------DLRALNASI--QAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTV 1792          

HSP 8 Score: 216.468 bits (550), Expect = 8.700e-56
Identity = 286/1130 (25.31%), Postives = 471/1130 (41.68%), Query Frame = 3
Query: 1503 PVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGK--QTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAK-PGFNAQLVTASGPGL--HSCKVNEKTQFVVDLDGAGHGSLGLAIEGPAD------AEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPN---HFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTK-DAGVNPDVIVGLFNPNGEPMPLHIEARPN--GLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKA---GKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLS-SGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCE--DNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTAN-ITGEPVKKSQV--------AVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFK------VNVKNEEVGDATKVKVSGKGLEKG--LANQGNEFTIDTRDAG----YGSLNISIEGPSKAEIDCKDNE---NGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV-GSVTPGGSKDVTASGPGLEKGFI--DINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSC--AVTYRVSQPGD-YECSIKFNGEHIVNSPFHIIV 4730
            P+ PK N N     V A GPG+ P G      A FTV   E    G+G+V   +Q P+G+  + +   +N  N  Y V Y P  EG HK+ V + G  I  SPF VK +    +A  V  +GPG+  +   + + T F +    AG G   + I  PA+      A+++  +N    C  EY     G + ++V +    I +SPF V+V       KV++ G    A  +R      F I    AG+   EV+V  PG    ++ V   +V+G    T++  Y P + G  +I V +    ++ SPF+   V P +   +   G G+   +G I    PA F V T  + G     + G       P    IE   N  G    +Y    VG++ + +  D   +PKSP+  + +P  +     +KA   G +K  + +N+ +  T++  +AG   +   V+ +   K            + V+++ +PDG   V Y P     + VEV YGG S PN        Y    V     ++    +   +  NA    +F ++ ++    +L  K++     + EVP    DN  +   ++  P  +G +   +   G+ +          T    ++     GL  +   N + +F IIT       L++ +  PS   IK       +G F V++ P   G Y + I F   PI   PF    +TG    K Q          VG  +E  +    +    L   +  P +  + C  +   +G   V++ P E G++ VN+      I GSPF+       N+KN         +VSG G++    + N   +F +D    G     G L+ +I  P    +  K  +   + +  + Y P E G + I + Y    VPGSPF VNV+      C+  + +     ++        +  ++        L + +  PS     C   D  +G+  + ++A + G + +++   D+HI GSPF+  V  +V P     V   GPG+E G +   +   F +   EAG G I+V +       +     +DKG+C  AV Y   + G    C +KF+   +  SPF + V
Sbjct:  247 PLRPKTNPN----RVRAYGPGIEPIGPVVGAPANFTV---ETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRC--EYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGG--MNQNVMQSKVDG---NTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVK-VGPKKESSIVAYGPGL--SSGVI--GYPAAFVVETNGETGALGFTVAG-------PSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTK------------LPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPH---RVYVGVPVDAAKVQAFGPWLQPGVRPNA--ATHFNVDAREAGDAELKVKIIHEETKI-EVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGEKVVVEQTVDVSKIKV--DGLEPTAPLNSLQQFRIITHGLPKADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINC--RDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKN--------TRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSG----CDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTC--TDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDP---SKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTV 1310          

HSP 9 Score: 137.117 bits (344), Expect = 1.234e-31
Identity = 96/309 (31.07%), Postives = 147/309 (47.57%), Query Frame = 2
Query: 4784 RENHREDAGGLISITVRAE--DGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQ-GLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            R+ ++   G    +T+  +  D ++  L AS+Q PSG  EP  ++++  G  G+ F+PRE G HLV V+   K IN SPF++ V   +  D   V  SG GL          F V+T NAG G L+V+I+GPSK  + C + +DG    +Y  T PG YI+N+ +  + H+ GSPFT  V G                  E S+++      E+ +  + +I  Q  L  K   + S +             L   +  P    E+  ++ V +  + V +V KE G H + VR+ +  IPGSPF   V
Sbjct: 1709 RKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKF-ADHHVEGSPFTVKVAG------------------EGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFD-------------LAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTV 1985          

HSP 10 Score: 112.464 bits (280), Expect = 3.290e-24
Identity = 60/160 (37.50%), Postives = 95/160 (59.38%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATN 5335
            + A V+ PSG ++  ++Q   DG   VK+ PRE G+H + V+ N +P+ GSPF+  V    +  G V A G GL+H +  + A F ++T  A +G L +A++GPSK ++N H+ +DG     Y+ TAPG Y +++ + G+ HI GSP+ A + G     N
Sbjct: 1556 VTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITS--GYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRF-GDKHIKGSPYFAKITGEGRKRN 1712          

HSP 11 Score: 111.309 bits (277), Expect = 8.095e-24
Identity = 89/286 (31.12%), Postives = 140/286 (48.95%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPA-IVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLN-SVNSFF-VDASQAGYGILLVGIAGPVR-PCEEVVVKHVGNNQFTVDYVVKESGTHII-MVRWGDKDIPGSPFMVHV 5695
            KL  ++  P G++ P+ IVQ   D  + + ++P E G H + +  +  P+ GSPF + V     DP    A G GL   + ++K KF V T  AG+G L++AI+GPS+  M C +  DG  +  Y+AT PG Y I I +  + HI GSPF  +VE                   E  D   V  Y              G G++  ++  SV +FF VD  +AG G + V +      P + + V+  GN  + V YV  ++G+ +   V++ + ++P SPF++ V
Sbjct: 1060 KLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNV-KSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRF-ADKHIPGSPFRVLVE-------------------ETVDPSKVKVY--------------GPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTV 1310          

HSP 12 Score: 108.997 bits (271), Expect = 4.468e-23
Identity = 83/282 (29.43%), Postives = 131/282 (46.45%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPG--MVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            L A V +PS   E A +Q++ DG Y V F P+E G H V V  ++  I GSPF+  VG  + D G  +V A G GL   +V + A+F V T  AG GSL ++++GPSK ++   + +DG  + +Y  T PG Y + + +  + HI  SPF   V  +    +  + +Q  Q  I+A                                ++   F V  + A  G L   I  P    ++  ++ +    ++V +  +E+G H I V++    IP SPF + V
Sbjct: 1929 LAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLR-DSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKF-NDRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQA--------------------------------DAPYQFMVRKNGA-KGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKV 2175          

HSP 13 Score: 102.834 bits (255), Expect = 3.292e-21
Identity = 83/294 (28.23%), Postives = 133/294 (45.24%), Query Frame = 2
Query: 4850 IPK--LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQ--ARLNSVNSFFVDASQAGYGI----LLVGIAGP---VRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            +PK  L  ++ +PSGN   A +    +G + V F+P + G +L+ +     PI   PFR+      +D   V A G GL   IV + A+F ++T  AG G L V ++GP +  +NC +  DG     Y+ T  G+Y +NIT+    HI GSPF  ++                                     N++     G+G++     +N+   F VD S+ G  I    L   I  P   V P +  +V+   ++ F + Y   E+G H I + + +  +PGSPF+V+V
Sbjct:  863 LPKADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQC-LTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITF-NERHITGSPFQPLI---------------------------------VPVPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSK--IVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNV 1118          

HSP 14 Score: 75.8702 bits (185), Expect = 4.028e-13
Identity = 82/290 (28.28%), Postives = 117/290 (40.34%), Query Frame = 2
Query: 4877 TPSGNMEPAI-VQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFR---IPVGHYKADPGMVHASGEGLSH--AIVDKKAKFFVNTSNAGS----GSLNVAIDGP------SKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            T  G  E AI  +  GDG   V + P E G + V +  N++ I GSPF+   +PV + K        SG G+     I++    F V+ S  GS    G L+ AI  P      SK+      T+D +   Y     G + I + Y  N  + GSPF   V                                 KS  +  +    G GL++   N  N F V+   AG G L + I GP     ++      +    VDY+  + G + I +R+ DK IPGSPF V V+
Sbjct:  965 TVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKN----TRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQG--PTDDIFRIMYTPFEAGRHTIELMYD-NIPVPGSPFVVNV---------------------------------KSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSE--AKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVE 1212          

HSP 15 Score: 71.2478 bits (173), Expect = 1.244e-11
Identity = 68/291 (23.37%), Postives = 125/291 (42.96%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRI---PVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAID---GPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVE-IEASDKRCVSQYAEKSSSN-VEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD*LT 5707
            +  +++ P G      ++++  G Y V F P E GT+   ++   K I GSPF++   P G  K    +  A     S +    ++   V+   AG G++   I    G   V+++  E +  ++  Y    PG+Y IN+ +GG           +  G+ S   V   EQ+S  E IE    + V Q  +    N   +I  + +  ++  L +             G +   +  P    ++ V++   +   +V Y  +E G+H ++V++  + + GSPF  HVD +T
Sbjct: 1350 INVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGS----QSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGK---------DIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTG-----------GNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSIT 1616          

HSP 16 Score: 66.6254 bits (161), Expect = 2.864e-10
Identity = 72/274 (26.28%), Postives = 110/274 (40.15%), Query Frame = 2
Query: 4886 GNMEPAIVQQIGDGQ-YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFT-YVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQ--ARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            G M   ++Q   DG  Y   + P + G +++ V    + +  SPF + VG  K     + A G GLS  ++   A F V T N  +G+L   + GPS+  + CH+  DG     Y  TA G Y ++I    N  I  SPF                               ++Q   ++  + E +   G GL++    +N   SF VD S+AG   L V +         V +K+  +    V Y       H + V +G    P SP  V+V
Sbjct:  496 GGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKES--SIVAYGPGLSSGVIGYPAAFVVET-NGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHI-LCDNEDIPKSPF-------------------------------IAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYV 734          

HSP 17 Score: 63.1586 bits (152), Expect = 3.251e-9
Identity = 73/290 (25.17%), Postives = 115/290 (39.66%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQ--YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLS-HAIVDKKAKFF-VNTSNAGSGSLNVAIDGP----SKVNMNCHETE-DGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQA--RLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++  +Q P+G +E A V+   D    Y V + P+  G+H V V+ + + I  SPF + V  +  D   V  +G G+  + +  KK  FF +   +AG G   V I  P    + V     + E D +   YV    G + +N+ Y G   I  SPF   V                                    S+  K+   G GL+    R+     F +    AG G   V + GP    + V+   V  N +   Y   + G ++IMV +  +++  SPF V V
Sbjct:  289 VDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGT-PIPNSPFPVKV---------------------------------APLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKV 544          

HSP 18 Score: 61.6178 bits (148), Expect = 9.144e-9
Identity = 70/270 (25.93%), Postives = 107/270 (39.63%), Query Frame = 2
Query: 4901 AIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGL--SHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETE-DG--YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            A V+Q+ +  +  ++     G H V V     PI  SPF + V    +D   V ASG GL  +   V   A F + T  AG G   V + GP  +N N  +++ DG  YE  Y  T  G Y+I +T+ G   +  SPF   V   K ++                                  I+  G GL    +    +F V+ +    G L   +AGP +   E+     G+    V Y     G + + +   ++DIP SPF+  +
Sbjct:  405 AKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPL-SDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQ-EVAKSPFEVKVGPKKESS----------------------------------IVAYGPGLSSGVIGYPAAFVVE-TNGETGALGFTVAGPSQ--AEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQI 635          

HSP 19 Score: 58.5362 bits (140), Expect = 7.605e-8
Identity = 62/264 (23.48%), Postives = 97/264 (36.74%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTS--NAGSGSLNVAIDGPSKVNMNCHETEDG----YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFF-VDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVH 5692
            DG   V +   + G + + +    K I GSPFR+ V     DP  V   G G+ H  V +    F N     AG G + V +     + ++    ED     Y   YV    G+ +          +  SPF   V      T                                 K+  +G+  K+    S+ + F +D  QAG   + V I  P     +  ++ V    + V +V  E GT+   +++GDK+I GSPF + 
Sbjct: 1176 DGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLV-EETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPT---------------------------------KVKVKGVNEKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLE 1405          

HSP 20 Score: 54.6842 bits (130), Expect = 1.208e-6
Identity = 64/248 (25.81%), Postives = 97/248 (39.11%), Query Frame = 2
Query: 4988 NKKPINGSPFRIPVGHYKADPGMVHASGEGLSH--AIVDKKAKFFVNTSNAGSGSLNVAIDGP------SKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVD--ASQAGYGILLVGIAGPVRPCEEVV--VKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            N K   G+P R      K +P  V A G G+     +V   A F V T +AG GS++V I GP      + V  N ++    Y  +Y+  + G++ + + + G   I  SPF   VEG+                                + +  K+   G G++   +      F D  A  AG G+  V I  P      V   V+ + N+ +  +YV    G H + V +    IP SPF V V
Sbjct:  239 NSKLKTGAPLRP-----KTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFN-NDKNLTYTVSYIPKSEGSHKVAVKFSGR-DIPKSPFPVKVEGH--------------------------------AGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKV 447          
BLAST of Filamin-A vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0337100)

HSP 1 Score: 784.252 bits (2024), Expect = 0.000e+0
Identity = 470/1194 (39.36%), Postives = 683/1194 (57.20%), Query Frame = 3
Query: 1245 SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHI---PQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQN-GQGTVKALVQSPSG-----KQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLR---PNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLI-DVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQE------VRETMTRSVQNQISNELASN----AFHGVNFE---INTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEI--PLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDS 4742
            S+KV  +G GLE+    + A F ID++ A    +GVTVEGP EA I+C DNGDGTC V Y     G YT+N+ ++  HI   P  P++VPV        +L     SG G+ P GV  +    F VD S+V  N   G +   +  P G     K   G  D++    + + YTP E G H I + Y+ +P+  SPF+V  K G +     A GPGL     N+K +F V+  GAG+G L LAIEGP++A++ C DN+DG+C V+Y     G+YDI+++F D+ I  SPF V V + V P KVK  GP  +   +R   P  F +D  EAG   + VK++    GI   PV   +VE      + V YVP + G  L   VK+++  +  SPF   V   ++  KVKV G   + +     AS+PA F ++TK AG   D+ V + NP G+ M   +E    G Y   +   + G ++ S+      +  SP+ +++ PTG  +KC +     K      +S + ++ +EAG G +TC   KI  +   ++  I V++          DG   + Y   + G+Y + VK+GG+ IPNG F   A  S ++      + E  T+ VQ    +EL +      +  V FE   + T  G   ++ A+V  PSG +++  I   DN    + + Y P E G H+L V   G P++GSPF+F VD+   G VTA+GPGL+ G T E A FTI TK A  GGL++ VEGPSK +I   DN DGT  V Y+P APG Y + ++F D+ I GSP+ A ITGE  K++Q++VG+ SE+  P  I   DL  L A +  PS ++ PC +K+M  G +G+SFTP+E GEHLV+V   G  I  SPFKV V   EVGDA KVKVSG GL++G  +  N F++DTR+AG+G L++SIEGPSKAEI C D ++G   + Y PTEPG Y++N+ +A  +V GSPF V V G+     + +K++R ++AV  T++G  C++  K+  +   DL   V +PS  TE  +I++  +G   + FV +E G+H VSV + + HI GSPFQFTVG +   GS  V A G GLE+G +    EF ++TREAG G++++++EGPSKA+++F++ +D GSC V+Y+V++PG+Y   +KFN  HI +SPF + V  D+
Sbjct:  929 SNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPV-------PNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDI----FRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTN-SEGI---PVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKG---VNEKKKTPASLPAEFEIDTKQAG-QADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTC---KITNKAGSEIVDIDVIEK---------DGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGG---NVTAEVRMPSGKVDKPVI--QDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEG-SNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKD-GSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA 2084          

HSP 2 Score: 224.172 bits (570), Expect = 0.000e+0
Identity = 120/283 (42.40%), Postives = 163/283 (57.60%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEI---EASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            +L+A +  PSG  +   +Q I    Y V+F PRE G H + V+ N   I  SPFRI VG   ADP  VHASG GL       KA F +NT NAG G+L V+IDGPSKV M+C E E+GY+  Y    PG + I + Y  N HIVGSPF     G+K A    QE     VE     A   +    +     S+  K++ +G+GLK+A +   N F + A+ AG  IL VG+ GP  PCEE  VKH G+N + V Y+V++ G ++++++WG++ IPGSPF + V
Sbjct: 2118 ELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKY-NNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2399          

HSP 3 Score: 447.588 bits (1150), Expect = 1.718e-127
Identity = 466/1682 (27.71%), Postives = 706/1682 (41.97%), Query Frame = 3
Query:   42 EVTYRPQECPNSKALHP-KVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLL-CEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPILSEQIKTLKAGNPH-------------------------------NPMQKANPGK------------SNKPYTALEEAIKEMKESA-VESSKWPQS-KPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGL-IDNLNNGKYVVRYTPTEEGP-HKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEK--------TQFVVDLDGAGHGSLGLAIEGPADAEIQ--CHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRP----------NHFTIDCSEAGKAPLEVKVS-KPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVV----QPAQVEKVKVDGDGIIPQ-------NGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYT--VKSMPTGNPEKCAIKAGKDKTIQVNKE-SVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQ------------VAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALK-----DLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAARAVSS 4775
            +VTY     P S   H  +V  GG   P SP  +      + +K       L+P V+      F V   +   +E  V +  +      P  +     NTY     P   G +  T +  G+   + P+   VV E   +V KIKV+GL P   + + Q F++++   +   DL  V + +P    I  H     +G  V F P + G + +       PI   P  ++ L  +D ++   +   P       + G V +P  F I  D          V V  P       +  +    G     ++P +AG Y++  + +   I GSP        PLI   P L     +     PH                               +PM    P K               P+ A    I+ M ++  V  S +  + K     ++   YG GLEK    +K  FT+++K A +  + + +EGP EA + C DN DG+C V Y    PG Y I + + + HIP SP  V V     + +D S V   GPG+    V +     F VD  E    G G +   + +  G   + L +++  N  Y V Y P + G      V +  + +  SPF++   P      V   G       VNEK         +F +D   AG   + +AI+ P    +Q    +   GT +V + P + G Y  S+K+ D++I  SPF +E             G  K  KL+            +H  +D  EAG   +  K++ K GS I D  V  K       G FD+ Y   + G   I+VK+    I    F    V    Q +  E ++     ++ Q       NG    +  +V            +V   +  P+G+     I+   +G  + +Y   + G H++ V  +G P+  SP+   V S+ +G         G   T  V  E +  TI TK A  G +T  V+   +  +                 ++ DG  SV Y+P   GEY V V++G + I    +F   T    E R+      +NQIS    S     V    +  D     LNA +  PSG  E  P         NI I + P E G H + V   G+ I  SPF+  V  +  G   +V   G GL  G T+    F++ T++AG GGLS+ +EGPSK EI+C D  DGT  +SY P  PG Y + +KF D  + GSPFT  + GE   + +              +G+  ++  K+P      L A +T+PS +     I+++ +G   V F PKE G H V+V      IPGSPF+  V       +  VK  G GLE+G+  +  EF + TR+AG GSL IS+EGPSKA+I+ KD ++G C V Y  TEPG Y + + +  +++P SPF V V  D     +  K+E VQ+  +     GN + +     M  K     +L   +  PSG  + C I+        ++F  RE+GIH + V     HI  SPF+  VG      +  V ASG GL++       +F I T  AG G ++V+++GPSK  M   E ++     V Y    PG++  ++K+N  HIV SPF +    D +    A+  S+
Sbjct:  703 KVTY----TPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQ---RVPLGEKVVVEQTVDVSKIKVDGLEPTAPLNSLQQFRIIT-HGLPKADLA-VTITSPSGNRIKAHIIPTAEGFLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKV--QAFGPGL-----ERGIVGQPAEFMI--DTRGAGQGGLGVTVEGPCEAA---INCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPF------QPLIVPVPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLV----EETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEA---GPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKG-------VNEKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPT---------GEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKD------GFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSG----YVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADI--------------NYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKIT---GEGRK------RNQISVGSCSE----VTMPGDITDDDLRALNASIQAPSGLEE--PCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA---GDAHKLE-VQQFPQ-----GNIQADAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAA-VHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEE--GYKVRYTPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETST 2283          

HSP 4 Score: 431.024 bits (1107), Expect = 3.966e-122
Identity = 446/1628 (27.40%), Postives = 708/1628 (43.49%), Query Frame = 3
Query:   24 KTPDLYEVTYRPQECPNSKALHP-KVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPN-VKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGTK-VTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEG-QVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPILSEQIKTLKAGNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTV---EGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFH-------XXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISD---RPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVIT---IETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLV-EVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSG-----CMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCED--NHDGTFKVSYVPQAPGNYNIIIKF--KDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLKIPSSDL-----------------------STLTAELTTPS-KIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINL--KIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            K   L   T+R +     + LH   V   G  IP SPF +      +  K   +   L+   V++     FK+      + EP V V    G+  + V+  KV  NTY+  Y PTK G+++I  +  G+ VAK+P  V V  +   ++      GL+  + +  P  F V   E       +   V  P    I  H     DG+  V + P   G +++     ++ I ++P I + LP+ D H  + K S P      EK G  +N+P SFT+  D +       DVVV      + +PV+ K  P G                  V   P  G P T+ V    + T                         P   ++ Y  +   +   K  A      P  +P+  +                    F +D+++A  A + V +   E   E     +DN D T  V    P  G YT  + Y    +P    VV       + +D+S +     GL P     +   +F +    +    +  +   + SPSG +    I     G ++V +TPT+ G + +++ + G PI   PF ++   G ++  V A GPGL    V +  +F++D  GAG G LG+ +EGP +A I C DN DGTC V Y P +AGDY +++ FN+  I+ SPF              V    ++  G I +A       F +D S+ G     +   K    I D     +  K V+G     F + Y P E G   I++ Y+  P+ GSPF  NV       + K  G G+  + G  L +    F V TK AG N  + + +  P+   M        +G    +Y   D G++ I++      +P SP+ V    T +P K  +     +  QV +ESV T   ++  EAG G+I          K+   E I V +   ++V++  + I +VHY+P + G  L  +VK+    +P   F  T  +   E  +   + V  +     +  A     FEI+TK     D+N  +  P G      +EEV   S   Y     + + P E G +Q  +    + I+GSPF+      GE    ++    P +   T+   +   +  ++AG G ++  +   + +EI   D    DG F + Y    PG+Y+I +KF  KD P       A  + E    S+    +++++  +   S+L                         +TAE+  PS K+  P VI+   +G + V + P+E G H + V   G  + GSPFK +V +   G    V   G GL  G+  +   FTI T+ A  G L +++EGPSKA+I+  DN++G  +V+YLPT PG Y ++V +  K++ GSP+   + G      E +K  ++        VG   E+ +   I +  L+ L  ++  PSG  EPC ++    GN+ I F  RE G H VSV    +HI  SPF+ TV     G +K V  SG GL++G    +N F++ TR AG G +SV++EGPSKAE++  + +D G+  ++Y+ ++PG Y  ++KF   H+  SPF + V
Sbjct:  406 KVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMN-QNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYG-PGLSSGV-IGYPAAFVV---ETNGETGALGFTVAGPSQAEIECHDNG--DGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGL----EKNGVTINQPTSFTV--DPSKAGNAPLDVVVQDVFGTK-LPVELKNNPDG---------------TKKVTYTPTSGVPHTVEVNYGGVST-------------------------PNSPHRVYVGV--PVDAAKVQAFGPWLQPGVRPNAATH-------------------FNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGEKVVV-----EQTVDVSKIKVD--GLEPTAPL-NSLQQFRIITHGLP---KADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKNTRVSGIGIQPHGVIMNAA----TDFMVDMSKVGS---NIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGL--EKG--LTNQKNKFTVETKGAG-NGGLSLAIEGPSEAKMTC--TDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQV-RESVPTFFNVDVGEAGPGRIAV--------KLTNSEGIPVDN---LRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMT-VFPKSEPTKVKVKGVNEKKKTPASLPA----EFEIDTKQAGQADINVAIKNPKGKAMQPRLEEV---STGTY----VVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQ--TSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKP-VIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSG---YVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITG------EGRKRNQI-------SVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTD-KDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKV 1887          

HSP 5 Score: 310.071 bits (793), Expect = 1.816e-84
Identity = 412/1671 (24.66%), Postives = 669/1671 (40.04%), Query Frame = 3
Query:   18 PTKTPDLYEVTYRPQECPNSK-ALHPKVTVGGEDIP-GSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIE---VCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTI--VKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKG--LLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQES--PLITE------EPILSEQ-----IKTLKAGNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKW-------PQSKPDQPS----------SKVIVYGKGLEKVAAKEK--AIFTIDSKDAPSAPIGVTVEGPGEAVIDCV---DNGDGTCGVVYEVPVPG-LYTINVLYDNVHIPQSPIVVPVYPKDN------KNLDLSTVT-ASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQ--LVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHD--NKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLR----------PNHFTIDCSEAGKAPL-------EVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVK-------------------------------------SMPTGNPEKCAIKAGKDKTIQVN------KESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASV----------------------------------HYMPKEEGEYLVEVKYGGQSIPNGKF-FQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFV---DTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANIT-----GEPVKKSQVAVGN-SSEIPLKI---PSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQK-----MERVQEAVKATQVGGNCEINLKIDE-------MALKD--------------------LKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV 4442
            P +  D  + TY  +  P SK A    +T GG+ +P G    +  T      K    ++ L+P   L   Q F++  +   K++  VT++  +G  ++  ++   +   +   +TPT+LG+++++    G P+   P  +  +     N    KV+   P +E   V  P  F + +  +      + V V  P    I        DGT  V ++P E G +++     ++ I  +P     +P  ++     K +  + + ++     +N    F +   K  +N D       +  P  H  +P K  + P        + P +AG +++    DN P+ GSP  + V+    P   +      E  L+ Q     ++T  AGN    +    P ++    T   +   ++   A +  ++        +  P  P           SKV VYG G+E    +E     F +D  +A    I V +       +D +   D G+    V Y  P  G + T  V +  V +P SP V+ V+PK        K ++    T AS P            A+F +D     Q GQ  +   +++P GK     ++ ++ G YVV + P E G ++ ++ Y    I+ SPF ++A P   A+   +    P + +     ++   VD   AG G++   I   A +EI   D   KDG   + Y     GDYDI+VKF  +DI +  F ++ V+ ++             K+++           +  T       K PL         +V  P SG  D+PV    ++    GT  V Y P E G   + VKYN  P+ GSPFK + V       V   G G+       +   PA F ++TK A     + + +  P+   +  H     +G  + +Y     G++++SV      +  SPY  K                                       P+G  E C +K      I ++       E +++++            V   ER+ VG  +++KV  +   + Q H D I SV                                   Y P E G Y+V +K+    +    F  + A       RE + R        E+ S                  DL A V  PS   E+  I   ++  +   + + P E G H + V      I GSPFQF V      G   V A G GL  G   E AEF + T++AG G L++ VEGPSK +I+ +D  DG+  VSY    PG Y + +KF D+ I  SPF   ++        ++  Q   GN  ++ P +     +     L A++  PS     C I+ ++     V F P+E G H ++V   G  IP SPF++ V  ++V D   V  SG GL++       +F I+T +AG G+L +SI+GPSK  +DC + E G   V+Y P  PG + I V Y   ++ GSPF VN  GDK+     Q+     +E VQ+  K  +  G      K D        M LK                     L V ++ P G  E   ++  G+ N  ++++ R+ G + + +   + HI GSPFQ  V
Sbjct:  788 PCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGEKVVVEQTVDVSKIK----VDGLEPTAPLNSLQQFRIITHGLPKADLAVTITSPSGNRIKAHIIP--TAEGFLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSN----KVQAFGPGLERGIVGQPAEFMIDT--RGAGQGGLGVTVEGPCEAAINCRDNG--DGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNL-----KNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHV-LPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKKTPASLP------------AEFEIDT---KQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTS--GSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMP-SGKVDKPV----IQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFH-VDSITSGYVTAYGPGLTHG----VTGEPANFTISTKGASAG-GLTMAVEGPSKADINYH--DNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCERE-VGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQC----KLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLY--AVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKV-GKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGY-KVRYTPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2399          

HSP 6 Score: 281.182 bits (718), Expect = 1.548e-75
Identity = 321/1211 (26.51%), Postives = 507/1211 (41.87%), Query Frame = 3
Query: 1245 SSKVIVYGKGLE--KVAAKEKAIFTIDSKDAPSAPIGVTVEGPGE------AVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPF--HXXXXXXXXXXXXXSKGPIKD---AKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGE-PMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSI-PNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFF---VDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAG----PGGLSL-------------IVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITG--EPVKKSQVAVG-------NSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQG--NEFTIDTRDAGYGSLNISI---EGPSKAEIDCKDNENGVCTVKYLPTEPGNYVI-NVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDK-GSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            +SKV V G G++   V  K+   F I +KDA      V +  P        A +  ++N    C   Y   + GL+++NV Y    IP SP  V V P      D   V ASG GL   GV     A F +        G+G  +  V  P G   N +   ++   Y   Y PT+EG + I VT+ G  +  SPF VK  P   + +V A GPGL S  +     FVV+ +G   G+LG  + GP+ AEI+CHDN DG+ LV+Y P   G+Y + +  ++EDI  SPF   +    +  PE VK+ GP  +     + +P  FT+D S+AG APL+V V       +  PV +K       GT  V Y P    P  ++V Y       SP +  V  P    KV+  G  + P    +  +    F+V+ ++AG + ++ V + +   +  +P  I    +  Y+ E      G +  ++   G  +P     V    T +  K  +  G + T  +N      I T    K  +  T+      +            IK  +    +G   V++ P + GEYL+ + +GG  I P     Q  T S     +     ++  I  + A        F I+T+      L   V  P     E  I   DN      + Y P+E G + + +    R I GSPFQ     V      RV+  G        N   +F +     G     G LS              IV+GP+          D  F++ Y P   G + I + + + P+ GSPF  N+    +P +      G         ++  ++   +    L+  +  PS+ K+ C   +  +G+  V +   + GE+ + +      IPGSPF+V V  EE  D +KVKV G G+E G   +     F +D  +AG G + + +   EG     +  +D  N +  V Y+P + G+ +   V ++   VP SPF + V   K  P +  K++ V E  K T      E  +   +    D+ V +  P G      +E+   G   + FV  E G +  S+ + D+ I GSPF+             +    P ++       +   +  REAG G ++  +   + +E+   +  +K G   + Y ++ PGDY+ ++KF G+ I N  F I
Sbjct:  354 ASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRC--EYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLS----DARKVRASGRGLQATGVRVGDDADFKI---YTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIV-AYGPGLSSGVIGYPAAFVVETNGE-TGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFG--TKLPVELKN---NPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQP---GVRPNAATHFNVDAREAG-DAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGEKVVVEQ-TVDVSKIKVD-GLEPTAPLNSLQQFRIITHGLPKADLAVTITSPSGNR------------IKAHIIPTAEGFL-VNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAE-------FMIDTRGAGQGGLGVTVEGPC----EAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPT----------DDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNR--DGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLV--EETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVF-PKSEPTKV-KVKGVNEK-KKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTS--GSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSI 1499          

HSP 7 Score: 253.447 bits (646), Expect = 3.849e-67
Identity = 373/1564 (23.85%), Postives = 634/1564 (40.54%), Query Frame = 3
Query:  336 TYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVE--GLAPM-IEVCAPQTFKVLSPEKVIN-PDLVDVQVLNPENKIIPIHKEAAPDGTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVV---QESPLITEEPILSEQIKTLKAG--------------NPHNPMQKANPGKSNKPYTALEE----AIKEMKESAV-ESSKWPQS--------KPDQPSSKVIVYGKGLEK--VAAKEKAIFTIDSKDAPSAPIGVTVEG--PGEAVIDCVDNGDGTCGVVYEVPVPGL-YTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH-SCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPD---VIVGLFNPNGEPMPLHIEARP-NGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKC-AIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFF----------QTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGP-HQLQVNSQGRPIKGSPFQFFVDTKGE-GRVTAFGPGLSSGTTNEV-AEFTIITKDAGPGGLSLIVEGPSKTEI--KCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFT--ANITGEPVKKSQV-------AVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNV-------KNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGY---------GSLNISIEGPSKAEID---CKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV-------GSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMK-FQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            TY  +Y P   G H +     G+ + K+P  V V      +  K+KV   G+ P  + +  P  F +L+ +     P+++ +   N +  +    ++   D  +  +V    G HS+  +    PI  +P  VK  P +D      +K   +   ++    +V     F I  +   +   + +V V+ P       ++SK       C + P K G Y ++ +     +  SP  + V   +ES ++   P LS  +    A                   P Q       N   +AL +    A+ E     + ++   P+S        + D     V   G GLEK  V   +   FT+D   A +AP+ V V+     +  ++  +N DGT  V Y  P  G+ +T+ V Y  V  P SP  V V       +D + V A GP L P GV  +    F VDA E   + +  VK + +    +    +IDN +N  Y V   P  +G +   +TY G   Q  P   K        +      GL  +  +N   QF +   G     L + I  P+   I+ H     +G  LV +TP + G+Y +S+ F    I+  PF ++ +      KV++ GP ++   + +P  F ID   AG+  L V V  P     +             GT +V Y+P E G   +++ +N+  I+GSPF+  +V    ++  +V G GI P    ++ +    F V+    G N D   +   +F+P G  +P  I   P + ++   Y   + G H I +  D  P+P SP+ V      +P +C A   G +K +  N+++  T+ETK AG G ++  ++       G  E        K+   ++ DG   V Y+  + GEY + +++  + IP   F           +   Y        +  SV    + ++       +  ++   +G+PVD N +V     C+  V               Y P + G     QV      +  SPF   V  K E  +V   G      T   + AEF I TK AG   +++ ++ P    +  + E+   GT+ VS+VP   G Y   IK+ D+ I GSPF   A  TGE  K   V         G+ S + +    +    +T ++T  +  ++  +     +G   + +   + G++ +NV   G DIP   F +          + E  +    KV  +  +  L N  +E T   R   +         G++   +  PS  ++D    +DN +G  +VKY P E G++ + V Y G+ V GSPF  +V+        +  +      +     G      +     +   L + V  PS      +  D  +G + ++++    G + VSV   D+HI+GSP+   +         ++ G   +VT  G        DI ++      +  A N S+  + PS  E   F +    G+  +++   + G++  S+K  G+HI NSPF + V
Sbjct:  314 TYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGH-AGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDA-----RKVRASGRGLQATGVRVGDDADFKIYTEGAGEG--EPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTY-TPTSGVPHTVEVNYGGVSTPNSPHRVYV----GVPVDAAKVQAFGPWLQP-GVRPNAATHFNVDAREAG-DAELKVKIIHEETKIEVPCRIIDNEDN-TYSVEVIPPSKGAYTTTMTYGG---QRVPLGEKVVVEQTVDVSKIKVDGLEPTAPLNSLQQFRIITHGLPKADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAIN-------CRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKNTRVSGIGIQPH--GVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGL-TNQKNKFTVETKGAGNGGLSLAIE-------GPSEA-------KMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVD-NLRVEDKGNCIYAV--------------HYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITY--RSVAFEKLPLPTTGGNVTAEVRMPS-GKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDS-----ITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPS--KADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPG--------DITDD------DLRALNASI--QAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTV 1792          

HSP 8 Score: 216.468 bits (550), Expect = 8.700e-56
Identity = 286/1130 (25.31%), Postives = 471/1130 (41.68%), Query Frame = 3
Query: 1503 PVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGK--QTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAK-PGFNAQLVTASGPGL--HSCKVNEKTQFVVDLDGAGHGSLGLAIEGPAD------AEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPN---HFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTK-DAGVNPDVIVGLFNPNGEPMPLHIEARPN--GLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKA---GKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLS-SGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCE--DNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTAN-ITGEPVKKSQV--------AVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFK------VNVKNEEVGDATKVKVSGKGLEKG--LANQGNEFTIDTRDAG----YGSLNISIEGPSKAEIDCKDNE---NGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV-GSVTPGGSKDVTASGPGLEKGFI--DINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSC--AVTYRVSQPGD-YECSIKFNGEHIVNSPFHIIV 4730
            P+ PK N N     V A GPG+ P G      A FTV   E    G+G+V   +Q P+G+  + +   +N  N  Y V Y P  EG HK+ V + G  I  SPF VK +    +A  V  +GPG+  +   + + T F +    AG G   + I  PA+      A+++  +N    C  EY     G + ++V +    I +SPF V+V       KV++ G    A  +R      F I    AG+   EV+V  PG    ++ V   +V+G    T++  Y P + G  +I V +    ++ SPF+   V P +   +   G G+   +G I    PA F V T  + G     + G       P    IE   N  G    +Y    VG++ + +  D   +PKSP+  + +P  +     +KA   G +K  + +N+ +  T++  +AG   +   V+ +   K            + V+++ +PDG   V Y P     + VEV YGG S PN        Y    V     ++    +   +  NA    +F ++ ++    +L  K++     + EVP    DN  +   ++  P  +G +   +   G+ +          T    ++     GL  +   N + +F IIT       L++ +  PS   IK       +G F V++ P   G Y + I F   PI   PF    +TG    K Q          VG  +E  +    +    L   +  P +  + C  +   +G   V++ P E G++ VN+      I GSPF+       N+KN         +VSG G++    + N   +F +D    G     G L+ +I  P    +  K  +   + +  + Y P E G + I + Y    VPGSPF VNV+      C+  + +     ++        +  ++        L + +  PS     C   D  +G+  + ++A + G + +++   D+HI GSPF+  V  +V P     V   GPG+E G +   +   F +   EAG G I+V +       +     +DKG+C  AV Y   + G    C +KF+   +  SPF + V
Sbjct:  247 PLRPKTNPN----RVRAYGPGIEPIGPVVGAPANFTV---ETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRC--EYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGG--MNQNVMQSKVDG---NTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVK-VGPKKESSIVAYGPGL--SSGVI--GYPAAFVVETNGETGALGFTVAG-------PSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTK------------LPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPH---RVYVGVPVDAAKVQAFGPWLQPGVRPNA--ATHFNVDAREAGDAELKVKIIHEETKI-EVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGEKVVVEQTVDVSKIKV--DGLEPTAPLNSLQQFRIITHGLPKADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINC--RDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKN--------TRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSG----CDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTC--TDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDP---SKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTV 1310          

HSP 9 Score: 137.117 bits (344), Expect = 1.234e-31
Identity = 96/309 (31.07%), Postives = 147/309 (47.57%), Query Frame = 2
Query: 4784 RENHREDAGGLISITVRAE--DGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQ-GLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            R+ ++   G    +T+  +  D ++  L AS+Q PSG  EP  ++++  G  G+ F+PRE G HLV V+   K IN SPF++ V   +  D   V  SG GL          F V+T NAG G L+V+I+GPSK  + C + +DG    +Y  T PG YI+N+ +  + H+ GSPFT  V G                  E S+++      E+ +  + +I  Q  L  K   + S +             L   +  P    E+  ++ V +  + V +V KE G H + VR+ +  IPGSPF   V
Sbjct: 1709 RKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKF-ADHHVEGSPFTVKVAG------------------EGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFD-------------LAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTV 1985          

HSP 10 Score: 112.464 bits (280), Expect = 3.290e-24
Identity = 60/160 (37.50%), Postives = 95/160 (59.38%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATN 5335
            + A V+ PSG ++  ++Q   DG   VK+ PRE G+H + V+ N +P+ GSPF+  V    +  G V A G GL+H +  + A F ++T  A +G L +A++GPSK ++N H+ +DG     Y+ TAPG Y +++ + G+ HI GSP+ A + G     N
Sbjct: 1556 VTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITS--GYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRF-GDKHIKGSPYFAKITGEGRKRN 1712          

HSP 11 Score: 111.309 bits (277), Expect = 8.095e-24
Identity = 89/286 (31.12%), Postives = 140/286 (48.95%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPA-IVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLN-SVNSFF-VDASQAGYGILLVGIAGPVR-PCEEVVVKHVGNNQFTVDYVVKESGTHII-MVRWGDKDIPGSPFMVHV 5695
            KL  ++  P G++ P+ IVQ   D  + + ++P E G H + +  +  P+ GSPF + V     DP    A G GL   + ++K KF V T  AG+G L++AI+GPS+  M C +  DG  +  Y+AT PG Y I I +  + HI GSPF  +VE                   E  D   V  Y              G G++  ++  SV +FF VD  +AG G + V +      P + + V+  GN  + V YV  ++G+ +   V++ + ++P SPF++ V
Sbjct: 1060 KLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNV-KSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRF-ADKHIPGSPFRVLVE-------------------ETVDPSKVKVY--------------GPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTV 1310          

HSP 12 Score: 108.997 bits (271), Expect = 4.468e-23
Identity = 83/282 (29.43%), Postives = 131/282 (46.45%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPG--MVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            L A V +PS   E A +Q++ DG Y V F P+E G H V V  ++  I GSPF+  VG  + D G  +V A G GL   +V + A+F V T  AG GSL ++++GPSK ++   + +DG  + +Y  T PG Y + + +  + HI  SPF   V  +    +  + +Q  Q  I+A                                ++   F V  + A  G L   I  P    ++  ++ +    ++V +  +E+G H I V++    IP SPF + V
Sbjct: 1929 LAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLR-DSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKF-NDRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQA--------------------------------DAPYQFMVRKNGA-KGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKV 2175          

HSP 13 Score: 102.834 bits (255), Expect = 3.292e-21
Identity = 83/294 (28.23%), Postives = 133/294 (45.24%), Query Frame = 2
Query: 4850 IPK--LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQ--ARLNSVNSFFVDASQAGYGI----LLVGIAGP---VRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            +PK  L  ++ +PSGN   A +    +G + V F+P + G +L+ +     PI   PFR+      +D   V A G GL   IV + A+F ++T  AG G L V ++GP +  +NC +  DG     Y+ T  G+Y +NIT+    HI GSPF  ++                                     N++     G+G++     +N+   F VD S+ G  I    L   I  P   V P +  +V+   ++ F + Y   E+G H I + + +  +PGSPF+V+V
Sbjct:  863 LPKADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQC-LTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITF-NERHITGSPFQPLI---------------------------------VPVPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSK--IVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNV 1118          

HSP 14 Score: 75.8702 bits (185), Expect = 4.028e-13
Identity = 82/290 (28.28%), Postives = 117/290 (40.34%), Query Frame = 2
Query: 4877 TPSGNMEPAI-VQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFR---IPVGHYKADPGMVHASGEGLSH--AIVDKKAKFFVNTSNAGS----GSLNVAIDGP------SKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            T  G  E AI  +  GDG   V + P E G + V +  N++ I GSPF+   +PV + K        SG G+     I++    F V+ S  GS    G L+ AI  P      SK+      T+D +   Y     G + I + Y  N  + GSPF   V                                 KS  +  +    G GL++   N  N F V+   AG G L + I GP     ++      +    VDY+  + G + I +R+ DK IPGSPF V V+
Sbjct:  965 TVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKN----TRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQG--PTDDIFRIMYTPFEAGRHTIELMYD-NIPVPGSPFVVNV---------------------------------KSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSE--AKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVE 1212          

HSP 15 Score: 71.2478 bits (173), Expect = 1.244e-11
Identity = 68/291 (23.37%), Postives = 125/291 (42.96%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRI---PVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAID---GPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVE-IEASDKRCVSQYAEKSSSN-VEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD*LT 5707
            +  +++ P G      ++++  G Y V F P E GT+   ++   K I GSPF++   P G  K    +  A     S +    ++   V+   AG G++   I    G   V+++  E +  ++  Y    PG+Y IN+ +GG           +  G+ S   V   EQ+S  E IE    + V Q  +    N   +I  + +  ++  L +             G +   +  P    ++ V++   +   +V Y  +E G+H ++V++  + + GSPF  HVD +T
Sbjct: 1350 INVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGS----QSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGK---------DIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTG-----------GNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSIT 1616          

HSP 16 Score: 66.6254 bits (161), Expect = 2.864e-10
Identity = 72/274 (26.28%), Postives = 110/274 (40.15%), Query Frame = 2
Query: 4886 GNMEPAIVQQIGDGQ-YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFT-YVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQ--ARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            G M   ++Q   DG  Y   + P + G +++ V    + +  SPF + VG  K     + A G GLS  ++   A F V T N  +G+L   + GPS+  + CH+  DG     Y  TA G Y ++I    N  I  SPF                               ++Q   ++  + E +   G GL++    +N   SF VD S+AG   L V +         V +K+  +    V Y       H + V +G    P SP  V+V
Sbjct:  496 GGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKES--SIVAYGPGLSSGVIGYPAAFVVET-NGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHI-LCDNEDIPKSPF-------------------------------IAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYV 734          

HSP 17 Score: 63.1586 bits (152), Expect = 3.251e-9
Identity = 73/290 (25.17%), Postives = 115/290 (39.66%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQ--YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLS-HAIVDKKAKFF-VNTSNAGSGSLNVAIDGP----SKVNMNCHETE-DGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQA--RLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++  +Q P+G +E A V+   D    Y V + P+  G+H V V+ + + I  SPF + V  +  D   V  +G G+  + +  KK  FF +   +AG G   V I  P    + V     + E D +   YV    G + +N+ Y G   I  SPF   V                                    S+  K+   G GL+    R+     F +    AG G   V + GP    + V+   V  N +   Y   + G ++IMV +  +++  SPF V V
Sbjct:  289 VDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGT-PIPNSPFPVKV---------------------------------APLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKV 544          

HSP 18 Score: 61.6178 bits (148), Expect = 9.144e-9
Identity = 70/270 (25.93%), Postives = 107/270 (39.63%), Query Frame = 2
Query: 4901 AIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGL--SHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETE-DG--YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            A V+Q+ +  +  ++     G H V V     PI  SPF + V    +D   V ASG GL  +   V   A F + T  AG G   V + GP  +N N  +++ DG  YE  Y  T  G Y+I +T+ G   +  SPF   V   K ++                                  I+  G GL    +    +F V+ +    G L   +AGP +   E+     G+    V Y     G + + +   ++DIP SPF+  +
Sbjct:  405 AKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPL-SDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQ-EVAKSPFEVKVGPKKESS----------------------------------IVAYGPGLSSGVIGYPAAFVVE-TNGETGALGFTVAGPSQ--AEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQI 635          

HSP 19 Score: 58.5362 bits (140), Expect = 7.605e-8
Identity = 62/264 (23.48%), Postives = 97/264 (36.74%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTS--NAGSGSLNVAIDGPSKVNMNCHETEDG----YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFF-VDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVH 5692
            DG   V +   + G + + +    K I GSPFR+ V     DP  V   G G+ H  V +    F N     AG G + V +     + ++    ED     Y   YV    G+ +          +  SPF   V      T                                 K+  +G+  K+    S+ + F +D  QAG   + V I  P     +  ++ V    + V +V  E GT+   +++GDK+I GSPF + 
Sbjct: 1176 DGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLV-EETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPT---------------------------------KVKVKGVNEKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLE 1405          

HSP 20 Score: 54.6842 bits (130), Expect = 1.208e-6
Identity = 64/248 (25.81%), Postives = 97/248 (39.11%), Query Frame = 2
Query: 4988 NKKPINGSPFRIPVGHYKADPGMVHASGEGLSH--AIVDKKAKFFVNTSNAGSGSLNVAIDGP------SKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVD--ASQAGYGILLVGIAGPVRPCEEVV--VKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            N K   G+P R      K +P  V A G G+     +V   A F V T +AG GS++V I GP      + V  N ++    Y  +Y+  + G++ + + + G   I  SPF   VEG+                                + +  K+   G G++   +      F D  A  AG G+  V I  P      V   V+ + N+ +  +YV    G H + V +    IP SPF V V
Sbjct:  239 NSKLKTGAPLRP-----KTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFN-NDKNLTYTVSYIPKSEGSHKVAVKFSGR-DIPKSPFPVKVEGH--------------------------------AGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKV 447          
BLAST of Filamin-A vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0303364)

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 549/1654 (33.19%), Postives = 826/1654 (49.94%), Query Frame = 3
Query:   45 VTYRPQECPNSKALHP-KVTVGGEDIPGSPFTIPFTKKDED-SKYIGTLEDLKPN-VKLQQPQTFKVKLNDGIKSEPCVTVSD-KNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGL---APMIEVCAPQTFKVLS-------PE-KVINPDLVDVQVLNPENKIIPIHKEAAPDGT--KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKG-LLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPILSEQIKTLKAGNPHNPMQ-------KANPGKS-NKPYTALEEAI------KEMKES-----------------AVESSKWPQSKPDQP----------SSKVIVYGKGLE-KVAAKEKAIFTIDSKDAPSAPIGVTV---EGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQN-GQGTVKALVQSPSG-----KQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLR---PNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLI-DVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQE------VRETMTRSVQNQISNELASN----AFHGVNFE---INTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEI--PLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDS 4742
            +TY     P S+  H   V   G DIP SPF +       D SK   T   ++PN V +++P  F +   D  +  P V + D  N        V+++  +T++  Y     G H +     G P+  +P  V V      +  K++  G    A  + V     FK+ +       PE +VI P  ++  V+           ++  DG   +  + P + G + I      Q + ++P  VK  PK        K+SS          G +  P +F +    TN +       V  P   +   ++      G  L ++ P   G Y++    DN  I  SP   + Q  P     P   E +K    G   N +          +P K+ N P   + + +       E+K +                  VE +    S P+ P          ++KV  +G  L+  V       F +D+++A  A + V +   E   E     +DN D T  V    P  G YT  + Y    +P    VV       + +D+S +   G  L P  V  +    F VD S+V  N   G +   +  P G     K   G  D++    + + YTP E G H I + Y+ +P+  SPF+V  K G +     A GPGL     N+K +F V+  GAG+G L LAIEGP++A++ C DN+DG+C V+Y     G+YDI+++F D+ I  SPF V V + V P KVK  GP  +   +R   P  F +D  EAG   + VK++    GI   PV   +VE      + V YVP + G  L   VK+++  +  SPF   V   ++  KVKV G   + +     AS+PA F ++TK AG   D+ V + NP G+ M   +E    G Y   +   + G ++ S+      +  SP+ +++ PTG  +KC +     K      +S + ++ +EAG G +TC   KI  +   ++  I V++          DG   + Y   + G+Y + VK+GG+ IPNG F   A  S ++      + E  T+ VQ    +EL +      +  V FE   + T  G   ++ A+V  PSG +++  I   DN    + + Y P E G H+L V   G P++GSPF+F VD+   G VTA+GPGL+ G T E A FTI TK A  GGL++ VEGPSK +I   DN DGT  V Y+P APG Y + ++F D+ I GSP+ A ITGE  K++Q++VG+ SE+  P  I   DL  L A +  PS ++ PC +K+M  G +G+SFTP+E GEHLV+V   G  I  SPFKV V   EVGDA KVKVSG GL++G  +  N F++DTR+AG+G L++SIEGPSKAEI C D ++G   + Y PTEPG Y++N+ +A  +V GSPF V V G+     + +K++R ++AV  T++G  C++  K+  +   DL   V +PS  TE  +I++  +G   + FV +E G+H VSV + + HI GSPFQFTVG +   GS  V A G GLE+G +    EF ++TREAG G++++++EGPSKA+++F++ +D GSC V+Y+V++PG+Y   +KFN  HI +SPF + V  D+
Sbjct:  343 LTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPL--SDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVM-----------QSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPK--------KESSIVAYGPGLSSGVIGYPAAFVV---ETNGETGALGFTVAGPSQAE---IECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSP--FIAQILPRTDFHP---ELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGEKVVV-----EQTVDVSKIKVDG--LEPS-VIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDI----FRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTN-SEGI---PVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKG---VNEKKKTPASLPAEFEIDTKQAG-QADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTC---KITNKAGSEIVDIDVIEK---------DGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGG---NVTAEVRMPSGKVDKPVI--QDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEG-SNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKD-GSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA 1925          

HSP 2 Score: 224.172 bits (570), Expect = 0.000e+0
Identity = 120/283 (42.40%), Postives = 163/283 (57.60%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEI---EASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            +L+A +  PSG  +   +Q I    Y V+F PRE G H + V+ N   I  SPFRI VG   ADP  VHASG GL       KA F +NT NAG G+L V+IDGPSKV M+C E E+GY+  Y    PG + I + Y  N HIVGSPF     G+K A    QE     VE     A   +    +     S+  K++ +G+GLK+A +   N F + A+ AG  IL VG+ GP  PCEE  VKH G+N + V Y+V++ G ++++++WG++ IPGSPF + V
Sbjct: 1959 ELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKY-NNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2240          

HSP 3 Score: 431.409 bits (1108), Expect = 2.249e-122
Identity = 371/1233 (30.09%), Postives = 554/1233 (44.93%), Query Frame = 3
Query: 1248 SKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGL-IDNLNNGKYVVRYTPTEEGP-HKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEK--------TQFVVDLDGAGHGSLGLAIEGPADAEIQ--CHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRP----------NHFTIDCSEAGKAPLEVKVS-KPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVV----QPAQVEKVKVDGDGIIPQ-------NGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYT--VKSMPTGNPEKCAIKAGKDKTIQVNKE-SVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQ------------VAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALK-----DLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAARAVSS 4775
            ++   YG GLEK    +K  FT+++K A +  + + +EGP EA + C DN DG+C V Y    PG Y I + + + HIP SP  V V     + +D S V   GPG+    V +     F VD  E    G G +   + +  G   + L +++  N  Y V Y P + G      V +  + +  SPF++   P      V   G       VNEK         +F +D   AG   + +AI+ P    +Q    +   GT +V + P + G Y  S+K+ D++I  SPF +E             G  K  KL+            +H  +D  EAG   +  K++ K GS I D  V  K       G FD+ Y   + G   I+VK+    I    F    V    Q +  E ++     ++ Q       NG    +  +V            +V   +  P+G+     I+   +G  + +Y   + G H++ V  +G P+  SP+   V S+ +G         G   T  V  E +  TI TK A  G +T  V+   +  +                 ++ DG  SV Y+P   GEY V V++G + I    +F   T    E R+      +NQIS    S     V    +  D     LNA +  PSG  E  P         NI I + P E G H + V   G+ I  SPF+  V  +  G   +V   G GL  G T+    F++ T++AG GGLS+ +EGPSK EI+C D  DGT  +SY P  PG Y + +KF D  + GSPFT  + GE   + +              +G+  ++  K+P      L A +T+PS +     I+++ +G   V F PKE G H V+V      IPGSPF+  V       +  VK  G GLE+G+  +  EF + TR+AG GSL IS+EGPSKA+I+ KD ++G C V Y  TEPG Y + + +  +++P SPF V V  D     +  K+E VQ+  +     GN + +     M  K     +L   +  PSG  + C I+        ++F  RE+GIH + V     HI  SPF+  VG      +  V ASG GL++       +F I T  AG G ++V+++GPSK  M   E ++     V Y    PG++  ++K+N  HIV SPF +    D +    A+  S+
Sbjct:  966 ARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLV----EETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEA---GPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKG-------VNEKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPT---------GEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKD------GFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSG----YVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADI--------------NYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKIT---GEGRK------RNQISVGSCSE----VTMPGDITDDDLRALNASIQAPSGLEE--PCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA---GDAHKLE-VQQFPQ-----GNIQADAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAA-VHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEE--GYKVRYTPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETST 2124          

HSP 4 Score: 305.064 bits (780), Expect = 6.442e-83
Identity = 384/1591 (24.14%), Postives = 626/1591 (39.35%), Query Frame = 3
Query:   42 EVTYRPQECPNSKALHP-KVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIEVCAPQTFKVLSPEKVINPDL--VDVQVLNPENKIIPIHKEAAP--DGTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQES----------------------------------------PLITEEPILSEQIKTLKAGNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQPSSKVIVYG-KGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGP-GEAVIDCVDNGDGTCGVVYEVPVP-GLYTINVLYDNVHIPQSPIVVPVYPK-DNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSL-GLAIE--------GPADAEIQC----------HDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPF---------KTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPY--TVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKF-FQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFV---DTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANIT-----GEPVKKSQVAVGN-SSEIPLKI---PSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQK-----MERVQEAVKATQVGGNCEINLKIDE-------MALKD--------------------LKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV 4442
            +VTY     P S   H  +V  GG   P SP  +      + +K       L+P V+      F V   +   +E  V +  +      P  +     NTY     P   G +  T +  G+   + P+   VV E   +V KIKV+GL P + + A   F V   +   N D   +   + +P   ++P      P  D  ++ + P E G H+I     + P+  +P +V    K+    A  K   P       ++G  N+   FT+      +      + +  P   +     ++        +++    G Y +     +  I GSP  ++V+E+                                         L   E I  + ++    GN    +    P   +     ++ +  E+  S    + +P+S+P    +KV V G    +K  A   A F ID+K A  A I V ++ P G+A+   ++       VV  VP   G Y  ++ Y +  I  SP  +  +P  + K   L       P +   G      +   VDA E    G G V   + + +G +   +     +G + + Y   + G + INV + G  I +  F +KA      Q   +     H+ KV ++T     ++G    +   +A E        G   AE++            DN+DGT  V+Y P + G +++ VK+N E +  SPF   V              +       P +FTI    A    L + V  P     +             GT  V Y+P   G   + V++    I GSP+         K N +      +V + GD       A+ AS+ A                     P+G   P  ++  P G     +   ++G+H +SV   G  +  SP+  TV     G+ +K  +     K  Q + +++ +++T+ AG G ++ +++   + ++              +  +  DG  ++ Y P E G Y+V +K+    +    F  + A       RE + R        E+ S                  DL A V  PS   E+  I   ++  +   + + P E G H + V      I GSPFQF V      G   V A G GL  G   E AEF + T++AG G L++ VEGPSK +I+ +D  DG+  VSY    PG Y + +KF D+ I  SPF   ++        ++  Q   GN  ++ P +     +     L A++  PS     C I+ ++     V F P+E G H ++V   G  IP SPF++ V  ++V D   V  SG GL++       +F I+T +AG G+L +SI+GPSK  +DC + E G   V+Y P  PG + I V Y   ++ GSPF VN  GDK+     Q+     +E VQ+  K  +  G      K D        M LK                     L V ++ P G  E   ++  G+ N  ++++ R+ G + + +   + HI GSPFQ  V
Sbjct:  733 KVTY----TPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQ---RVPLGEKVVVEQTVDVSKIKVDGLEPSVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNV--KSGCDPARCKAYGPGL-----EKGLTNQKNKFTVETKGAGNG--GLSLAIEGPSEAKMTCTDNRD--GSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEP----TKVKVKGVNEKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKL---VEQAPKIQTSG----SQSHLKVDAREA---GDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIE-QYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADIN-------YHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQA---------------------PSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEI--------------QCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQC----KLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLY--AVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKV-GKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGY-KVRYTPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2240          

HSP 5 Score: 233.417 bits (594), Expect = 5.803e-61
Identity = 410/1679 (24.42%), Postives = 665/1679 (39.61%), Query Frame = 3
Query:  111 EDIPGSPFT---IPFTK-KDEDSKYIG-TLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEG--LAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKI-IPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQ--PINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTI--VKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKG--LLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQES--PLITE------EPILSEQ-----IKTLKAGNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKWP-------QSKPDQPS----------SKVIVYGKGLEKVAAKEK--AIFTIDSKDAPSAPIGVTVEGPGEAVIDCV---DNGDGTCGVVYEVPVPG-LYTINVLYDNVHIPQSPIVVPVYPKDN------KNLDLSTVT-ASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQL--VTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHD--NKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLR----------PNHFTIDCSEAGKAPL-------EVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQIT---CTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVN-FEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGR----VTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKT--EIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI-----TGEPVKKS------QVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCK----DNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQF---------------------TVGSVTPGG-------------SKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQ-ESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            EDIP SPF    +P T    E  K  G  LE  K  V + QP +F V  +    +   V V D  G  + PV +K     T + TYTPT    H +  +  G     +P  V V   +P +  K++  G  L P +   A   F V + E       + V++++ E KI +P       D T  V  +P   G ++       Q  P+ E   + +++   D+ +       P+ +        +N    F +   K  +N D       +  P  H  +P K  + P        + P +AG +++    DN P+ GSP  + V+    P   +      E  L+ Q     ++T  AGN    +    P ++    T   +   ++   A +  ++        +  P  P           SKV VYG G+E    +E     F +D  +A    I V +       +D +   D G+    V Y  P  G + T  V +  V +P SP V+ V+PK        K ++    T AS P            A+F +D     Q GQ  +   +++P GK     ++ ++ G YVV + P E G ++ ++ Y    I+ SPF ++A P   A+   +    P + +     ++   VD   AG G++   I   A +EI   D   KDG   + Y     GDYDI+VKF  +DI +  F ++ V+ ++             K+++           +  T       K PL         +V  P SG  D+PV    ++    GT  V Y P E G   + VKYN  P+ GSPFK +V        V   G G+       +   PA F ++TK A     + + +  P+   +  H     +G  + +Y     G++++SV      +  SPY  K    G          K   I V   S +T+       G IT           Q    +E+   L  +       P G   + + P+E GE+LV VK  G+ I N  F    T   +EV +     V       L     H  N F ++T++     L+  +  PS    E+  T  D+    + I Y+P+E G + + +      ++GSPF   V  +G  R    +      +         + T          L+  V  PS    + + ++  DG + V +VP+  G + + +++ +  I GSPF   +     +G  + K+      +  VG ++E  +    +   +L   +  PSK  +    K   +G+  VS+   E GE+ V +      IP SPFKV V + + GDA K++V         A+   +F +  ++   G L+  I  PS  + DC     D E  + +V++ P E G + I+V + G ++P SPF + V  D   P          + VK    G   +  +      +  L V++  PS     C   + G    ++++     G H+++V + + HI GSPF+                      TV  V  GG             +  V + G GL+K +I   N+F+I   +AG   + V M GP     +F  +     +  V Y V   G Y   IK+  EHI  SPF I V
Sbjct:  654 EDIPKSPFIAQILPRTDFHPELVKASGPGLE--KNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKL-PVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVG--VPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREA--GDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGEKVVVEQTV---DVSKIKVDGLEPSVI--------MNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHV-LPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKKTPASLP------------AEFEIDTK---QAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTS--GSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMP-SGKVDKPV----IQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHV-DSITSGYVTAYGPGLTHG----VTGEPANFTISTKGASAG-GLTMAVEGPSKADINYH--DNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGR---------KRNQISVGSCSEVTM------PGDITDDDLRALNASIQAPSGLEEPCFLKRM-------PTGNIGISFTPREIGEHLVSVKRLGKHINNSPF--KVTVCEREVGDAKKVKVS---GTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKA--EIQCTDKDD--GTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIE--FKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYV-SPDAGDAHKLEVQQFPQGNIQADAPYQFMV-RKNGAKGELDAKIVAPSGTDDDCFIQVIDGE--MYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKT---GHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEG---YKVRYTPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2240          

HSP 6 Score: 224.557 bits (571), Expect = 2.565e-58
Identity = 281/1128 (24.91%), Postives = 479/1128 (42.46%), Query Frame = 3
Query: 1503 PVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGK--QTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAK-PGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIEGPAD------AEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPN---HFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTK-DAGVNPDVIVGLFNPNGEPMPLHIEARPN--GLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKA---GKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPI---KGSPFQFFVDTKGEGRVTAFGPG-LSSGTTNEVAEFTIITKDAGPGGLSL-------------IVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITG--EPVKKSQVAVG-------NSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQG--NEFTIDTRDAGYGSLNISI---EGPSKAEIDCKDNENGVCTVKYLPTEPGNYVI-NVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDK-GSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            P+ PK N N     V A GPG+ P G      A FTV   E    G+G+V   +Q P+G+  + +   +N  N  Y V Y P  EG HK+ V + G  I  SPF VK +    +A  V  +GPG+      + + T F +    AG G   + I  PA+      A+++  +N    C  EY     G + ++V +    I +SPF V+V       KV++ G    A  +R      F I    AG+   EV+V  PG    ++ V   +V+G    T++  Y P + G  +I V +    ++ SPF+   V P +   +   G G+   +G I    PA F V T  + G     + G       P    IE   N  G    +Y    VG++ + +  D   +PKSP+  + +P  +     +KA   G +K  + +N+ +  T++  +AG   +   V+ +   K            + V+++ +PDG   V Y P     + VEV YGG S PN        Y    V     ++    +   +  NA    +F ++ ++    +L  K++     + EVP    DN  +   ++  P  +G +   +   G+ +   +    +  VD   + +V    P  + +  T+ + + + +  +   G LS              IV+GP+          D  F++ Y P   G + I + + + P+ GSPF  N+    +P +      G         ++  ++   +    L+  +  PS+ K+ C   +  +G+  V +   + GE+ + +      IPGSPF+V V  EE  D +KVKV G G+E G   +     F +D  +AG G + + +   EG     +  +D  N +  V Y+P + G+ +   V ++   VP SPF + V   K  P +  K++ V E  K T      E  +   +    D+ V +  P G      +E+   G   + FV  E G +  S+ + D+ I GSPF+             +    P ++       +   +  REAG G ++  +   + +E+   +  +K G   + Y ++ PGDY+ ++KF G+ I N  F I
Sbjct:  277 PLRPKTNPN----RVRAYGPGIEPIGPVVGAPANFTV---ETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRC--EYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGG--MNQNVMQSKVDG---NTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVK-VGPKKESSIVAYGPGL--SSGVI--GYPAAFVVETNGETGALGFTVAG-------PSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTK------------LPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPH---RVYVGVPVDAAKVQAFGPWLQPGVRPNA--ATHFNVDAREAGDAELKVKIIHEETKI-EVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGEKVVVEQTVDVS-KIKVDGLEPSVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPT----------DDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNR--DGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLV--EETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVF-PKSEPTKV-KVKGVNEK-KKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTS--GSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSI 1340          

HSP 7 Score: 137.502 bits (345), Expect = 9.754e-32
Identity = 96/309 (31.07%), Postives = 147/309 (47.57%), Query Frame = 2
Query: 4784 RENHREDAGGLISITVRAE--DGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQ-GLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            R+ ++   G    +T+  +  D ++  L AS+Q PSG  EP  ++++  G  G+ F+PRE G HLV V+   K IN SPF++ V   +  D   V  SG GL          F V+T NAG G L+V+I+GPSK  + C + +DG    +Y  T PG YI+N+ +  + H+ GSPFT  V G                  E S+++      E+ +  + +I  Q  L  K   + S +             L   +  P    E+  ++ V +  + V +V KE G H + VR+ +  IPGSPF   V
Sbjct: 1550 RKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKF-ADHHVEGSPFTVKVAG------------------EGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFD-------------LAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTV 1826          

HSP 8 Score: 134.035 bits (336), Expect = 9.327e-31
Identity = 135/490 (27.55%), Postives = 217/490 (44.29%), Query Frame = 3
Query: 3345 RVTAFGPGLS--SGTTNEVAEFTIITKDAGPGGLSLIVEGPS----KTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIP----LKIPS-SDLSTLTAELTTPS---------KIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGN--EFTIDTRDAGYGSLNISIEGPSKAEIDCKDN--ENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINN--EFAIYTREAGAGNISVAMEG--PSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            RV A+GPG+          A FT+ T  AG G + + ++GP+    K +++  ++ + T+ VSY+P++ G++ + +KF  + I  SPF   + G     S+V V      P    +K P+  D+    A    P          K  V   ++++ N      +     G H VNV+  GT IP SPF V V    + DA KV+ SG+GL+      G+  +F I T  AG G   + + GP     +   +  +       Y PT+ G YVI VT+AG+ V  SPF V     KV P +   +      + +  +G      ++ +      L   V  PS     C   D G+G+  +K+     G + V +L  +  I  SPF   +   T    + V ASGPGLEK  + IN    F +   +AG   + V ++    +K  ++ + + D G+  VTY  +    +   + + G    NSP  + V
Sbjct:  286 RVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVA--PLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEV-----KVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNG-ETGALGFTVAGPSQAEIEC--HDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPD-GTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYV 764          

HSP 9 Score: 112.849 bits (281), Expect = 2.529e-24
Identity = 60/160 (37.50%), Postives = 95/160 (59.38%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATN 5335
            + A V+ PSG ++  ++Q   DG   VK+ PRE G+H + V+ N +P+ GSPF+  V    +  G V A G GL+H +  + A F ++T  A +G L +A++GPSK ++N H+ +DG     Y+ TAPG Y +++ + G+ HI GSP+ A + G     N
Sbjct: 1397 VTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITS--GYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRF-GDKHIKGSPYFAKITGEGRKRN 1553          

HSP 10 Score: 111.309 bits (277), Expect = 8.219e-24
Identity = 89/286 (31.12%), Postives = 140/286 (48.95%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPA-IVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLN-SVNSFF-VDASQAGYGILLVGIAGPVR-PCEEVVVKHVGNNQFTVDYVVKESGTHII-MVRWGDKDIPGSPFMVHV 5695
            KL  ++  P G++ P+ IVQ   D  + + ++P E G H + +  +  P+ GSPF + V     DP    A G GL   + ++K KF V T  AG+G L++AI+GPS+  M C +  DG  +  Y+AT PG Y I I +  + HI GSPF  +VE                   E  D   V  Y              G G++  ++  SV +FF VD  +AG G + V +      P + + V+  GN  + V YV  ++G+ +   V++ + ++P SPF++ V
Sbjct:  901 KLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNV-KSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRF-ADKHIPGSPFRVLVE-------------------ETVDPSKVKVY--------------GPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTV 1151          

HSP 11 Score: 108.997 bits (271), Expect = 4.034e-23
Identity = 83/282 (29.43%), Postives = 131/282 (46.45%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPG--MVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            L A V +PS   E A +Q++ DG Y V F P+E G H V V  ++  I GSPF+  VG  + D G  +V A G GL   +V + A+F V T  AG GSL ++++GPSK ++   + +DG  + +Y  T PG Y + + +  + HI  SPF   V  +    +  + +Q  Q  I+A                                ++   F V  + A  G L   I  P    ++  ++ +    ++V +  +E+G H I V++    IP SPF + V
Sbjct: 1770 LAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLR-DSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKF-NDRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQA--------------------------------DAPYQFMVRKNGA-KGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKV 2016          

HSP 12 Score: 71.2478 bits (173), Expect = 1.114e-11
Identity = 68/291 (23.37%), Postives = 125/291 (42.96%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRI---PVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAID---GPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVE-IEASDKRCVSQYAEKSSSN-VEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD*LT 5707
            +  +++ P G      ++++  G Y V F P E GT+   ++   K I GSPF++   P G  K    +  A     S +    ++   V+   AG G++   I    G   V+++  E +  ++  Y    PG+Y IN+ +GG           +  G+ S   V   EQ+S  E IE    + V Q  +    N   +I  + +  ++  L +             G +   +  P    ++ V++   +   +V Y  +E G+H ++V++  + + GSPF  HVD +T
Sbjct: 1191 INVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGS----QSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGK---------DIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTG-----------GNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSIT 1457          

HSP 13 Score: 66.6254 bits (161), Expect = 2.698e-10
Identity = 72/274 (26.28%), Postives = 110/274 (40.15%), Query Frame = 2
Query: 4886 GNMEPAIVQQIGDGQ-YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFT-YVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQ--ARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            G M   ++Q   DG  Y   + P + G +++ V    + +  SPF + VG  K     + A G GLS  ++   A F V T N  +G+L   + GPS+  + CH+  DG     Y  TA G Y ++I    N  I  SPF                               ++Q   ++  + E +   G GL++    +N   SF VD S+AG   L V +         V +K+  +    V Y       H + V +G    P SP  V+V
Sbjct:  526 GGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKE--SSIVAYGPGLSSGVIGYPAAFVVET-NGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHI-LCDNEDIPKSPF-------------------------------IAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYV 764          

HSP 14 Score: 64.3142 bits (155), Expect = 1.278e-9
Identity = 92/346 (26.59%), Postives = 143/346 (41.33%), Query Frame = 3
Query:   24 KTPDLYEVTYRPQECPNSKALHP-KVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPN-VKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVE--GLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGTK-VTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEG-QVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGL-LCEFIPKKAGPYSLVASVDNNPIKGSPQTIVV 1040
            K   L   T+R +     + LH   V   G  IP SPF +      +  K   +   L+   V++     FK+      + EP V V    G+  + V+  KV  NTY+  Y PTK G+++I  +  G+ VAK+P  V V    P+    I     GL+  + +  P  F V   E       +   V  P    I  H     DG+  V + P   G +++     ++ I ++P I + LP+ D H  + K S P      EK G  +N+P SFT+  D +       DVVV      + +PV+ K  P G     + P    P+++  +        SP  + V
Sbjct:  436 KVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMN-QNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVG---PKKESSIVAYGPGLSSGV-IGYPAAFVV---ETNGETGALGFTVAGPSQAEIECHDNG--DGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGL----EKNGVTINQPTSFTV--DPSKAGNAPLDVVVQDVFGTK-LPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYV 764          

HSP 15 Score: 63.5438 bits (153), Expect = 2.657e-9
Identity = 73/290 (25.17%), Postives = 115/290 (39.66%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQ--YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLS-HAIVDKKAKFF-VNTSNAGSGSLNVAIDGP----SKVNMNCHETE-DGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQA--RLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++  +Q P+G +E A V+   D    Y V + P+  G+H V V+ + + I  SPF + V  +  D   V  +G G+  + +  KK  FF +   +AG G   V I  P    + V     + E D +   YV    G + +N+ Y G   I  SPF   V                                    S+  K+   G GL+    R+     F +    AG G   V + GP    + V+   V  N +   Y   + G ++IMV +  +++  SPF V V
Sbjct:  319 VDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGT-PIPNSPFPVKV---------------------------------APLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKV 574          

HSP 16 Score: 62.003 bits (149), Expect = 8.061e-9
Identity = 70/270 (25.93%), Postives = 107/270 (39.63%), Query Frame = 2
Query: 4901 AIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGL--SHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETE-DG--YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            A V+Q+ +  +  ++     G H V V     PI  SPF + V    +D   V ASG GL  +   V   A F + T  AG G   V + GP  +N N  +++ DG  YE  Y  T  G Y+I +T+ G   +  SPF   V   K ++                                  I+  G GL    +    +F V+ +    G L   +AGP +   E+     G+    V Y     G + + +   ++DIP SPF+  +
Sbjct:  435 AKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPL-SDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQ-EVAKSPFEVKVGPKKESS----------------------------------IVAYGPGLSSGVIGYPAAFVVE-TNGETGALGFTVAGPSQ--AEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQI 665          

HSP 17 Score: 58.9214 bits (141), Expect = 6.064e-8
Identity = 62/264 (23.48%), Postives = 97/264 (36.74%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTS--NAGSGSLNVAIDGPSKVNMNCHETEDG----YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFF-VDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVH 5692
            DG   V +   + G + + +    K I GSPFR+ V     DP  V   G G+ H  V +    F N     AG G + V +     + ++    ED     Y   YV    G+ +          +  SPF   V      T                                 K+  +G+  K+    S+ + F +D  QAG   + V I  P     +  ++ V    + V +V  E GT+   +++GDK+I GSPF + 
Sbjct: 1017 DGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLV-EETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPT---------------------------------KVKVKGVNEKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLE 1246          

HSP 18 Score: 57.3806 bits (137), Expect = 1.677e-7
Identity = 57/213 (26.76%), Postives = 82/213 (38.50%), Query Frame = 2
Query: 5090 IVDKKAKFFVNTSNAGS----GSLNVAIDGP------SKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            I++    F V+ S  GS    G L+ AI  P      SK+      T+D +   Y     G + I + Y  N  + GSPF   V                                 KS  +  +    G GL++   N  N F V+   AG G L + I GP     ++      +    VDY+  + G + I +R+ DK IPGSPF V V+
Sbjct:  879 IMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQG--PTDDIFRIMYTPFEAGRHTIELMYD-NIPVPGSPFVVNV---------------------------------KSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSE--AKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVE 1053          

HSP 19 Score: 54.6842 bits (130), Expect = 1.112e-6
Identity = 63/247 (25.51%), Postives = 99/247 (40.08%), Query Frame = 2
Query: 4988 NKKPINGSPFRIPVGHYKADPGMVHASGEGLSH--AIVDKKAKFFVNTSNAGSGSLNVAIDGPS----KVNMNCHETED-GYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVD--ASQAGYGILLVGIAGPVRPCEEVV--VKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            N K   G+P R      K +P  V A G G+     +V   A F V T +AG GS++V I GP+    K ++  +  ++  Y  +Y+  + G++ + + + G   I  SPF   VEG+                                + +  K+   G G++   +      F D  A  AG G+  V I  P      V   V+ + N+ +  +YV    G H + V +    IP SPF V V
Sbjct:  269 NSKLKTGAPLRP-----KTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGR-DIPKSPFPVKVEGH--------------------------------AGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKV 477          
BLAST of Filamin-A vs. Ensembl Zebrafish
Match: flna (filamin A, alpha (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-030131-2145])

HSP 1 Score: 817.379 bits (2110), Expect = 0.000e+0
Identity = 586/1677 (34.94%), Postives = 856/1677 (51.04%), Query Frame = 3
Query:   42 EVTYRPQECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVK-----LQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPM-IEVCAPQTFKVLSPEK--------------VINPDLVDVQ--VLNPENKIIPIHKEAAPDGTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTI--------------VKDNTNDDIHDFDVVVLSPDNH------QPIPVKSKKLPKGLLCEF----IPKKAGPYSLVASVDNNPIK----GSPQTIVVQESPLITEEPILSEQIKTLKAGNPHNPMQ--KANPGKSNKPYTALEEAIKEMK-----ESAVESSKWPQS-------KPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTV--EGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXX--XXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAG---------KDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYS-----FQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDL-----------NAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGE-PVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV---EDDSIKPVAARAVSSSF 4781
            +V Y P E P   A+H  V    EDI  SPF            Y   ++   P ++     + +P  F V    G K+   +   D++G PV+ V VK     TY  +YTP K  +H +  S  G  + ++P  +++      N  K+   G+A   ++   P  F V   E               V+ P   D+   ++  +N           D   V + P   G ++I     DQ I  TP  +K  P    H+A   K+    L+    E  +NKP  FT+                 N  D + DFD++    DNH      +  PV+   +  GL   +    IPK     ++  S+D + +K    GS  T+   +   +  +    +     K   P       K  PG S  P T+    I   K     E   + +  P S        P  PS KV   G GLE+    E   F +D  +A  A + + +  +   EA +   DNGDGT  + Y    PG YT+ + Y +  +P  P  + V P     ++ S V   GPG+  +GVF++    FTVDA  +++ G   +K  + +PSG +T  LI +L +G Y V YTP EEG H + V Y+  P+  SPF V    G +   V   GPGL S   N+  +F V+  GAG G LGLA+EGP++A++ C DNKDG+C VEY P + G Y+++V +  + I+ SPF V V D V     K + +G   + +   P  F++D S+AG APL+V+V  P  G+    V   +V      T  V YVP   GP  I+V Y    I  SP+K  V+      KV+  G G+      + AS+P  F ++ KDAG    + V + +P+G+P   +I    +G Y   Y     G + I +   G  +P SPY ++++PTG+  KC +               TIQ+ +++VIT++ K AGKG++TCTV   +  +V             V V E+ DG   + Y   + G+Y++ V++GG+ IPN  F  TA          +  + +  +    +    A++   G+N  ++     P DL              V  PSG + +  IT  DN    + + Y P+E G H++ +   G  I GSP QF+VD    G VTA+GPGL  G  N+ A FT+ TKDAG GGLSL +EGPSK +I C DN DGT  VSY+P  PG+YNII+K+ D+ I GSPF + ITG+  ++ S + VG++++IPL I   DLS LTA LTTPS  + PC++K + NG +G+SF PKE GEHLVN+ + G  IP SP  V +   E+GDA++V+V+G+GL +    +  EF IDTRDAGYG L++SIEGPSK +I+ +D E+G C V Y PTEPGNY+IN+ +A ++VPGS F V V G+  +    + + R + A     VG  C+++LKI E+++ D+   V +PSG     +I +  N    I+FV  E G+H VSV ++ +H+ GSPFQFTVG +  GG+  V A GPGLE+    +  EF+I+TREAGAG +S+A+EGPSKAE+ F++ +D GS  V+Y V +PGDYE SIKFN EHI +SPF + V    DD+ +   A    S  
Sbjct:  636 DVRYWPTE-PGEYAVH--VLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPLKIQAQDRDGNPVD-VQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNKVKVSGPGVAKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDN-----------DTFTVKYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPS---HDASKVKAEGPGLSRSGVE--LNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDFDII----DNHDGTHTVKYTPVQQGNM--GLNVTYGGDPIPKSPFAVAIAPSLDLSKVKVAGLGSKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPCKVEPGLS--PETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPS-KVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPA----VETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTEGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHDTVDPTKVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGP-KGV----VEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGL--NTTGVPASLPVEFTIDAKDAGEGL-LAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEV------------DVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTALEGDSPDQLMQQSQNLQYAYAPNMGQTWATDGQLGMN-GLDVAGLRPFDLVIPFTIQKGEITGDVRMPSGKVAKPDIT--DNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKITGDDSMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTGEGRM---KESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKD-GSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPSDDARRLTVASLQESGL 2252          

HSP 2 Score: 249.98 bits (637), Expect = 0.000e+0
Identity = 127/283 (44.88%), Postives = 179/283 (63.25%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGH--YKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEK--SSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++A V +PSG +E   V +I + +Y V+F PRE G +L+ V+ N   I GSPF+I VG      DPGMV A G GL         +F VNTS+AG G+L V IDGPSKV M+C E  +GY+ TY   APGNY+I+I YGG +HIVGSPF A + G++   + +  E  S +    +     SQ A    +SS+  +++ +GLGL +  +   N+F VD S+AG  +LLVG+ GP  PCEE++VKH+GN  + V Y +KE G +I++V+WGD+ IPGSP+ + V
Sbjct: 2271 IDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPEGYKVTYTPMAPGNYLISIKYGGPYHIVGSPFKAKITGSRLVNSHSMHETSSVLVDPVTRSMTTSQQAAPGWASSDASRVVAKGLGLNKGFIGQKNTFSVDCSKAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDEHIPGSPYHITV 2553          

HSP 3 Score: 506.908 bits (1304), Expect = 1.987e-146
Identity = 475/1667 (28.49%), Postives = 729/1667 (43.73%), Query Frame = 3
Query:   33 DLYEVTYRPQECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDL-KPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKN-GVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKE--AAPDGTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLC-EFIPKKAGPYSLVASVDNNPIKGSPQTIVVQES----------PLITEEPILSEQIKTL--------KAGNPH------NP--------MQKANPGKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQPS------SKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKV--NEKTQFVVDLDGAGHGSLGLAIEGPADA--EIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDA----------KLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGI----IPQNGAILASMPAVFHVNTKDAGVNP-DVIVGLFNPNGE-----PMPLHIEARPN------GLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVD--------LNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVA----------VGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVN---------VHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKD-VTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNG-EHIVNSPF 4718
            D + V Y P   P + +    V    + IP +P  I      + SK       L +  V+L +P  F V      K++     +  N G  V    +      T+   YTP + G   +  +  G P+ K+P  V++   +  ++ K+KV GL   + V   Q   V S +       V  +V  P  K +P   E   +P+ ++V F+P++ GP+ +       PI  +P  ++++   D  +   + S P       +  +V +P  F +  D TN    +  + ++S DN     V  +    G     ++P   G Y+L     +  +   P  + V+ +          P +  + +  E             K G  H      NP        ++    G     YT  EE    + E A +SS  P+S    P       ++V V+G GL+     +   FT++++ A +  +G+ +EGP EA + C DN DG+C V Y    PG Y +NV Y    I  SP  VPV+      +D + V   G GL    V  +    F+VDAS+    G   ++  VQ P G      + +  +  + V Y PT EGP+ INV Y    I  SP+ VK  P  +A  V  SGPGL++  V  +   +F +D   AG G L + I  P     +    DN+DGT LV Y P   G Y I +K+  ++I  SP+ +  +      K      I             ++      T+D   AGK  +   V  P  G  D  V   +      GTFD+ Y   + G  +I V++    I  SPF+   ++    +++      +     P  G   A+   +       AG+ P D+++      GE      MP    A+P+      G  T +Y   + G H++ +  DG  +P SP         +    A   G    + VNK +V T+ TK+AG+G ++  ++   +  +                 ++ DG  +V Y+P   G+Y + VKY  ++IP   F    T                        ++    + ++ +   +P+D        L A +  PSG   E P         ++ I + P E G H + +   GR I  SP    ++    G   RV   G GLS   T E AEF I T+DAG GGLSL +EGPSK +I  ED  DGT KV+Y P  PGNY I IKF DQ + GS FT  +TGE   K  +           VG+  ++ LKIP   ++ +TA++T+PS       I +  N    + F P E G H V+V  +G  +PGSPF+  V     G A KV+  G GLE+  A    EF+I TR+AG G L+I++EGPSKAEI  +D ++G   V Y+  EPG+Y +++ +  +++P SPF        VVP  +   +  +  V + Q     E  LK+++ A   + +N         VH+PSG  E C + +       ++F+ RE+G++ + V     HI GSPF+  VG     G    V+A G GLE G      EF + T  AG G ++V ++GPSK +M  QE  +     VTY    PG+Y  SIK+ G  HIV SPF
Sbjct:  837 DTFTVKYTP---PGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPSL--DLSKVKVAGLGSKMTVGKDQEITVKS-KGAGGQGKVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPSKV--RCSGPGL-----ERAKVGEPGQFVV--DCTNAGPAELTIEIIS-DNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSV-EVAYDSSPVPKSPFRVPVTEGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVH----DTVDPTKVKCQGQGLG-NNVRANIPQVFSVDASKA---GMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENE-----DGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTALEGDSPDQLMQQSQNLQYAYAPNMGQTWATDGQLGMNGLDVAGLRPFDLVIPFTIQKGEITGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAYGPGLIHGM-VNKPAVFTVNTKDAGEGGLSLAIEGPSKADI--------------SCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKIT----------------------GDDSMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSG--REEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTGEGRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPF--------VVPVASPSDDARRLTVASLQ-----ESGLKVNQPASFAVSLNGAKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPE--GYKVTYTPMAPGNYLISIKYGGPYHIVGSPF 2419          

HSP 4 Score: 395.586 bits (1015), Expect = 8.169e-111
Identity = 358/1216 (29.44%), Postives = 558/1216 (45.89%), Query Frame = 3
Query: 1245 SSKVIVYGKGLEKVA--AKEKAIFTIDSKDAPSAPIGVTVEGPG--EAVIDCV--DNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSK----GPIKDAKLL---RPNHFTIDCSEAGKAPLEVKVSKPGSGISDR---PVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAG-----VNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKA-GKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKD---GVPVDLNAKVVRPSGCMEEVPITSNDNYK-HNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF-FVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLS--LIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEP-VKKSQVAV---GNSSEIPLKIPSSDLSTLTAELT------------TPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINL------KIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFI--DINNEFAIYTREAGAGNISVAMEGPSKAEMK--FQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            SSKV   G GLE     A +   F + +  A    + V +  P   +  ++C   D G+ +    Y+    G + I + +    I +SP  V V    N +L     TA G GL P+G+     A+F V        G G +K  ++ P G +      +L +G Y   Y P+  G + I +T+ G  I  SPF VK       Q V A GPGL S  V +   FVV+  G   G+LG ++EGP+ A+I+C D  DG+C V Y P + G+Y + V   +EDI  SPF  E++     +    K    GP   +  L   +P  FT+D    GKAPL+++         DR   PV + QV+    GT+   Y P +     + V +    I  SPF+ N+       KVKV G G+      + A  P  F V+  +AG     +      G+  P    +   I    N  +T +Y     G + I V      +P +P  +K  P+ +  K   +  G  ++ +++NK +  T+ TK AGK        K++ Q  G  +   V D     + ++ DG  +V Y P ++G   + V YGG  IP   F      S    +  +           L S    G + EI  K    G    + AKV  PS   + VP            ++ + P ++GP+++++   G PI GSPF    +      +V   GPGL      E  +F +   +AGP  L+  +I +  ++ E+  +DN DGT+ ++YVP  PG Y + I++ DQ +    F A +  EP V+ S V V   G   +   +  ++D +     LT             PS  +   +I+ + +G   V +TP E G H V V    + +P SPF+V V   E  D  +V+V G GL+ G+ N+ N+FT++TR AG G L +++EGPS+A++ C DN++G C V+Y+P EPG Y +NVTY G+ + GSPF+V V  D V P + +         +   +G N   N+         +  +  L+V V  P G  EP ++ D G+    + +V    G + ++VL+ D  I  SP++  V  +    +  V  SGPGL    +   +  EF I  ++AG G ++V +  P     K   +++QD G+  V+Y     G Y   IK+ G+ I  SP+ I
Sbjct:  384 SSKVTAQGPGLEPAGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEACNPSL----CTAKGRGLQPKGLRVKETAEFKV---YTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKIGSEAGPQQVRAWGPGLESGVVGKSADFVVEAVGDDVGTLGFSVEGPSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPLKIQA-------QDRDGNPVDV-QVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNKVKVSGPGV--AKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTVKYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKA-------KLDAQFTGPNKGDAVRD---FDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPSLDLSKVKVAG---------LGSKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSA--KSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPSKVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPN--FPARLHVEPAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVT--EGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVH-DTVDPTKVK--------CQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKV--LPTHDASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQD-GTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRI 1545          

HSP 5 Score: 374.015 bits (959), Expect = 4.920e-104
Identity = 412/1601 (25.73%), Postives = 660/1601 (41.22%), Query Frame = 3
Query:    9 ETKPTKTPDLYEVTYRPQECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKI---KVEGLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEE---KEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLC-EFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPILSE--------------QIKTLKAGNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKWPQS-------------------KPDQPSSKVIVYGKGLEK--VAAKEKAIFTIDSKDAPSAPIGVTVEGPGEA--VIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPG--------FNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAI-----EGPADAEIQC----------HDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVV--QPAQVEKVKVDGDGIIPQN-GAI-LASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTV--KSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVP----VDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLKI--PSSDLSTLT-------AELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNV-KNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAG-KNVPGSPFNVNVEGDKVVPCE-------------TQKMERVQEAVKATQ------------------VGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV 4442
            + +P  +P+  +V + P++         ++T  G  IPGSPF I      + SK   +   L+   K+ +P  F V   +   +E  + +   NG   E V ++     TY  TY P   G + +T     + V   P  + V   +  +  K+    VEG     E     T    +  K    + +   + NP             DGT +V + P E G HS+       P+          PK+     + +   PA + V     + G  NKP  FT+  +          + +  P   +     +K    G  C E+IP + G Y+L  +    PI GSP ++ V ++   T+     +               +   KAG     ++   P    +P   ++   +    S V + + P S                    P   +SKV   G GL    V A     FTID+KDA    + V +  P       +  DN DGT  V Y   + G YTI + Y    IP SP  +   P  + +    TV+  G GL           + TV   +    G+G V   V +P G + +  +    +G + + YT  + G + I V + G  I +SPF V A  G         +  L  A  P +      +    +  LD AG     L I     +G    +++            DNKDGT  V+Y P +AG +++ +K++   I  SP    V              +    + +P  FT++  +AG+  L + +  P    +D   T  Q      GT  V Y+P   G   I VKYN   I GSPF + +      ++  +KV     IP + G + L+ + A                  L  P+G   P  ++   NG     +   ++G+H +++  +G  +P SP +V       G+  +  +        +  + +   I+T++AG G ++ +++   +              + +  ++  DG   V Y P E G Y++ +K+  Q +P G  F         ++E++TR          AS A  G   +++ K  +P     D+ A+V  PSG + +  I   +N  + I+  + P+E G H + V  QG+ + GSPFQF V   GEG   +V A GPGL        AEF+I T++AG GGLS+ VEGPSK EI  ED  DG+  VSY+ Q PG+Y + IKF D+ I  SPF   +        ++ V +  E  LK+  P+S   +L        A++ +PS     C + +++     V F P+E G +L++V   G+ IPGSPFK+ V +  + GD   V   G GLE G      EF ++T  AG G+L ++I+GPSK ++DC++   G   V Y P  PGNY+I++ Y G  ++ GSPF   + G ++V                T+ M   Q+A                       +G     ++   +     L V V  P    E   ++  GN    + +  +E G + + V   D HI GSP+  TV
Sbjct: 1024 KVEPGLSPETSQVRFIPRD---KGPYEVELTYDGAPIPGSPFPIEAIAPTDPSKVRCSGPGLE-RAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAE-VHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKT-GGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPV----------PKSPFRVPVTEGCDPARVRVHGPGLQSGITNKPNKFTV--ETRGAGTGGLGLAMEGPSEAKMSCTDNKD---GSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHDTVDPTKVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTALEGDSPDQLMQQSQNLQYAYAPNMGQTWATDGQLGMNGLDVAGLRPFDLVIPFTIQKGEITGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSK--ADISCTDNQ-----DGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKITGDDSMRMSHLKVGSAADIPLDIGELDLSQLTAT-----------------LTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSK--------------VDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVP-GSAFTVKVTGEGRMKESITRK------RRAASVANVGSQCDLSLK--IPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIR--FVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPSDDARRLTVASLQESGLKVNQPASFAVSLNGAKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPEGY-KVTYTPMAPGNYLISIKYGGPYHIVGSPFKAKITGSRLVNSHSMHETSSVLVDPVTRSMTTSQQAAPGWASSDASRVVAKGLGLNKGFIGQKNTFSVDCSKAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDEHIPGSPYHITV 2553          

HSP 6 Score: 270.781 bits (691), Expect = 2.894e-72
Identity = 329/1259 (26.13%), Postives = 528/1259 (41.94%), Query Frame = 3
Query: 1248 SKVIVYGKGL-EKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAV--IDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTAS---------GPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP--------------IKDAKL---------LRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSP--FKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDV--GDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGR----VTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCE--DNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANIT-------------GEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGL-ANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDC--KDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKD-RHIRGSPFQFTV-GS----------------------------VTPGGSKD----VTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPS-KAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            +KV   G+GL   V A    +F++D+  A  AP+ V V+GP   V   + VDNGD T  V Y     G Y+INVLY +  IPQSP  V V P      D S V  SGPGL+  GV      +FT+DA +    G+G +   +  P GK     I +  +G Y+V Y P   G + I + Y G  I  SP+ ++A P  +A   T +              + ++ E+T   VD   AG G +   +  P   E+     +N+DGT  + YT  + G Y I V+F  E I +SPF V  ++   P+++  +                  D +L         LRP    I  +   K  +   V  P   ++   +T  +      GT  V Y P E G   +D+KY+   I GSP  F  + V    V      G G+I      + + PAVF VNTKDAG       GL      P    I    N   TC      V  GD+ I V  +   +P SP+  K   TG+       + +   ++V   + I ++  E    Q+T T+     +     E+  +L  ++       +G   + ++PKE GE+LV +K  G+ IP+     +   +  E+ +     V  Q  +E  +  F    F I+T+D     L+  +  PS    +V I + D      K+ Y P+E G + + +    + + GS F   V   GEGR    +T      S        + ++   +     ++  V  PS    K E  +  + T+ + +VP   G + + +K++ Q + GSPF   +              G  +++++  V   +E  +    +    L+  +  PSK ++    +   +G+ GVS+  +E G++ V++      IP SPF V V +    DA ++ V+    E GL  NQ   F +    A  G ++  +  PS A  +C   + +     V+++P E G Y+I+V + G ++PGSPF + V G+     +   +      ++    G  CE  +         L V +  PS     C     G    ++ +     G + +S+ +    HI GSPF+  + GS                              PG +      V A G GL KGFI   N F++   +AG   + V ++GP    E    +        V+Y++ + G+Y   +K+  EHI  SP+HI V
Sbjct: 1361 TKVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTH----DASKVRCSGPGLNTTGVPASLPVEFTIDAKDA---GEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTALEGDSPDQLMQQSQNLQYAYAPNMGQTWATDGQLGMNGLDVAGLRPFDLVIPFT-IQKGEITGDVRMPSGKVAKPDITDNK-----DGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAY---GPGLIHG----MVNKPAVFTVNTKDAGEG-----GLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKI--TGD------DSMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGR-----EEPCLLKMLR-------NGHVGISFVPKEIGEHLVNIKKNGRHIPSSPI--SVMINQSEIGDASRVRVTGQGLSE--ARTFEPAEFIIDTRDAGYGGLSLSIEGPS----KVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFT--VKVTGEGRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGV--PAEFSIWTREAGAGGLSIAVEGPSKAEI--AFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPS-DDARRLTVASL-QESGLKVNQPASFAVSLNGA-KGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRV-GETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPEG---YKVTYTPMAPGNYLISIKYGGPYHIVGSPFKAKITGSRLVNSHSMHETSSVLVDPVTRSMTTSQQAAPGWASSDASRVVAKGLGLNKGFIGQKNTFSVDCSKAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDEHIPGSPYHITV 2553          

HSP 7 Score: 246.514 bits (628), Expect = 7.628e-65
Identity = 317/1247 (25.42%), Postives = 506/1247 (40.58%), Query Frame = 3
Query: 1230 KPDQPSSKVIVYGKGLEKVAAKEKAI--FTIDSKDAPSAPIGVTVEGPGEAVIDCVDN-------------GDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGL-HSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADA--EIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLL---RPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKV-----DGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKA---------------GKDKTIQVNKESVITIETKEA------GKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHG-VN----FEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKC--EDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTA-------------NITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNE--FTIDTRDAGYGSLNISIEGPS----KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVE-----GDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGA-GNISVAMEGPSKAEMKFQESQ-DKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            +P   +S V V+G G+E      +A   FT+D++        +T  G G  +  C++N             GDGT  V Y     G +++ V YD+  +P+SP  VPV     +  D + V   GPGL  +    +   KFTV   E    G G +   ++ PS  + +   DN  +G   V Y P E G + +NVTY G PI  SPF V      +   V   G GL ++ + N    F VD   AG   L + ++GP       +  DN D T  V Y P + G Y I+V + DE+I  SP+ V+V+      KV+  GP  +   +    P  FTID  +AG+  L V+++ P     D       +     GT+ V YVP+  G   I +KY    I  SP++   +      K  V                I      V  V+ K AG    V   +  P+G  + + +    +G +   Y     G + I V   G  +P SP+ V ++   +P++   ++                 D  + +N   V  +   +        KG+IT  V    R   G+V +  + D        + DG  +V Y P E G + +++KY G  IP         Y            V +           HG VN    F +NTKD     L+  +  PS    +  I+  DN      + Y P   G + + V    + I GSPF   +      R++    G ++    ++ E  +         L+  +  PS  E  C  +   +G   +S+VP+  G + + IK   + I  SP +               +TG+ +  S+      +E  +    +    L+  +  PSK+ +    +   +G   V++ P E G +++N+      +PGS F V V  E      K  ++ K     +AN G++   ++   +     +   +  PS    KAEI   + EN    ++++PTE G + ++V Y G++VPGSPF   V      G   V      +ER +  V A       E ++   E     L + V  PS        ED  +G+  + ++ +E G + VS+   D HI  SPF   V S +    +   AS   L++  + +N   +      GA G I   +  PS A  +   ++ D+   AV +   + G Y   +KFNG HI  SPF I V
Sbjct: 1162 EPAVETSGVKVFGPGVEGKGVFREATTDFTVDAR-------ALTKTG-GNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPV----TEGCDPARVRVHGPGL--QSGITNKPNKFTV---ETRGAGTGGLGLAMEGPSEAKMS-CTDN-KDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHDTVDPTKVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDP-----DGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKG-KVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTALEGDSPDQLMQQSQNLQYAYAPNMGQTWATDGQLGMNGLDVAGLRPFDLVIPFTIQKGEITGDV----RMPSGKVAKPDITD--------NKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDY------------VNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPS----KADISCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKITGDDSMRMSHLKVGSAADIPLDIGELDLSQ-------LTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGL--SEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINT--EDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTGE---GRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEI--MEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPA-------EFSIWTREAGAGGLSIAVEGPS--KAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPSDDARRLTVAS---LQESGLKVNQPASFAVSLNGAKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRV 2327          

HSP 8 Score: 137.887 bits (346), Expect = 9.599e-32
Identity = 100/281 (35.59%), Postives = 135/281 (48.04%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGL-KQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++  +  PSGN   A+++ +GDG Y V+++P E GTH V V  +  P+  SPFR+PV     DP  V   G GL   I +K  KF V T  AG+G L +A++GPS+  M+C + +DG     Y+   PG Y +N+TYGG   I GSPF+  V      T                                 K+ CQG GL    R N    F VDAS+AG   L V + GP    E   V   G+   TV YV    G + I V + D++IP SP+ V V
Sbjct: 1205 IKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTE-GCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCCVEYIPYEPGTYNLNVTYGGQ-PITGSPFSVPVHDTVDPT---------------------------------KVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKV 1450          

HSP 9 Score: 128.642 bits (322), Expect = 6.324e-29
Identity = 85/285 (29.82%), Postives = 141/285 (49.47%), Query Frame = 2
Query: 4847 EIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++ +L A++ TPSG  EP +++ + +G  G+ F P+E G HLV ++ N + I  SP  + +   +  D   V  +G+GLS A   + A+F ++T +AG G L+++I+GPSKV++N  + EDG  + TY  T PGNYIINI +  + H+ GS FT  V G              +++   + KR  +  A   S       C  L LK   ++  +             +   +  P     +  +    NN + + +V  E G H + V++  + +PGSPF   V
Sbjct: 1886 DLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKF-ADQHVPGSAFTVKVTG------------EGRMKESITRKRRAASVANVGSQ------CD-LSLKIPEISIAD-------------MTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTV 2137          

HSP 10 Score: 105.145 bits (261), Expect = 8.596e-22
Identity = 78/307 (25.41%), Postives = 136/307 (44.30%), Query Frame = 2
Query: 4781 HRENHREDAGGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHY-KADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYE-FTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
             R     + G    ++++  +  I  + A V +PSG +  A + +  +  Y ++F P E G H V V+   + + GSPF+  VG   +     V A G GL  A     A+F + T  AG+G L++A++GPSK  +   + +DG    +Y+   PG+Y ++I +  + HI  SPF   V                                   S +  ++    L     ++N   SF V  + A  G++   +  P    EE  V  +  +++ V ++ +E+G ++I V++    IPGSPF + V
Sbjct: 2055 RRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKF-NDEHIPDSPFVVPV--------------------------------ASPSDDARRLTVASLQESGLKVNQPASFAVSLNGA-KGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRV 2327          

HSP 11 Score: 102.064 bits (253), Expect = 7.404e-21
Identity = 81/304 (26.64%), Postives = 134/304 (44.08%), Query Frame = 2
Query: 4802 DAGGL----ISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            D  GL    + I    + GEI      V+ PSG +    +    DG   VK++P E G H + ++ +   I GSP +  V +  +  G V A G GL H +V+K A F VNT +AG G L++AI+GPSK +++C + +DG    +Y+   PG+Y I + Y  + +I GSPF + + G+ S                                         + +   ++ S     +D  +     L   +  P    E  ++K + N    + +V KE G H++ ++   + IP SP  V ++
Sbjct: 1691 DVAGLRPFDLVIPFTIQKGEI---TGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNS--GHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYNIIVKY-NDKNIPGSPFMSKITGDDS-----------------------------------------MRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMIN 1947          

HSP 12 Score: 97.0561 bits (240), Expect = 2.177e-19
Identity = 76/273 (27.84%), Postives = 130/273 (47.62%), Query Frame = 3
Query: 3945 FTIDTRDAGYGSLNISIEGPS----KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNV---EGDKV-VPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGF--TEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLE-KGF-IDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQ-DKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            FT++T  AG G + + +E P+    +A++   +++N   +V Y+P   G + + V +AG+++  SPF V+V   +GD   V  +   +E        T        ++      + +++V +  PSG   T  C +ED GN + R  +   + G H + +      I  SP+   VG          TA G GL+ KG  +    EF +YT+ AG G++ V ++GP   E   ++     G  +  Y  S PG+Y  +I + G+HI  SPF +
Sbjct:  307 FTVETISAGQGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMAQGDSSKVTAQGPGLEPAGNIANKTTY-----FDVYTAGAGVGEVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEAC--NPSLCTAKGRGLQPKGLRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEV 572          

HSP 13 Score: 93.2041 bits (230), Expect = 3.322e-18
Identity = 75/282 (26.60%), Postives = 118/282 (41.84%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLN--SVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            L+ +++ P G  EP   + +GDG Y   + P   G +++ +    + I  SPF + +G  +A P  V A G GL   +V K A F V       G+L  +++GPS   + C +  DG  +  Y  T PG Y +++    N  I  SPF A +                               A       +K+   G GL+ + L+      F VDA   G   L +          +V VK  GN  ++  Y  ++   H +MV WG  +IP SPF +++
Sbjct:  518 LKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKIGS-EAGPQQVRAWGPGLESGVVGKSADFVVEAVGDDVGTLGFSVEGPSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCK-NEDIQLSPFMAEI-----------------------------MPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPLKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNI 768          

HSP 14 Score: 92.8189 bits (229), Expect = 3.864e-18
Identity = 93/302 (30.79%), Postives = 127/302 (42.05%), Query Frame = 2
Query: 4826 TVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQ--YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHA--IVDKKAKFFVNTSNAGSGSLNVAIDGPS--KVNMNCHETEDG---YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPV---RPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            T+ A  GE+      V+ P+G+ E A V    D    Y V + P+  G H V V    + I+ SPF + VG  + D   V A G GL  A  I +K   F V T+ AG G + V I  PS  K  + C   + G   Y  TY  T  G +II IT+ G   I  SP+T  V                                E  + ++     +GL  K  R+     F V    AG G L V I GP     PC++   K +G+  ++ DY     G +II + WG + IP SPF V +
Sbjct:  311 TISAGQGEV---LVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMAQGDSSKVTAQGPGLEPAGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGG-QISKSPYTVNV-------------------------------GEACNPSLCTAKGRGLQPKGLRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKK---KDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKI 574          

HSP 15 Score: 90.1225 bits (222), Expect = 3.299e-17
Identity = 78/287 (27.18%), Postives = 121/287 (42.16%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEP--AIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHA--IVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG---YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++E  +  PSG  +     V+  G+  Y   + P + G H++++      I+ SP+ + VG    +P +  A G GL      V + A+F V T  AG+G L V I GP  +   C + + G   Y F Y  + PGNYII IT+GG  HI  SPF                    +V+I              S +  +++   G GL+   +     F V+A     G L   + GP     ++     G+    V Y   E G + + V   ++DI  SPFM  +
Sbjct:  418 EVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGE-ACNPSLCTAKGRGLQPKGLRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQ-HIPRSPF--------------------EVKI-------------GSEAGPQQVRAWGPGLESGVVGKSADFVVEAVGDDVGTLGFSVEGPSP--AKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLSPFMAEI 667          

HSP 16 Score: 80.1073 bits (196), Expect = 3.045e-14
Identity = 78/287 (27.18%), Postives = 117/287 (40.77%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQ-IGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAI--DGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDA---SQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            K+ A V  PS    P  V+  +      V+F PR+ G + V +  +  PI GSPF I       DP  V  SG GL  A V +  +F V+ +NAG   L + I  D  ++  ++  +  DG Y  TYV   PG Y + I Y                G++   N      H +  +E S                 K+   G+  K     +   F VDA   ++ G   +   I  P     E +++ +G+  + V+Y   E GTH + V +    +P SPF V V
Sbjct: 1008 KVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEA-IAPTDPSKVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRY----------------GDQDVPNF-PARLHVEPAVETSGV---------------KVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPV 1261          

HSP 17 Score: 75.0998 bits (183), Expect = 1.180e-12
Identity = 70/265 (26.42%), Postives = 113/265 (42.64%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAG-SGSLNVAIDGPSKVNMNCHETEDGY-----EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            DG + VK++P + G   + V     PI  SPF + +     D   V  +G G S   V K  +  V +  AG  G +   + GPS  ++ C + E G      +  ++    G Y + +TY G   I GSPF                       IEA            + ++  K+ C G GL++A++     F VD + AG   L + I        EV ++  G+  +T+ YV    G + + +R+GD+D+P  P  +HV+
Sbjct:  935 DGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAP-SLDLSKVKVAGLG-SKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPC-KVEPGLSPETSQVRFIPRDKGPYEVELTYDGA-PIPGSPF----------------------PIEAI-----------APTDPSKVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVE 1162          

HSP 18 Score: 70.4774 bits (171), Expect = 2.624e-11
Identity = 82/296 (27.70%), Postives = 119/296 (40.20%), Query Frame = 2
Query: 4823 ITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKK--AKFFVNTSNAGSGSLNVAIDGPS--KVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPF--TAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMV 5689
             +V A    +  L+  VQ P G +EPA V   GD  + V + P   G + + V    + I  SP+++ V     D   V  SG GL+   V      +F ++  +AG G L V I  P       N  + +DG Y  +YV    G Y I I YGG+  I  SP+   A+  G+ S   V                  VS       + V   I         ++       VDA  AG G +   +  P     +V V    +  F + Y   + G ++I VR+G + IP SPF V
Sbjct: 1382 FSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKV-LPTHDASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGD-EIPYSPYRIRALPTGDASKCTVT-----------------VSIGGHGLGAGVGPTI---------QIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQV 1649          

HSP 19 Score: 66.2402 bits (160), Expect = 4.890e-10
Identity = 80/310 (25.81%), Postives = 124/310 (40.00%), Query Frame = 2
Query: 4817 ISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRI---PVGHYKADPGMVHASGEGLSHAI-----VDKKAKFFVNTSNAGSGSLNVAIDGPS--KVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGL-GLKQARLNSVNSFFVDASQAGYGILLVGIAGPVR-PCEEVVVKHVGNNQ---FTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            +  T+ A+D     L   +  P G  + A ++   DG Y V + P   G + + ++     I  SP+RI   P G        V   G GL   +     + ++    V+   AG G +   +  P   +V+++  E EDG ++  Y A  PG Y+I + +GG  HI  SPF        S   + Q+ Q+ Q             YA             G+ GL  A L   +       Q G       I G VR P  +V    + +N+    TV Y   E+G H + +++    IPGSP   +VD
Sbjct: 1477 VEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGE-HIPNSPFQVTALEGDSPDQLMQQSQNLQY-----------AYAPNMGQTWATDGQLGMNGLDVAGLRPFDLVIPFTIQKGE------ITGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVD 1768          

HSP 20 Score: 65.855 bits (159), Expect = 6.240e-10
Identity = 73/265 (27.55%), Postives = 107/265 (40.38%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHET---EDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVR---PCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDK-DIPGSPFMVHV 5695
            DG  GV +  +E G + V ++ N + I  SPF +PV     D   +  +    S   V++ A F V+  N   G ++  +  PS     C  T   ED Y   ++    G Y+I++ + G+ HI GSPF            V +  Q       A D   VS Y              G GL+     S   F V+ S AG G L V I GP +    C+E          + V Y     G ++I +++G    I GSPF   +
Sbjct: 2197 DGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPSDDARRLTVASLQESGLKVNQPASFAVSL-NGAKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGS-HIPGSPF---------KIRVGETGQ-------AGDPGMVSAY--------------GAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQEC------PEGYKVTYTPMAPGNYLISIKYGGPYHIVGSPFKAKI 2423          

HSP 21 Score: 59.6918 bits (143), Expect = 4.461e-8
Identity = 64/261 (24.52%), Postives = 101/261 (38.70%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNC--HETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            DG   V + P   G + + V+ N K I GSPF   +     D  M       +SH  V   A   ++        L   +  PS     C      +G+   ++V    G +++NI   G  HI  SP + ++               +Q EI                 +  ++   G GL +AR      F +D   AGYG L + I GP +   ++  +   +    V Y   E G +II +++ D+ +PGS F V V
Sbjct: 1824 DGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPF---MSKITGDDSMR------MSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGR-HIPSSPISVMI---------------NQSEI----------------GDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSK--VDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKV 2041          

HSP 22 Score: 55.8398 bits (133), Expect = 7.834e-7
Identity = 73/309 (23.62%), Postives = 117/309 (37.86%), Query Frame = 2
Query: 4823 ITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVD--KKAKFFVNTSNAGSGSLNVAID------GPSKVNMN---CHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQA--RLNSVNSFFVDASQAGYGILLVGIAGP-----VRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
             TV A+ G    L+   Q   GN     V+  G+G Y   ++PR+   H V V      I  SPFR+ +G     P  V  SG G++   +       F V+ + AG G +++ I       GP++ +++        D +   Y     G+Y I + +                        +Q    + + I+              S +  K+  +G GL ++   LN    F V+   AG   L     GP     VR   +++  H G +  TV Y   + G   + V +G   IP SPF V +
Sbjct:  700 FTVDAKLGGKAPLKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGA-GCHPNKVKVSGPGVAKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTVKYTPPGAGSYTIMVLF-----------------------ADQTIPMTPIRIKVD-----------PSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDF-DIIDNHDGTH--TVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAI 970          

HSP 23 Score: 55.8398 bits (133), Expect = 8.102e-7
Identity = 74/308 (24.03%), Postives = 116/308 (37.66%), Query Frame = 2
Query: 4799 EDAGGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVD--KKAKFFVNTSNAGSGSLNVAIDGPSK----VNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVR---PCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVH 5692
            E   G ISI ++   G +   EA +          I++   D  + VK++P   G++ + V    + I  +P RI V     D   V A G GLS + V+  K   F VNT  AG   L+    GP+K     + +  +  DG +   Y     GN  +N+TYGG+  I  SPF   +                                   S ++ K+   GLG K                 G G +   + GP     PC+  V   +      V ++ ++ G + + + +    IPGSPF + 
Sbjct:  803 EAGQGDISIGIKCAAGVVGPAEADIDF-------DIIRNDND-TFTVKYTPPGAGSYTIMVLFADQTIPMTPIRIKV-DPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGD-PIPKSPFAVAI---------------------------------APSLDLSKVKVAGLGSKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPCK--VEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIE 1065          
BLAST of Filamin-A vs. Ensembl Zebrafish
Match: CR352234.3 (filamin A, alpha (actin binding protein 280) [Source:NCBI gene;Acc:562529])

HSP 1 Score: 816.994 bits (2109), Expect = 0.000e+0
Identity = 588/1677 (35.06%), Postives = 854/1677 (50.92%), Query Frame = 3
Query:   42 EVTYRPQECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVK-----LQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPM-IEVCAPQTFKVLSPEK--------------VINPDLVDVQ--VLNPENKIIPIHKEAAPDGTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTI--------------VKDNTNDDIHDFDVVVLSPDNH------QPIPVKSKKLPKGLLCEF----IPKKAGPYSLVASVDNNPIK----GSPQTIVVQESPLITEEPILSEQIKTLKAGNPHNPMQ--KANPGKSNKPYTALEEAIKEMK-----ESAVESSKWPQS-------KPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTV--EGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXX--XXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAG---------KDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQT-----ATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDL-----------NAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGE-PVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV---EDDSIKPVAARAVSSSF 4781
            +V Y P E P   A+H  V    EDI  SPF            Y   ++   P ++     + +P  F V    G K+   +   D++G PV+ V VK     TY  +YTP K  +H +  S  G  + ++P  +++      N  K+   G+A   ++   P  F V   E               V+ P   D+   ++  +N           D   V + P   G ++I     DQ I  TP  +K  P    H+A   K+    L+    E  +NKP  FT+                 N  D + DFD++    DNH      +  PV+   +  GL   +    IPK     ++  S+D + +K    GS  T+   +   +  +    +     K   P       K  PG S  P T+    I   K     E   + +  P S        P  PS KV   G GLE+    E   F +D  +A  A + + +  +   EA +   DNGDGT  + Y    PG YT+ + Y +  +P  P  + V P     ++ S V   GPG+  +GVF++    FTVDA  +++ G   +K  + +PSG +T  LI +L +G Y V YTP EEG H + V Y+  P+  SPF V    G +   V   GPGL S   N+  +F V+  GAG G LGLA+EGP++A++ C DNKDG+C VEY P + G Y+++V +  + I+ SPF V V D V     K + +G   + +   P  F++D S+AG APL+V+V  P  G+    V   +V      T  V YVP   GP  I+V Y    I  SP+K  V+      KV+  G G+      + AS+P  F ++ KDAG    + V + +P+G+P   +I    +G Y   Y     G + I +   G  +P SPY ++++PTG+  KC +               TIQ+ +++VIT++ K AGKG++TCTV   +  +V             V V E+ DG   + Y   + G+Y++ V++GG+ IPN  F  T     A + F  +   ++ S Q   + +L  N               P DL              V  PSG + +  IT  DN    + + Y P+E G H++ +   G  I GSP QF+VD    G VTA+GPGL  G  N+ A FT+ TKDAG GGLSL +EGPSK +I C DN DGT  VSY+P  PG+YNII+K+ D+ I GSPF + ITG+  ++ S + VG++++IPL I   DLS LTA LTTPS  + PC++K + NG +G+SF PKE GEHLVN+ + G  IP SP  V +   E+GDA++V+V+G+GL +    +  EF IDTRDAGYG L++SIEGPSK +I+ +D E+G C V Y PTEPGNY+IN+ +A ++VPGS F V V G+  +    + + R + A     VG  C+++LKI E+++ D+   V +PSG     +I +  N    I+FV  E G+H VSV ++ +H+ GSPFQFTVG +  GG+  V A GPGLE+    +  EF+I+TREAGAG +S+A+EGPSKAE+ F++ +D GS  V+Y V +PGDYE SIKFN EHI +SPF + V    DD+ +   A    S  
Sbjct:  635 DVRYWPTE-PGEYAVH--VLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPLKIQAQDRDGNPVD-VQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNKVKVSGPGVAKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDN-----------DTFTVKYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPS---HDASKVKAEGPGLSRSGVE--LNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDFDII----DNHDGTHTVKYTPVQQGNM--GLNVTYGGDPIPKSPFAVAIAPSLDLSKVKVAGLGSKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPCKVEPGLS--PETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPS-KVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPA----VETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTEGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHDTVDPTKVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGP-KGV----VEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGL--NTTGVPASLPVEFTIDAKDAGEGL-LAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEV------------DVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTVHTCHAHHLFIHI-SFISNSGQTLTNGQLGMNGLDVAGLR-------PFDLVIPFTIQKGEITGDVRMPSGKVAKPDIT--DNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKITGDDSMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTGEGRM---KESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKD-GSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPSDDARRLTVASLQESGL 2244          

HSP 2 Score: 250.366 bits (638), Expect = 0.000e+0
Identity = 127/283 (44.88%), Postives = 179/283 (63.25%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGH--YKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEK--SSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++A V +PSG +E   V +I + +Y V+F PRE G +L+ V+ N   I GSPF+I VG      DPGMV A G GL         +F VNTS+AG G+L V IDGPSKV M+C E  +GY+ TY   APGNY+I+I YGG +HIVGSPF A + G++   + +  E  S +    +     SQ A    +SS+  +++ +GLGL +  +   N+F VD S+AG  +LLVG+ GP  PCEE++VKH+GN  + V Y +KE G +I++V+WGD+ IPGSP+ + V
Sbjct: 2263 IDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPEGYKVTYTPMAPGNYLISIKYGGPYHIVGSPFKAKITGSRLVNSHSMHETSSVLVDPVTRSMTTSQQAAPGWASSDASRVVAKGLGLNKGFIGQKNTFSVDCSKAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDEHIPGSPYHITV 2545          

HSP 3 Score: 505.368 bits (1300), Expect = 5.746e-146
Identity = 478/1664 (28.73%), Postives = 729/1664 (43.81%), Query Frame = 3
Query:   33 DLYEVTYRPQECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDL-KPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKN-GVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKE--AAPDGTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLC-EFIPKKAGPYSLVASVDNNPIKGSPQTIVVQES----------PLITEEPILSEQIKTL--------KAGNPH------NP--------MQKANPGKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQPSS------KVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKV--NEKTQFVVDLDGAGHGSLGLAIEGPADA--EIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDA----------KLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKD-AGVNP-DVIVGLFNPNGE-----PMPLHIEARPN------GLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVD--------LNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVA----------VGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVN---------VHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKD-VTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNG-EHIVNSPF 4718
            D + V Y P   P + +    V    + IP +P  I      + SK       L +  V+L +P  F V      K++     +  N G  V    +      T+   YTP + G   +  +  G P+ K+P  V++   +  ++ K+KV GL   + V   Q   V S +       V  +V  P  K +P   E   +P+ ++V F+P++ GP+ +       PI  +P  ++++   D  +   + S P       +  +V +P  F +  D TN    +  + ++S DN     V  +    G     ++P   G Y+L     +  +   P  + V+ +          P +  + +  E             K G  H      NP        ++    G     YT  EE    + E A +SS  P+S    P +      +V V+G GL+     +   FT++++ A +  +G+ +EGP EA + C DN DG+C V Y    PG Y +NV Y    I  SP  VPV+      +D + V   G GL    V  +    F+VDAS+    G   ++  VQ P G      + +  +  + V Y PT EGP+ INV Y    I  SP+ VK  P  +A  V  SGPGL++  V  +   +F +D   AG G L + I  P     +    DN+DGT LV Y P   G Y I +K+  ++I  SP+ +  +      K      I             ++      T+D   AGK  +   V  P  G  D  V   +      GTFD+ Y   + G  +I V++    I  SPF+  V        + +     I  +G  L +      +N  D AG+ P D+++      GE      MP    A+P+      G  T +Y   + G H++ +  DG  +P SP         +    A   G    + VNK +V T+ TK+AG+G ++  ++   +  +                 ++ DG  +V Y+P   G+Y + VKY  ++IP   F    T                        ++    + ++ +   +P+D        L A +  PSG   E P         ++ I + P E G H + +   GR I  SP    ++    G   RV   G GLS   T E AEF I T+DAG GGLSL +EGPSK +I  ED  DGT KV+Y P  PGNY I IKF DQ + GS FT  +TGE   K  +           VG+  ++ LKIP   ++ +TA++T+PS       I +  N    + F P E G H V+V  +G  +PGSPF+  V     G A KV+  G GLE+  A    EF+I TR+AG G L+I++EGPSKAEI  +D ++G   V Y+  EPG+Y +++ +  +++P SPF        VVP  +   +  +  V + Q     E  LK+++ A   + +N         VH+PSG  E C + +       ++F+ RE+G++ + V     HI GSPF+  VG     G    V+A G GLE G      EF + T  AG G ++V ++GPSK +M  QE  +     VTY    PG+Y  SIK+ G  HIV SPF
Sbjct:  836 DTFTVKYTP---PGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPSL--DLSKVKVAGLGSKMTVGKDQEITVKS-KGAGGQGKVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPSKV--RCSGPGL-----ERAKVGEPGQFVV--DCTNAGPAELTIEIIS-DNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSV-EVAYDSSPVPKSPFRVPVTEGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVH----DTVDPTKVKCQGQGLG-NNVRANIPQVFSVDASKA---GMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENE-----DGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTV-HTCHAHHLFIH-ISFISNSGQTLTN--GQLGMNGLDVAGLRPFDLVIPFTIQKGEITGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAYGPGLIHGM-VNKPAVFTVNTKDAGEGGLSLAIEGPSKADI--------------SCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKIT----------------------GDDSMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSG--REEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTGEGRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPF--------VVPVASPSDDARRLTVASLQ-----ESGLKVNQPASFAVSLNGAKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPE--GYKVTYTPMAPGNYLISIKYGGPYHIVGSPF 2411          

HSP 4 Score: 395.971 bits (1016), Expect = 6.367e-111
Identity = 358/1216 (29.44%), Postives = 558/1216 (45.89%), Query Frame = 3
Query: 1245 SSKVIVYGKGLEKVA--AKEKAIFTIDSKDAPSAPIGVTVEGPG--EAVIDCV--DNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSK----GPIKDAKLL---RPNHFTIDCSEAGKAPLEVKVSKPGSGISDR---PVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAG-----VNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKA-GKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKD---GVPVDLNAKVVRPSGCMEEVPITSNDNYK-HNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF-FVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLS--LIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEP-VKKSQVAV---GNSSEIPLKIPSSDLSTLTAELT------------TPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINL------KIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFI--DINNEFAIYTREAGAGNISVAMEGPSKAEMK--FQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            SSKV   G GLE     A +   F + +  A    + V +  P   +  ++C   D G+ +    Y+    G + I + +    I +SP  V V    N +L     TA G GL P+G+     A+F V        G G +K  ++ P G +      +L +G Y   Y P+  G + I +T+ G  I  SPF VK       Q V A GPGL S  V +   FVV+  G   G+LG ++EGP+ A+I+C D  DG+C V Y P + G+Y + V   +EDI  SPF  E++     +    K    GP   +  L   +P  FT+D    GKAPL+++         DR   PV + QV+    GT+   Y P +     + V +    I  SPF+ N+       KVKV G G+      + A  P  F V+  +AG     +      G+  P    +   I    N  +T +Y     G + I V      +P +P  +K  P+ +  K   +  G  ++ +++NK +  T+ TK AGK        K++ Q  G  +   V D     + ++ DG  +V Y P ++G   + V YGG  IP   F      S    +  +           L S    G + EI  K    G    + AKV  PS   + VP            ++ + P ++GP+++++   G PI GSPF    +      +V   GPGL      E  +F +   +AGP  L+  +I +  ++ E+  +DN DGT+ ++YVP  PG Y + I++ DQ +    F A +  EP V+ S V V   G   +   +  ++D +     LT             PS  +   +I+ + +G   V +TP E G H V V    + +P SPF+V V   E  D  +V+V G GL+ G+ N+ N+FT++TR AG G L +++EGPS+A++ C DN++G C V+Y+P EPG Y +NVTY G+ + GSPF+V V  D V P + +         +   +G N   N+         +  +  L+V V  P G  EP ++ D G+    + +V    G + ++VL+ D  I  SP++  V  +    +  V  SGPGL    +   +  EF I  ++AG G ++V +  P     K   +++QD G+  V+Y     G Y   IK+ G+ I  SP+ I
Sbjct:  383 SSKVTAQGPGLEPAGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEACNPSL----CTAKGRGLQPKGLRVKETAEFKV---YTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKIGSEAGPQQVRAWGPGLESGVVGKSADFVVEAVGDDVGTLGFSVEGPSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPLKIQA-------QDRDGNPVDV-QVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNKVKVSGPGV--AKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTVKYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKA-------KLDAQFTGPNKGDAVRD---FDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPSLDLSKVKVAG---------LGSKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSA--KSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPSKVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPN--FPARLHVEPAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVT--EGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVH-DTVDPTKVK--------CQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKV--LPTHDASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQD-GTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRI 1544          

HSP 5 Score: 371.318 bits (952), Expect = 3.104e-103
Identity = 410/1600 (25.62%), Postives = 659/1600 (41.19%), Query Frame = 3
Query:    9 ETKPTKTPDLYEVTYRPQECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKI---KVEGLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEE---KEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLC-EFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPILSE--------------QIKTLKAGNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKWPQS-------------------KPDQPSSKVIVYGKGLEK--VAAKEKAIFTIDSKDAPSAPIGVTVEGPGEA--VIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVD-------LDGAGHGSLGLAI-----EGPADAEIQC----------HDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVV--QPAQVEKVKVDGDGIIPQN-GAI-LASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTV--KSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVP----VDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLKI--PSSDLSTLT-------AELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNV-KNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAG-KNVPGSPFNVNVEGDKVVPCE-------------TQKMERVQEAVKATQ------------------VGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV 4442
            + +P  +P+  +V + P++         ++T  G  IPGSPF I      + SK   +   L+   K+ +P  F V   +   +E  + +   NG   E V ++     TY  TY P   G + +T     + V   P  + V   +  +  K+    VEG     E     T    +  K    + +   + NP             DGT +V + P E G HS+       P+          PK+     + +   PA + V     + G  NKP  FT+  +          + +  P   +     +K    G  C E+IP + G Y+L  +    PI GSP ++ V ++   T+     +               +   KAG     ++   P    +P   ++   +    S V + + P S                    P   +SKV   G GL    V A     FTID+KDA    + V +  P       +  DN DGT  V Y   + G YTI + Y    IP SP  +   P  + +    TV+  G GL           + TV   +    G+G V   V +P G + +  +    +G + + YT  + G + I V + G  I +SPF V         L       +H   ++   Q + +       LD AG     L I     +G    +++            DNKDGT  V+Y P +AG +++ +K++   I  SP    V              +    + +P  FT++  +AG+  L + +  P    +D   T  Q      GT  V Y+P   G   I VKYN   I GSPF + +      ++  +KV     IP + G + L+ + A                  L  P+G   P  ++   NG     +   ++G+H +++  +G  +P SP +V       G+  +  +        +  + +   I+T++AG G ++ +++   +              + +  ++  DG   V Y P E G Y++ +K+  Q +P G  F         ++E++TR          AS A  G   +++ K  +P     D+ A+V  PSG + +  I   +N  + I+  + P+E G H + V  QG+ + GSPFQF V   GEG   +V A GPGL        AEF+I T++AG GGLS+ VEGPSK EI  ED  DG+  VSY+ Q PG+Y + IKF D+ I  SPF   +        ++ V +  E  LK+  P+S   +L        A++ +PS     C + +++     V F P+E G +L++V   G+ IPGSPFK+ V +  + GD   V   G GLE G      EF ++T  AG G+L ++I+GPSK ++DC++   G   V Y P  PGNY+I++ Y G  ++ GSPF   + G ++V                T+ M   Q+A                       +G     ++   +     L V V  P    E   ++  GN    + +  +E G + + V   D HI GSP+  TV
Sbjct: 1023 KVEPGLSPETSQVRFIPRD---KGPYEVELTYDGAPIPGSPFPIEAIAPTDPSKVRCSGPGLE-RAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAE-VHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKT-GGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPV----------PKSPFRVPVTEGCDPARVRVHGPGLQSGITNKPNKFTV--ETRGAGTGGLGLAMEGPSEAKMSCTDNKD---GSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHDTVDPTKVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTVHTCHAHHLF------IHISFISNSGQTLTNGQLGMNGLDVAGLRPFDLVIPFTIQKGEITGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSK--ADISCTDNQ-----DGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKITGDDSMRMSHLKVGSAADIPLDIGELDLSQLTAT-----------------LTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSK--------------VDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVP-GSAFTVKVTGEGRMKESITRK------RRAASVANVGSQCDLSLK--IPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIR--FVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPSDDARRLTVASLQESGLKVNQPASFAVSLNGAKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPEGY-KVTYTPMAPGNYLISIKYGGPYHIVGSPFKAKITGSRLVNSHSMHETSSVLVDPVTRSMTTSQQAAPGWASSDASRVVAKGLGLNKGFIGQKNTFSVDCSKAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDEHIPGSPYHITV 2545          

HSP 6 Score: 299.671 bits (766), Expect = 4.694e-95
Identity = 323/1135 (28.46%), Postives = 492/1135 (43.35%), Query Frame = 3
Query: 1503 PVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLI--DNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVK-AKPGFNAQLVTASGPGLHSCK--VNEKTQFVVDLDGAGHGSLGLAIEGPA----DAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEG---------AAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCE--YQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGN----PEKC-AIKAG-KDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLN------AKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVD-TKGEGRVTAFGPGLS-SGT-TNEVAEFTIITKDAGPGGLSLIVEGPSK----TEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANIT-GEPVKKSQVA-------VGNSSEIPLKIP-SSDLSTLTAELTTPSKIKVPCVIK-KMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISI--EGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMAL-----KDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGS-KDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVED 4736
            P+ PK    L+     A GPG+ P G      A FTV   E    GQG V   V+ P+G +    +  +N  N  Y V Y P   G HK+ V + G  I  SPF V       ++  VTA GPGL       N+ T F V   GAG G + + I  P+      E    D  + +    Y P + G + I + F    IS SP+ V V +   P    +KG     + L+P    +      K   E KV   G+G  D  VTIK  +G            G +   Y P   G  +I + +    I  SPF+  +   A  ++V+  G G+  ++G +  S   V      D G     + G       P P  IE    G  +C+  Y   + G++ + V      +  SP+  + MP       P+K  A   G +   + V K +  T++ K  GK  +     KI+ Q        +  + + V+V+++ +G  S  Y P++  ++ V V +GG +IP   F           +      V      +    A+    F ++  +    D++      A VV P+    +  I  NDN    +K  Y P   G + + V    + I  +P +  VD +    +V A GPGLS SG   N+   FT+ TK AG   L     GP+K     +    DNHDGT  V Y P   GN  + + +   PI  SPF   I     + K +VA       VG   EI +K   +     + A++T PS   VPC ++  ++     V F P++ G + V +   G  IPGSPF +        D +KV+ SG GLE+    +  +F +D  +AG   L I I  +  ++AE+  +DN +G  T+ Y+P  PG Y + + Y  ++VP  P  ++VE       ET  ++     V+   V      +  +D  AL       +K  ++ PSG      I D G+G  ++++   E G H V V +    +  SPF+     VT G     V   GPGL+ G  +  N+F + TR AG G + +AMEGPS+A+M   +++D GSC V Y   +PG Y  ++ + G+ I  SPF + V D
Sbjct:  276 PLRPK----LNPKKARAYGPGIEPTGNVVMKKAVFTV---ETISAGQGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMAQGDSSKVTAQGPGLEPAGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEACNPSLCTAKG-----RGLQPKGLRV------KETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKIGSEAGPQQVRAWGPGL--ESGVVGKSADFVVEAVGDDVGTLGFSVEG-------PSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPL-----KIQAQD-------RDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNK----VKVSGPGVAKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTVK--YTPPGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPSLDLSKVKVAGLGSKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPT--DPSKVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVE----PAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRV---PVTEGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKD-GSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHD 1355          

HSP 7 Score: 71.633 bits (174), Expect = 4.694e-95
Identity = 83/298 (27.85%), Postives = 120/298 (40.27%), Query Frame = 2
Query: 4823 ITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKK--AKFFVNTSNAGSGSLNVAIDGPS--KVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPF--TAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
             +V A    +  L+  VQ P G +EPA V   GD  + V + P   G + + V    + I  SP+++ V     D   V  SG GL+   V      +F ++  +AG G L V I  P       N  + +DG Y  +YV    G Y I I YGG+  I  SP+   A+  G+ S   V                  VS       + V   I         ++       VDA  AG G +   +  P     +V V    +  F + Y   + G ++I VR+G + IP SPF V V
Sbjct: 1381 FSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKV-LPTHDASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGD-EIPYSPYRIRALPTGDASKCTVT-----------------VSIGGHGLGAGVGPTI---------QIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTV 1650          

HSP 8 Score: 270.781 bits (691), Expect = 1.328e-82
Identity = 320/1218 (26.27%), Postives = 523/1218 (42.94%), Query Frame = 3
Query: 1230 KPDQPSSKVIVYGKGLEKVA--AKEKAIFTIDSKDAPSAPIGVTVEGPG----EAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQ--TNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQC--HDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPA-----QVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKA-GKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPS--GCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTK---GEGRVTAFGPGLSSGTTNEVAEFTIITKDA-GPGGLSLIVEGPSKTEIKCEDN---HDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVA----------VGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLE-KGLANQG-NEFTIDTR---DAGYGSLNISIEGPS--KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNV-EGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV-GSVTPGGSKDVTASGPGLEKGF-IDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKG--SCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            +P     K   YG G+E       +KA+FT+++  A    + V VE P     EA +   ++ + T  V Y   V G + + VL+   HI +SP  V V        D S VTA GPGL P G   +    F V     +  G G V+ ++  PSGK+      +++  N  Y   Y PT+EG H I +T+ G  I  SP+ V      N  L TA G GL     +V E  +F V   GAG G L + I+GP   E  C   D  DG    +Y P   G+Y I++ +  + I  SPF V++  E  P++V++ GP ++   + +   F ++        L   V  P       P  I + +    G+ DV Y P E G   + V      I  SPF   ++ PA       +KVK  G G+  Q+  +    PA F V+ K  G  P + +   + +G P+ + ++   NG Y+C Y       H + V   G  +P+SP+ +      +P K  +   G  KT ++    +  T++  EAG+G I+  + K     VG  E     D I+     + +   +V Y P   G Y + V +  Q+IP          S    +        ++   EL        +F +NTK      L+A+   P+    + +  I  N +  H +K  Y P ++G   L V   G PI  SPF   +       + +V   G  ++ G   E+   T+ +K A G G +   V GPS   + C+        T +V ++P+  G Y + + +   PI GSPF       P   S+V           VG   +  +   ++  + LT E+ + +  +    I+   +G   +++ P   G + + +     D+P  P +++V  E   + + VKV G G+E KG+  +   +FT+D R     G   +   I  PS  + E   +D  +G   V+Y P E G + + V Y    VP SPF V V EG     C+  ++      +++       +  ++        L + +  PS     C   D  +G+  ++++  E G ++++V +  + I GSPF   V  +V P     V   G GL      +I   F++   +AG   + V ++GP K  ++  E  D G  +  V+Y  ++ G Y  ++ +  E I  SP+ + V
Sbjct:  278 RPKLNPKKARAYGPGIEPTGNVVMKKAVFTVETISAGQGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTVLFAGQHISKSPFEVDV---GMAQGDSSKVTAQGPGLEPAGNIANKTTYFDV---YTAGAGVGEVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEACNPSLCTAKGRGLQPKGLRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKIGSEAGPQQVRAWGPGLESGVVGKSADFVVEAVGDDVGTLGFSVEGP------SPAKI-ECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIM-PAPGKDFYPDKVKAYGPGL--QSSGLSVGKPAEFTVDAKLGGKAP-LKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNKVKVSGPGVAKTGLKAYDPTYFTVDCAEAGQGDISIGI-KCAAGVVGPAEADIDFDIIR-----NDNDTFTVKYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKP----THFTVNTKAAGKAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVK--YTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPSLDLSKVKVAGLGSKMTVGKDQEI---TVKSKGAGGQGKVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIA-PTDPSKVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHV--EPAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTEG-----CDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSC--TDNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHDTVDP---TKVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGP-KGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKV 1449          

HSP 9 Score: 58.9214 bits (141), Expect = 1.328e-82
Identity = 77/309 (24.92%), Postives = 120/309 (38.83%), Query Frame = 2
Query: 4817 ISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRI---PVGHYKADPGMVHASGEGLSHAI-----VDKKAKFFVNTSNAGSGSLNVAIDGPS--KVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVR-PCEEVVVKHVGNNQ---FTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            +  T+ A+D     L   +  P G  + A ++   DG Y V + P   G + + ++     I  SP+RI   P G        V   G GL   +     + ++    V+   AG G +   +  P   +V+++  E EDG ++  Y A  PG Y+I + +GG  HI  SPF   V              H  + I          +   S   +        GL  A L   +       Q G       I G VR P  +V    + +N+    TV Y   E+G H + +++    IPGSP   +VD
Sbjct: 1476 VEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGE-HIPNSPFQVTVH--------TCHAHHLFIHI---------SFISNSGQTLTNGQLGMNGLDVAGLRPFDLVIPFTIQKGE------ITGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVD 1760          

HSP 10 Score: 275.789 bits (704), Expect = 7.926e-74
Identity = 328/1252 (26.20%), Postives = 524/1252 (41.85%), Query Frame = 3
Query: 1248 SKVIVYGKGL-EKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAV--IDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTAS---------GPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPF-------HXXXXXXXXXXXXXSKGPIKDAKL---------LRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSP--FKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDV--GDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGR----VTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCE--DNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANIT-------------GEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGL-ANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDC--KDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKD-RHIRGSPFQFTV-GS----------------------------VTPGGSKD----VTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPS-KAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            +KV   G+GL   V A    +F++D+  A  AP+ V V+GP   V   + VDNGD T  V Y     G Y+INVLY +  IPQSP  V V P      D S V  SGPGL+  GV      +FT+DA +    G+G +   +  P GK     I +  +G Y+V Y P   G + I + Y G  I  SP+ ++A P  +A   T +              + ++ E+T   VD   AG G +   +  P   E+     +N+DGT  + YT  + G Y I V+F  E I +SPF       H   +         S   + + +L         LRP    I  +   K  +   V  P   ++   +T  +      GT  V Y P E G   +D+KY+   I GSP  F  + V    V      G G+I      + + PAVF VNTKDAG       GL      P    I    N   TC      V  GD+ I V  +   +P SP+  K   TG+       + +   ++V   + I ++  E    Q+T T+     +     E+  +L  ++       +G   + ++PKE GE+LV +K  G+ IP+     +   +  E+ +     V  Q  +E  +  F    F I+T+D     L+  +  PS    +V I + D      K+ Y P+E G + + +    + + GS F   V   GEGR    +T      S        + ++   +     ++  V  PS    K E  +  + T+ + +VP   G + + +K++ Q + GSPF   +              G  +++++  V   +E  +    +    L+  +  PSK ++    +   +G+ GVS+  +E G++ V++      IP SPF V V +    DA ++ V+    E GL  NQ   F +    A  G ++  +  PS A  +C   + +     V+++P E G Y+I+V + G ++PGSPF + V G+     +   +      ++    G  CE  +         L V +  PS     C     G    ++ +     G + +S+ +    HI GSPF+  + GS                              PG +      V A G GL KGFI   N F++   +AG   + V ++GP    E    +        V+Y++ + G+Y   +K+  EHI  SP+HI V
Sbjct: 1360 TKVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTH----DASKVRCSGPGLNTTGVPASLPVEFTIDAKDA---GEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTVHTCHAHHLFIHISFISNSGQTLTNGQLGMNGLDVAGLRPFDLVIPFT-IQKGEITGDVRMPSGKVAKPDITDNK-----DGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAY---GPGLIHG----MVNKPAVFTVNTKDAGEG-----GLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKI--TGD------DSMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGR-----EEPCLLKMLR-------NGHVGISFVPKEIGEHLVNIKKNGRHIPSSPI--SVMINQSEIGDASRVRVTGQGLSE--ARTFEPAEFIIDTRDAGYGGLSLSIEGPS----KVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFT--VKVTGEGRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGV--PAEFSIWTREAGAGGLSIAVEGPSKAEI--AFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPS-DDARRLTVASL-QESGLKVNQPASFAVSLNGA-KGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRV-GETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPEG---YKVTYTPMAPGNYLISIKYGGPYHIVGSPFKAKITGSRLVNSHSMHETSSVLVDPVTRSMTTSQQAAPGWASSDASRVVAKGLGLNKGFIGQKNTFSVDCSKAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDEHIPGSPYHITV 2545          

HSP 11 Score: 241.891 bits (616), Expect = 2.319e-63
Identity = 322/1241 (25.95%), Postives = 507/1241 (40.85%), Query Frame = 3
Query: 1230 KPDQPSSKVIVYGKGLEKVAAKEKAI--FTIDSKDAPSAPIGVTVEGPGEAVIDCVDN-------------GDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGL-HSCKVNEKTQFVVDLDGAGHGSLGLAIEGPAD----AEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLL---RPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKV-----DGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAI------KAGKDKT---IQVNKESVITIETKEA------GKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHG-VN----FEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKC--EDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPV-KKSQVAVGNS----------SEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNE--FTIDTRDAGYGSLNISIEGPS----KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVE-----GDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGA-GNISVAMEGPSKAEMKFQESQ-DKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            +P   +S V V+G G+E      +A   FT+D++        +T  G G  +  C++N             GDGT  V Y     G +++ V YD+  +P+SP  VPV     +  D + V   GPGL  +    +   KFTV   E    G G +   ++ PS  + +   DN  +G   V Y P E G + +NVTY G PI  SPF V      +   V   G GL ++ + N    F VD   AG   L + ++GP      AE+   DN D T  V Y P + G Y I+V + DE+I  SP+ V+V+      KV+  GP  +   +    P  FTID  +AG+  L V+++ P     D       +     GT+ V YVP+  G   I +KY    I  SP++   +      K  V                I      V  V+ K AG    V   +  P+G  + + +    +G +   Y     G + I V   G  +P SP+ V ++ T +     I       +G+  T   + +N   V  +   +        KG+IT  V    R   G+V +  + D        + DG  +V Y P E G + +++KY G  IP         Y            V +           HG VN    F +NTKD     L+  +  PS    +  I+  DN      + Y P   G + + V    + I GSPF   +      R++    G ++    ++ E  +         L+  +  PS  E  C  +   +G   +S+VP+  G + + IK   + I  SP +  I    +   S+V V             +E  +    +    L+  +  PSK+ +    +   +G   V++ P E G +++N+      +PGS F V V  E      K  ++ K     +AN G++   ++   +     +   +  PS    KAEI   + EN    ++++PTE G + ++V Y G++VPGSPF   V      G   V      +ER +  V A       E ++   E     L + V  PS        ED  +G+  + ++ +E G + VS+   D HI  SPF   V S +    +   AS   L++  + +N   +      GA G I   +  PS A  +   ++ D+   AV +   + G Y   +KFNG HI  SPF I V
Sbjct: 1161 EPAVETSGVKVFGPGVEGKGVFREATTDFTVDAR-------ALTKTG-GNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPV----TEGCDPARVRVHGPGL--QSGITNKPNKFTV---ETRGAGTGGLGLAMEGPSEAKMS-CTDN-KDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHDTVDPTKVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVV--DNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDP-----DGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKG-KVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQV-TVHTCHAHHLFIHISFISNSGQTLTNGQLGMNGLDVAGLRPFDLVIPFTIQKGEITGDV----RMPSGKVAKPDITD--------NKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDY------------VNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPS----KADISCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKITGDDSMRMSHLKVGSAADIPLDIGELDLSQ-------LTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINT--EDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTGE---GRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEI--MEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPA-------EFSIWTREAGAGGLSIAVEGPS--KAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPSDDARRLTVAS---LQESGLKVNQPASFAVSLNGAKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRV 2319          

HSP 12 Score: 137.502 bits (345), Expect = 1.070e-31
Identity = 100/281 (35.59%), Postives = 135/281 (48.04%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGL-KQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++  +  PSGN   A+++ +GDG Y V+++P E GTH V V  +  P+  SPFR+PV     DP  V   G GL   I +K  KF V T  AG+G L +A++GPS+  M+C + +DG     Y+   PG Y +N+TYGG   I GSPF+  V      T                                 K+ CQG GL    R N    F VDAS+AG   L V + GP    E   V   G+   TV YV    G + I V + D++IP SP+ V V
Sbjct: 1204 IKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTE-GCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCCVEYIPYEPGTYNLNVTYGGQ-PITGSPFSVPVHDTVDPT---------------------------------KVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKV 1449          

HSP 13 Score: 128.257 bits (321), Expect = 6.758e-29
Identity = 85/285 (29.82%), Postives = 141/285 (49.47%), Query Frame = 2
Query: 4847 EIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++ +L A++ TPSG  EP +++ + +G  G+ F P+E G HLV ++ N + I  SP  + +   +  D   V  +G+GLS A   + A+F ++T +AG G L+++I+GPSKV++N  + EDG  + TY  T PGNYIINI +  + H+ GS FT  V G              +++   + KR  +  A   S       C  L LK   ++  +             +   +  P     +  +    NN + + +V  E G H + V++  + +PGSPF   V
Sbjct: 1878 DLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKF-ADQHVPGSAFTVKVTG------------EGRMKESITRKRRAASVANVGSQ------CD-LSLKIPEISIAD-------------MTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTV 2129          

HSP 14 Score: 105.145 bits (261), Expect = 8.236e-22
Identity = 78/307 (25.41%), Postives = 136/307 (44.30%), Query Frame = 2
Query: 4781 HRENHREDAGGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHY-KADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYE-FTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
             R     + G    ++++  +  I  + A V +PSG +  A + +  +  Y ++F P E G H V V+   + + GSPF+  VG   +     V A G GL  A     A+F + T  AG+G L++A++GPSK  +   + +DG    +Y+   PG+Y ++I +  + HI  SPF   V                                   S +  ++    L     ++N   SF V  + A  G++   +  P    EE  V  +  +++ V ++ +E+G ++I V++    IPGSPF + V
Sbjct: 2047 RRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKF-NDEHIPDSPFVVPV--------------------------------ASPSDDARRLTVASLQESGLKVNQPASFAVSLNGA-KGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRV 2319          

HSP 15 Score: 102.064 bits (253), Expect = 6.918e-21
Identity = 81/304 (26.64%), Postives = 134/304 (44.08%), Query Frame = 2
Query: 4802 DAGGL----ISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            D  GL    + I    + GEI      V+ PSG +    +    DG   VK++P E G H + ++ +   I GSP +  V +  +  G V A G GL H +V+K A F VNT +AG G L++AI+GPSK +++C + +DG    +Y+   PG+Y I + Y  + +I GSPF + + G+ S                                         + +   ++ S     +D  +     L   +  P    E  ++K + N    + +V KE G H++ ++   + IP SP  V ++
Sbjct: 1683 DVAGLRPFDLVIPFTIQKGEI---TGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNS--GHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYNIIVKY-NDKNIPGSPFMSKITGDDS-----------------------------------------MRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMIN 1939          

HSP 16 Score: 97.8265 bits (242), Expect = 1.198e-19
Identity = 88/329 (26.75%), Postives = 150/329 (45.59%), Query Frame = 3
Query: 3795 EHLVNVY----EKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLE--KGLANQGNEFTIDTRDAGYGSLNISIEGPS----KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNV---EGDKV-VPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGF--TEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLE-KGF-IDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQ-DKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            EH V  Y     K    PG+P +  +      +  K +  G G+E    +  +   FT++T  AG G + + +E P+    +A++   +++N   +V Y+P   G + + V +AG+++  SPF V+V   +GD   V  +   +E        T        ++      + +++V +  PSG   T  C +ED GN + R  +   + G H + +      I  SP+   VG          TA G GL+ KG  +    EF +YT+ AG G++ V ++GP   E   ++     G  +  Y  S PG+Y  +I + G+HI  SPF +
Sbjct:  256 EHSVMTYLSQFPKAKLKPGAPLRPKL------NPKKARAYGPGIEPTGNVVMKKAVFTVETISAGQGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMAQGDSSKVTAQGPGLEPAGNIANKTTY-----FDVYTAGAGVGEVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEAC--NPSLCTAKGRGLQPKGLRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEV 571          

HSP 17 Score: 93.2041 bits (230), Expect = 3.798e-18
Identity = 93/302 (30.79%), Postives = 127/302 (42.05%), Query Frame = 2
Query: 4826 TVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQ--YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHA--IVDKKAKFFVNTSNAGSGSLNVAIDGPS--KVNMNCHETEDG---YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPV---RPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            T+ A  GE+      V+ P+G+ E A V    D    Y V + P+  G H V V    + I+ SPF + VG  + D   V A G GL  A  I +K   F V T+ AG G + V I  PS  K  + C   + G   Y  TY  T  G +II IT+ G   I  SP+T  V                                E  + ++     +GL  K  R+     F V    AG G L V I GP     PC++   K +G+  ++ DY     G +II + WG + IP SPF V +
Sbjct:  310 TISAGQGEV---LVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMAQGDSSKVTAQGPGLEPAGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGG-QISKSPYTVNV-------------------------------GEACNPSLCTAKGRGLQPKGLRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKK---KDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKI 573          

HSP 18 Score: 91.6633 bits (226), Expect = 1.051e-17
Identity = 93/353 (26.35%), Postives = 139/353 (39.38%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEP--AIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHA--IVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG---YEFTYVATAPGNYIINITYGGNFHIVGSPFTA-----------------------------VVE--GNKSATNVNQEEQHSQVEIEASDK---RC-VSQYAEKSSSNVEKIICQ-----------------------------GLGLKQARLN--SVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++E  +  PSG  +     V+  G+  Y   + P + G H++++      I+ SP+ + VG    +P +  A G GL      V + A+F V T  AG+G L V I GP  +   C + + G   Y F Y  + PGNYII IT+GG  HI  SPF                               VVE  G+   T     E  S  +IE  DK    C V  +  +       ++C+                             G GL+ + L+      F VDA   G   L +          +V VK  GN  ++  Y  ++   H +MV WG  +IP SPF +++
Sbjct:  417 EVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGE-ACNPSLCTAKGRGLQPKGLRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQ-HIPRSPFEVKIGSEAGPQQVRAWGPGLESGVVGKSADFVVEAVGDDVGTLGFSVEGPSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPLKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNI 767          

HSP 19 Score: 80.1073 bits (196), Expect = 2.918e-14
Identity = 78/287 (27.18%), Postives = 117/287 (40.77%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQ-IGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAI--DGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDA---SQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            K+ A V  PS    P  V+  +      V+F PR+ G + V +  +  PI GSPF I       DP  V  SG GL  A V +  +F V+ +NAG   L + I  D  ++  ++  +  DG Y  TYV   PG Y + I Y                G++   N      H +  +E S                 K+   G+  K     +   F VDA   ++ G   +   I  P     E +++ +G+  + V+Y   E GTH + V +    +P SPF V V
Sbjct: 1007 KVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEA-IAPTDPSKVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRY----------------GDQDVPNF-PARLHVEPAVETSGV---------------KVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPV 1260          

HSP 20 Score: 74.7146 bits (182), Expect = 1.304e-12
Identity = 70/265 (26.42%), Postives = 113/265 (42.64%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAG-SGSLNVAIDGPSKVNMNCHETEDGY-----EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            DG + VK++P + G   + V     PI  SPF + +     D   V  +G G S   V K  +  V +  AG  G +   + GPS  ++ C + E G      +  ++    G Y + +TY G   I GSPF                       IEA            + ++  K+ C G GL++A++     F VD + AG   L + I        EV ++  G+  +T+ YV    G + + +R+GD+D+P  P  +HV+
Sbjct:  934 DGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAP-SLDLSKVKVAGLG-SKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPC-KVEPGLSPETSQVRFIPRDKGPYEVELTYDGA-PIPGSPF----------------------PIEAI-----------APTDPSKVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVE 1161          

HSP 21 Score: 65.855 bits (159), Expect = 5.832e-10
Identity = 73/265 (27.55%), Postives = 107/265 (40.38%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHET---EDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVR---PCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDK-DIPGSPFMVHV 5695
            DG  GV +  +E G + V ++ N + I  SPF +PV     D   +  +    S   V++ A F V+  N   G ++  +  PS     C  T   ED Y   ++    G Y+I++ + G+ HI GSPF            V +  Q       A D   VS Y              G GL+     S   F V+ S AG G L V I GP +    C+E          + V Y     G ++I +++G    I GSPF   +
Sbjct: 2189 DGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPSDDARRLTVASLQESGLKVNQPASFAVSL-NGAKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGS-HIPGSPF---------KIRVGETGQ-------AGDPGMVSAY--------------GAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQEC------PEGYKVTYTPMAPGNYLISIKYGGPYHIVGSPFKAKI 2415          

HSP 22 Score: 59.6918 bits (143), Expect = 4.535e-8
Identity = 64/261 (24.52%), Postives = 101/261 (38.70%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNC--HETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            DG   V + P   G + + V+ N K I GSPF   +     D  M       +SH  V   A   ++        L   +  PS     C      +G+   ++V    G +++NI   G  HI  SP + ++               +Q EI                 +  ++   G GL +AR      F +D   AGYG L + I GP +   ++  +   +    V Y   E G +II +++ D+ +PGS F V V
Sbjct: 1816 DGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPF---MSKITGDDSMR------MSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGR-HIPSSPISVMI---------------NQSEI----------------GDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSK--VDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKV 2033          

HSP 23 Score: 55.8398 bits (133), Expect = 7.081e-7
Identity = 73/309 (23.62%), Postives = 117/309 (37.86%), Query Frame = 2
Query: 4823 ITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVD--KKAKFFVNTSNAGSGSLNVAID------GPSKVNMN---CHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQA--RLNSVNSFFVDASQAGYGILLVGIAGP-----VRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
             TV A+ G    L+   Q   GN     V+  G+G Y   ++PR+   H V V      I  SPFR+ +G     P  V  SG G++   +       F V+ + AG G +++ I       GP++ +++        D +   Y     G+Y I + +                        +Q    + + I+              S +  K+  +G GL ++   LN    F V+   AG   L     GP     VR   +++  H G +  TV Y   + G   + V +G   IP SPF V +
Sbjct:  699 FTVDAKLGGKAPLKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGA-GCHPNKVKVSGPGVAKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTVKYTPPGAGSYTIMVLF-----------------------ADQTIPMTPIRIKVD-----------PSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDF-DIIDNHDGTH--TVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAI 969          

HSP 24 Score: 55.8398 bits (133), Expect = 8.168e-7
Identity = 74/308 (24.03%), Postives = 116/308 (37.66%), Query Frame = 2
Query: 4799 EDAGGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVD--KKAKFFVNTSNAGSGSLNVAIDGPSK----VNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVR---PCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVH 5692
            E   G ISI ++   G +   EA +          I++   D  + VK++P   G++ + V    + I  +P RI V     D   V A G GLS + V+  K   F VNT  AG   L+    GP+K     + +  +  DG +   Y     GN  +N+TYGG+  I  SPF   +                                   S ++ K+   GLG K                 G G +   + GP     PC+  V   +      V ++ ++ G + + + +    IPGSPF + 
Sbjct:  802 EAGQGDISIGIKCAAGVVGPAEADIDF-------DIIRNDND-TFTVKYTPPGAGSYTIMVLFADQTIPMTPIRIKV-DPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGD-PIPKSPFAVAI---------------------------------APSLDLSKVKVAGLGSKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPCK--VEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIE 1064          
BLAST of Filamin-A vs. Ensembl Zebrafish
Match: CR352234.2 (filamin A, alpha (actin binding protein 280) [Source:NCBI gene;Acc:562529])

HSP 1 Score: 816.994 bits (2109), Expect = 0.000e+0
Identity = 588/1677 (35.06%), Postives = 854/1677 (50.92%), Query Frame = 3
Query:   42 EVTYRPQECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVK-----LQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPM-IEVCAPQTFKVLSPEK--------------VINPDLVDVQ--VLNPENKIIPIHKEAAPDGTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTI--------------VKDNTNDDIHDFDVVVLSPDNH------QPIPVKSKKLPKGLLCEF----IPKKAGPYSLVASVDNNPIK----GSPQTIVVQESPLITEEPILSEQIKTLKAGNPHNPMQ--KANPGKSNKPYTALEEAIKEMK-----ESAVESSKWPQS-------KPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTV--EGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXX--XXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAG---------KDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQT-----ATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDL-----------NAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGE-PVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV---EDDSIKPVAARAVSSSF 4781
            +V Y P E P   A+H  V    EDI  SPF            Y   ++   P ++     + +P  F V    G K+   +   D++G PV+ V VK     TY  +YTP K  +H +  S  G  + ++P  +++      N  K+   G+A   ++   P  F V   E               V+ P   D+   ++  +N           D   V + P   G ++I     DQ I  TP  +K  P    H+A   K+    L+    E  +NKP  FT+                 N  D + DFD++    DNH      +  PV+   +  GL   +    IPK     ++  S+D + +K    GS  T+   +   +  +    +     K   P       K  PG S  P T+    I   K     E   + +  P S        P  PS KV   G GLE+    E   F +D  +A  A + + +  +   EA +   DNGDGT  + Y    PG YT+ + Y +  +P  P  + V P     ++ S V   GPG+  +GVF++    FTVDA  +++ G   +K  + +PSG +T  LI +L +G Y V YTP EEG H + V Y+  P+  SPF V    G +   V   GPGL S   N+  +F V+  GAG G LGLA+EGP++A++ C DNKDG+C VEY P + G Y+++V +  + I+ SPF V V D V     K + +G   + +   P  F++D S+AG APL+V+V  P  G+    V   +V      T  V YVP   GP  I+V Y    I  SP+K  V+      KV+  G G+      + AS+P  F ++ KDAG    + V + +P+G+P   +I    +G Y   Y     G + I +   G  +P SPY ++++PTG+  KC +               TIQ+ +++VIT++ K AGKG++TCTV   +  +V             V V E+ DG   + Y   + G+Y++ V++GG+ IPN  F  T     A + F  +   ++ S Q   + +L  N               P DL              V  PSG + +  IT  DN    + + Y P+E G H++ +   G  I GSP QF+VD    G VTA+GPGL  G  N+ A FT+ TKDAG GGLSL +EGPSK +I C DN DGT  VSY+P  PG+YNII+K+ D+ I GSPF + ITG+  ++ S + VG++++IPL I   DLS LTA LTTPS  + PC++K + NG +G+SF PKE GEHLVN+ + G  IP SP  V +   E+GDA++V+V+G+GL +    +  EF IDTRDAGYG L++SIEGPSK +I+ +D E+G C V Y PTEPGNY+IN+ +A ++VPGS F V V G+  +    + + R + A     VG  C+++LKI E+++ D+   V +PSG     +I +  N    I+FV  E G+H VSV ++ +H+ GSPFQFTVG +  GG+  V A GPGLE+    +  EF+I+TREAGAG +S+A+EGPSKAE+ F++ +D GS  V+Y V +PGDYE SIKFN EHI +SPF + V    DD+ +   A    S  
Sbjct:  635 DVRYWPTE-PGEYAVH--VLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPLKIQAQDRDGNPVD-VQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNKVKVSGPGVAKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDN-----------DTFTVKYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPS---HDASKVKAEGPGLSRSGVE--LNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDFDII----DNHDGTHTVKYTPVQQGNM--GLNVTYGGDPIPKSPFAVAIAPSLDLSKVKVAGLGSKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPCKVEPGLS--PETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPS-KVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPA----VETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTEGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHDTVDPTKVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGP-KGV----VEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGL--NTTGVPASLPVEFTIDAKDAGEGL-LAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEV------------DVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTVHTCHAHHLFIHI-SFISNSGQTLTNGQLGMNGLDVAGLR-------PFDLVIPFTIQKGEITGDVRMPSGKVAKPDIT--DNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKITGDDSMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTGEGRM---KESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKD-GSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPSDDARRLTVASLQESGL 2244          

HSP 2 Score: 250.366 bits (638), Expect = 0.000e+0
Identity = 127/283 (44.88%), Postives = 179/283 (63.25%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGH--YKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEK--SSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++A V +PSG +E   V +I + +Y V+F PRE G +L+ V+ N   I GSPF+I VG      DPGMV A G GL         +F VNTS+AG G+L V IDGPSKV M+C E  +GY+ TY   APGNY+I+I YGG +HIVGSPF A + G++   + +  E  S +    +     SQ A    +SS+  +++ +GLGL +  +   N+F VD S+AG  +LLVG+ GP  PCEE++VKH+GN  + V Y +KE G +I++V+WGD+ IPGSP+ + V
Sbjct: 2263 IDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPEGYKVTYTPMAPGNYLISIKYGGPYHIVGSPFKAKITGSRLVNSHSMHETSSVLVDPVTRSMTTSQQAAPGWASSDASRVVAKGLGLNKGFIGQKNTFSVDCSKAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDEHIPGSPYHITV 2545          

HSP 3 Score: 505.368 bits (1300), Expect = 5.746e-146
Identity = 478/1664 (28.73%), Postives = 729/1664 (43.81%), Query Frame = 3
Query:   33 DLYEVTYRPQECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDL-KPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKN-GVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKE--AAPDGTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLC-EFIPKKAGPYSLVASVDNNPIKGSPQTIVVQES----------PLITEEPILSEQIKTL--------KAGNPH------NP--------MQKANPGKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQPSS------KVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKV--NEKTQFVVDLDGAGHGSLGLAIEGPADA--EIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDA----------KLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKD-AGVNP-DVIVGLFNPNGE-----PMPLHIEARPN------GLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVD--------LNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVA----------VGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVN---------VHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKD-VTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNG-EHIVNSPF 4718
            D + V Y P   P + +    V    + IP +P  I      + SK       L +  V+L +P  F V      K++     +  N G  V    +      T+   YTP + G   +  +  G P+ K+P  V++   +  ++ K+KV GL   + V   Q   V S +       V  +V  P  K +P   E   +P+ ++V F+P++ GP+ +       PI  +P  ++++   D  +   + S P       +  +V +P  F +  D TN    +  + ++S DN     V  +    G     ++P   G Y+L     +  +   P  + V+ +          P +  + +  E             K G  H      NP        ++    G     YT  EE    + E A +SS  P+S    P +      +V V+G GL+     +   FT++++ A +  +G+ +EGP EA + C DN DG+C V Y    PG Y +NV Y    I  SP  VPV+      +D + V   G GL    V  +    F+VDAS+    G   ++  VQ P G      + +  +  + V Y PT EGP+ INV Y    I  SP+ VK  P  +A  V  SGPGL++  V  +   +F +D   AG G L + I  P     +    DN+DGT LV Y P   G Y I +K+  ++I  SP+ +  +      K      I             ++      T+D   AGK  +   V  P  G  D  V   +      GTFD+ Y   + G  +I V++    I  SPF+  V        + +     I  +G  L +      +N  D AG+ P D+++      GE      MP    A+P+      G  T +Y   + G H++ +  DG  +P SP         +    A   G    + VNK +V T+ TK+AG+G ++  ++   +  +                 ++ DG  +V Y+P   G+Y + VKY  ++IP   F    T                        ++    + ++ +   +P+D        L A +  PSG   E P         ++ I + P E G H + +   GR I  SP    ++    G   RV   G GLS   T E AEF I T+DAG GGLSL +EGPSK +I  ED  DGT KV+Y P  PGNY I IKF DQ + GS FT  +TGE   K  +           VG+  ++ LKIP   ++ +TA++T+PS       I +  N    + F P E G H V+V  +G  +PGSPF+  V     G A KV+  G GLE+  A    EF+I TR+AG G L+I++EGPSKAEI  +D ++G   V Y+  EPG+Y +++ +  +++P SPF        VVP  +   +  +  V + Q     E  LK+++ A   + +N         VH+PSG  E C + +       ++F+ RE+G++ + V     HI GSPF+  VG     G    V+A G GLE G      EF + T  AG G ++V ++GPSK +M  QE  +     VTY    PG+Y  SIK+ G  HIV SPF
Sbjct:  836 DTFTVKYTP---PGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPSL--DLSKVKVAGLGSKMTVGKDQEITVKS-KGAGGQGKVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPSKV--RCSGPGL-----ERAKVGEPGQFVV--DCTNAGPAELTIEIIS-DNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSV-EVAYDSSPVPKSPFRVPVTEGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVH----DTVDPTKVKCQGQGLG-NNVRANIPQVFSVDASKA---GMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENE-----DGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTV-HTCHAHHLFIH-ISFISNSGQTLTN--GQLGMNGLDVAGLRPFDLVIPFTIQKGEITGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAYGPGLIHGM-VNKPAVFTVNTKDAGEGGLSLAIEGPSKADI--------------SCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKIT----------------------GDDSMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSG--REEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTGEGRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPF--------VVPVASPSDDARRLTVASLQ-----ESGLKVNQPASFAVSLNGAKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPE--GYKVTYTPMAPGNYLISIKYGGPYHIVGSPF 2411          

HSP 4 Score: 395.971 bits (1016), Expect = 6.367e-111
Identity = 358/1216 (29.44%), Postives = 558/1216 (45.89%), Query Frame = 3
Query: 1245 SSKVIVYGKGLEKVA--AKEKAIFTIDSKDAPSAPIGVTVEGPG--EAVIDCV--DNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSK----GPIKDAKLL---RPNHFTIDCSEAGKAPLEVKVSKPGSGISDR---PVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAG-----VNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKA-GKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKD---GVPVDLNAKVVRPSGCMEEVPITSNDNYK-HNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF-FVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLS--LIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEP-VKKSQVAV---GNSSEIPLKIPSSDLSTLTAELT------------TPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINL------KIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFI--DINNEFAIYTREAGAGNISVAMEGPSKAEMK--FQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            SSKV   G GLE     A +   F + +  A    + V +  P   +  ++C   D G+ +    Y+    G + I + +    I +SP  V V    N +L     TA G GL P+G+     A+F V        G G +K  ++ P G +      +L +G Y   Y P+  G + I +T+ G  I  SPF VK       Q V A GPGL S  V +   FVV+  G   G+LG ++EGP+ A+I+C D  DG+C V Y P + G+Y + V   +EDI  SPF  E++     +    K    GP   +  L   +P  FT+D    GKAPL+++         DR   PV + QV+    GT+   Y P +     + V +    I  SPF+ N+       KVKV G G+      + A  P  F V+  +AG     +      G+  P    +   I    N  +T +Y     G + I V      +P +P  +K  P+ +  K   +  G  ++ +++NK +  T+ TK AGK        K++ Q  G  +   V D     + ++ DG  +V Y P ++G   + V YGG  IP   F      S    +  +           L S    G + EI  K    G    + AKV  PS   + VP            ++ + P ++GP+++++   G PI GSPF    +      +V   GPGL      E  +F +   +AGP  L+  +I +  ++ E+  +DN DGT+ ++YVP  PG Y + I++ DQ +    F A +  EP V+ S V V   G   +   +  ++D +     LT             PS  +   +I+ + +G   V +TP E G H V V    + +P SPF+V V   E  D  +V+V G GL+ G+ N+ N+FT++TR AG G L +++EGPS+A++ C DN++G C V+Y+P EPG Y +NVTY G+ + GSPF+V V  D V P + +         +   +G N   N+         +  +  L+V V  P G  EP ++ D G+    + +V    G + ++VL+ D  I  SP++  V  +    +  V  SGPGL    +   +  EF I  ++AG G ++V +  P     K   +++QD G+  V+Y     G Y   IK+ G+ I  SP+ I
Sbjct:  383 SSKVTAQGPGLEPAGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEACNPSL----CTAKGRGLQPKGLRVKETAEFKV---YTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKIGSEAGPQQVRAWGPGLESGVVGKSADFVVEAVGDDVGTLGFSVEGPSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPLKIQA-------QDRDGNPVDV-QVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNKVKVSGPGV--AKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTVKYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKA-------KLDAQFTGPNKGDAVRD---FDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPSLDLSKVKVAG---------LGSKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSA--KSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPSKVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPN--FPARLHVEPAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVT--EGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVH-DTVDPTKVK--------CQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKV--LPTHDASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQD-GTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRI 1544          

HSP 5 Score: 371.318 bits (952), Expect = 3.104e-103
Identity = 410/1600 (25.62%), Postives = 659/1600 (41.19%), Query Frame = 3
Query:    9 ETKPTKTPDLYEVTYRPQECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKI---KVEGLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEE---KEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLC-EFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPILSE--------------QIKTLKAGNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKWPQS-------------------KPDQPSSKVIVYGKGLEK--VAAKEKAIFTIDSKDAPSAPIGVTVEGPGEA--VIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVD-------LDGAGHGSLGLAI-----EGPADAEIQC----------HDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVV--QPAQVEKVKVDGDGIIPQN-GAI-LASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTV--KSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVP----VDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLKI--PSSDLSTLT-------AELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNV-KNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAG-KNVPGSPFNVNVEGDKVVPCE-------------TQKMERVQEAVKATQ------------------VGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV 4442
            + +P  +P+  +V + P++         ++T  G  IPGSPF I      + SK   +   L+   K+ +P  F V   +   +E  + +   NG   E V ++     TY  TY P   G + +T     + V   P  + V   +  +  K+    VEG     E     T    +  K    + +   + NP             DGT +V + P E G HS+       P+          PK+     + +   PA + V     + G  NKP  FT+  +          + +  P   +     +K    G  C E+IP + G Y+L  +    PI GSP ++ V ++   T+     +               +   KAG     ++   P    +P   ++   +    S V + + P S                    P   +SKV   G GL    V A     FTID+KDA    + V +  P       +  DN DGT  V Y   + G YTI + Y    IP SP  +   P  + +    TV+  G GL           + TV   +    G+G V   V +P G + +  +    +G + + YT  + G + I V + G  I +SPF V         L       +H   ++   Q + +       LD AG     L I     +G    +++            DNKDGT  V+Y P +AG +++ +K++   I  SP    V              +    + +P  FT++  +AG+  L + +  P    +D   T  Q      GT  V Y+P   G   I VKYN   I GSPF + +      ++  +KV     IP + G + L+ + A                  L  P+G   P  ++   NG     +   ++G+H +++  +G  +P SP +V       G+  +  +        +  + +   I+T++AG G ++ +++   +              + +  ++  DG   V Y P E G Y++ +K+  Q +P G  F         ++E++TR          AS A  G   +++ K  +P     D+ A+V  PSG + +  I   +N  + I+  + P+E G H + V  QG+ + GSPFQF V   GEG   +V A GPGL        AEF+I T++AG GGLS+ VEGPSK EI  ED  DG+  VSY+ Q PG+Y + IKF D+ I  SPF   +        ++ V +  E  LK+  P+S   +L        A++ +PS     C + +++     V F P+E G +L++V   G+ IPGSPFK+ V +  + GD   V   G GLE G      EF ++T  AG G+L ++I+GPSK ++DC++   G   V Y P  PGNY+I++ Y G  ++ GSPF   + G ++V                T+ M   Q+A                       +G     ++   +     L V V  P    E   ++  GN    + +  +E G + + V   D HI GSP+  TV
Sbjct: 1023 KVEPGLSPETSQVRFIPRD---KGPYEVELTYDGAPIPGSPFPIEAIAPTDPSKVRCSGPGLE-RAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAE-VHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKT-GGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPV----------PKSPFRVPVTEGCDPARVRVHGPGLQSGITNKPNKFTV--ETRGAGTGGLGLAMEGPSEAKMSCTDNKD---GSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHDTVDPTKVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTVHTCHAHHLF------IHISFISNSGQTLTNGQLGMNGLDVAGLRPFDLVIPFTIQKGEITGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSK--ADISCTDNQ-----DGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKITGDDSMRMSHLKVGSAADIPLDIGELDLSQLTAT-----------------LTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSK--------------VDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVP-GSAFTVKVTGEGRMKESITRK------RRAASVANVGSQCDLSLK--IPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIR--FVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPSDDARRLTVASLQESGLKVNQPASFAVSLNGAKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPEGY-KVTYTPMAPGNYLISIKYGGPYHIVGSPFKAKITGSRLVNSHSMHETSSVLVDPVTRSMTTSQQAAPGWASSDASRVVAKGLGLNKGFIGQKNTFSVDCSKAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDEHIPGSPYHITV 2545          

HSP 6 Score: 299.671 bits (766), Expect = 4.694e-95
Identity = 323/1135 (28.46%), Postives = 492/1135 (43.35%), Query Frame = 3
Query: 1503 PVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLI--DNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVK-AKPGFNAQLVTASGPGLHSCK--VNEKTQFVVDLDGAGHGSLGLAIEGPA----DAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEG---------AAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCE--YQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGN----PEKC-AIKAG-KDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLN------AKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVD-TKGEGRVTAFGPGLS-SGT-TNEVAEFTIITKDAGPGGLSLIVEGPSK----TEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANIT-GEPVKKSQVA-------VGNSSEIPLKIP-SSDLSTLTAELTTPSKIKVPCVIK-KMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISI--EGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMAL-----KDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGS-KDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVED 4736
            P+ PK    L+     A GPG+ P G      A FTV   E    GQG V   V+ P+G +    +  +N  N  Y V Y P   G HK+ V + G  I  SPF V       ++  VTA GPGL       N+ T F V   GAG G + + I  P+      E    D  + +    Y P + G + I + F    IS SP+ V V +   P    +KG     + L+P    +      K   E KV   G+G  D  VTIK  +G            G +   Y P   G  +I + +    I  SPF+  +   A  ++V+  G G+  ++G +  S   V      D G     + G       P P  IE    G  +C+  Y   + G++ + V      +  SP+  + MP       P+K  A   G +   + V K +  T++ K  GK  +     KI+ Q        +  + + V+V+++ +G  S  Y P++  ++ V V +GG +IP   F           +      V      +    A+    F ++  +    D++      A VV P+    +  I  NDN    +K  Y P   G + + V    + I  +P +  VD +    +V A GPGLS SG   N+   FT+ TK AG   L     GP+K     +    DNHDGT  V Y P   GN  + + +   PI  SPF   I     + K +VA       VG   EI +K   +     + A++T PS   VPC ++  ++     V F P++ G + V +   G  IPGSPF +        D +KV+ SG GLE+    +  +F +D  +AG   L I I  +  ++AE+  +DN +G  T+ Y+P  PG Y + + Y  ++VP  P  ++VE       ET  ++     V+   V      +  +D  AL       +K  ++ PSG      I D G+G  ++++   E G H V V +    +  SPF+     VT G     V   GPGL+ G  +  N+F + TR AG G + +AMEGPS+A+M   +++D GSC V Y   +PG Y  ++ + G+ I  SPF + V D
Sbjct:  276 PLRPK----LNPKKARAYGPGIEPTGNVVMKKAVFTV---ETISAGQGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMAQGDSSKVTAQGPGLEPAGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEACNPSLCTAKG-----RGLQPKGLRV------KETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKIGSEAGPQQVRAWGPGL--ESGVVGKSADFVVEAVGDDVGTLGFSVEG-------PSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPL-----KIQAQD-------RDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNK----VKVSGPGVAKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTVK--YTPPGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPSLDLSKVKVAGLGSKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPT--DPSKVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVE----PAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRV---PVTEGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKD-GSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHD 1355          

HSP 7 Score: 71.633 bits (174), Expect = 4.694e-95
Identity = 83/298 (27.85%), Postives = 120/298 (40.27%), Query Frame = 2
Query: 4823 ITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKK--AKFFVNTSNAGSGSLNVAIDGPS--KVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPF--TAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
             +V A    +  L+  VQ P G +EPA V   GD  + V + P   G + + V    + I  SP+++ V     D   V  SG GL+   V      +F ++  +AG G L V I  P       N  + +DG Y  +YV    G Y I I YGG+  I  SP+   A+  G+ S   V                  VS       + V   I         ++       VDA  AG G +   +  P     +V V    +  F + Y   + G ++I VR+G + IP SPF V V
Sbjct: 1381 FSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKV-LPTHDASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGD-EIPYSPYRIRALPTGDASKCTVT-----------------VSIGGHGLGAGVGPTI---------QIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTV 1650          

HSP 8 Score: 270.781 bits (691), Expect = 1.328e-82
Identity = 320/1218 (26.27%), Postives = 523/1218 (42.94%), Query Frame = 3
Query: 1230 KPDQPSSKVIVYGKGLEKVA--AKEKAIFTIDSKDAPSAPIGVTVEGPG----EAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQ--TNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQC--HDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPA-----QVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKA-GKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPS--GCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTK---GEGRVTAFGPGLSSGTTNEVAEFTIITKDA-GPGGLSLIVEGPSKTEIKCEDN---HDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVA----------VGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLE-KGLANQG-NEFTIDTR---DAGYGSLNISIEGPS--KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNV-EGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV-GSVTPGGSKDVTASGPGLEKGF-IDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKG--SCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            +P     K   YG G+E       +KA+FT+++  A    + V VE P     EA +   ++ + T  V Y   V G + + VL+   HI +SP  V V        D S VTA GPGL P G   +    F V     +  G G V+ ++  PSGK+      +++  N  Y   Y PT+EG H I +T+ G  I  SP+ V      N  L TA G GL     +V E  +F V   GAG G L + I+GP   E  C   D  DG    +Y P   G+Y I++ +  + I  SPF V++  E  P++V++ GP ++   + +   F ++        L   V  P       P  I + +    G+ DV Y P E G   + V      I  SPF   ++ PA       +KVK  G G+  Q+  +    PA F V+ K  G  P + +   + +G P+ + ++   NG Y+C Y       H + V   G  +P+SP+ +      +P K  +   G  KT ++    +  T++  EAG+G I+  + K     VG  E     D I+     + +   +V Y P   G Y + V +  Q+IP          S    +        ++   EL        +F +NTK      L+A+   P+    + +  I  N +  H +K  Y P ++G   L V   G PI  SPF   +       + +V   G  ++ G   E+   T+ +K A G G +   V GPS   + C+        T +V ++P+  G Y + + +   PI GSPF       P   S+V           VG   +  +   ++  + LT E+ + +  +    I+   +G   +++ P   G + + +     D+P  P +++V  E   + + VKV G G+E KG+  +   +FT+D R     G   +   I  PS  + E   +D  +G   V+Y P E G + + V Y    VP SPF V V EG     C+  ++      +++       +  ++        L + +  PS     C   D  +G+  ++++  E G ++++V +  + I GSPF   V  +V P     V   G GL      +I   F++   +AG   + V ++GP K  ++  E  D G  +  V+Y  ++ G Y  ++ +  E I  SP+ + V
Sbjct:  278 RPKLNPKKARAYGPGIEPTGNVVMKKAVFTVETISAGQGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTVLFAGQHISKSPFEVDV---GMAQGDSSKVTAQGPGLEPAGNIANKTTYFDV---YTAGAGVGEVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEACNPSLCTAKGRGLQPKGLRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKIGSEAGPQQVRAWGPGLESGVVGKSADFVVEAVGDDVGTLGFSVEGP------SPAKI-ECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIM-PAPGKDFYPDKVKAYGPGL--QSSGLSVGKPAEFTVDAKLGGKAP-LKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNKVKVSGPGVAKTGLKAYDPTYFTVDCAEAGQGDISIGI-KCAAGVVGPAEADIDFDIIR-----NDNDTFTVKYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKP----THFTVNTKAAGKAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVK--YTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPSLDLSKVKVAGLGSKMTVGKDQEI---TVKSKGAGGQGKVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIA-PTDPSKVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHV--EPAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTEG-----CDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSC--TDNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHDTVDP---TKVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGP-KGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKV 1449          

HSP 9 Score: 58.9214 bits (141), Expect = 1.328e-82
Identity = 77/309 (24.92%), Postives = 120/309 (38.83%), Query Frame = 2
Query: 4817 ISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRI---PVGHYKADPGMVHASGEGLSHAI-----VDKKAKFFVNTSNAGSGSLNVAIDGPS--KVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVR-PCEEVVVKHVGNNQ---FTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            +  T+ A+D     L   +  P G  + A ++   DG Y V + P   G + + ++     I  SP+RI   P G        V   G GL   +     + ++    V+   AG G +   +  P   +V+++  E EDG ++  Y A  PG Y+I + +GG  HI  SPF   V              H  + I          +   S   +        GL  A L   +       Q G       I G VR P  +V    + +N+    TV Y   E+G H + +++    IPGSP   +VD
Sbjct: 1476 VEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGE-HIPNSPFQVTVH--------TCHAHHLFIHI---------SFISNSGQTLTNGQLGMNGLDVAGLRPFDLVIPFTIQKGE------ITGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVD 1760          

HSP 10 Score: 275.789 bits (704), Expect = 7.926e-74
Identity = 328/1252 (26.20%), Postives = 524/1252 (41.85%), Query Frame = 3
Query: 1248 SKVIVYGKGL-EKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAV--IDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTAS---------GPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPF-------HXXXXXXXXXXXXXSKGPIKDAKL---------LRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSP--FKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDV--GDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGR----VTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCE--DNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANIT-------------GEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGL-ANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDC--KDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKD-RHIRGSPFQFTV-GS----------------------------VTPGGSKD----VTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPS-KAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            +KV   G+GL   V A    +F++D+  A  AP+ V V+GP   V   + VDNGD T  V Y     G Y+INVLY +  IPQSP  V V P      D S V  SGPGL+  GV      +FT+DA +    G+G +   +  P GK     I +  +G Y+V Y P   G + I + Y G  I  SP+ ++A P  +A   T +              + ++ E+T   VD   AG G +   +  P   E+     +N+DGT  + YT  + G Y I V+F  E I +SPF       H   +         S   + + +L         LRP    I  +   K  +   V  P   ++   +T  +      GT  V Y P E G   +D+KY+   I GSP  F  + V    V      G G+I      + + PAVF VNTKDAG       GL      P    I    N   TC      V  GD+ I V  +   +P SP+  K   TG+       + +   ++V   + I ++  E    Q+T T+     +     E+  +L  ++       +G   + ++PKE GE+LV +K  G+ IP+     +   +  E+ +     V  Q  +E  +  F    F I+T+D     L+  +  PS    +V I + D      K+ Y P+E G + + +    + + GS F   V   GEGR    +T      S        + ++   +     ++  V  PS    K E  +  + T+ + +VP   G + + +K++ Q + GSPF   +              G  +++++  V   +E  +    +    L+  +  PSK ++    +   +G+ GVS+  +E G++ V++      IP SPF V V +    DA ++ V+    E GL  NQ   F +    A  G ++  +  PS A  +C   + +     V+++P E G Y+I+V + G ++PGSPF + V G+     +   +      ++    G  CE  +         L V +  PS     C     G    ++ +     G + +S+ +    HI GSPF+  + GS                              PG +      V A G GL KGFI   N F++   +AG   + V ++GP    E    +        V+Y++ + G+Y   +K+  EHI  SP+HI V
Sbjct: 1360 TKVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTH----DASKVRCSGPGLNTTGVPASLPVEFTIDAKDA---GEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTVHTCHAHHLFIHISFISNSGQTLTNGQLGMNGLDVAGLRPFDLVIPFT-IQKGEITGDVRMPSGKVAKPDITDNK-----DGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAY---GPGLIHG----MVNKPAVFTVNTKDAGEG-----GLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKI--TGD------DSMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGR-----EEPCLLKMLR-------NGHVGISFVPKEIGEHLVNIKKNGRHIPSSPI--SVMINQSEIGDASRVRVTGQGLSE--ARTFEPAEFIIDTRDAGYGGLSLSIEGPS----KVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFT--VKVTGEGRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGV--PAEFSIWTREAGAGGLSIAVEGPSKAEI--AFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPS-DDARRLTVASL-QESGLKVNQPASFAVSLNGA-KGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRV-GETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPEG---YKVTYTPMAPGNYLISIKYGGPYHIVGSPFKAKITGSRLVNSHSMHETSSVLVDPVTRSMTTSQQAAPGWASSDASRVVAKGLGLNKGFIGQKNTFSVDCSKAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDEHIPGSPYHITV 2545          

HSP 11 Score: 241.891 bits (616), Expect = 2.319e-63
Identity = 322/1241 (25.95%), Postives = 507/1241 (40.85%), Query Frame = 3
Query: 1230 KPDQPSSKVIVYGKGLEKVAAKEKAI--FTIDSKDAPSAPIGVTVEGPGEAVIDCVDN-------------GDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGL-HSCKVNEKTQFVVDLDGAGHGSLGLAIEGPAD----AEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLL---RPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKV-----DGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAI------KAGKDKT---IQVNKESVITIETKEA------GKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHG-VN----FEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKC--EDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPV-KKSQVAVGNS----------SEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNE--FTIDTRDAGYGSLNISIEGPS----KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVE-----GDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGA-GNISVAMEGPSKAEMKFQESQ-DKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            +P   +S V V+G G+E      +A   FT+D++        +T  G G  +  C++N             GDGT  V Y     G +++ V YD+  +P+SP  VPV     +  D + V   GPGL  +    +   KFTV   E    G G +   ++ PS  + +   DN  +G   V Y P E G + +NVTY G PI  SPF V      +   V   G GL ++ + N    F VD   AG   L + ++GP      AE+   DN D T  V Y P + G Y I+V + DE+I  SP+ V+V+      KV+  GP  +   +    P  FTID  +AG+  L V+++ P     D       +     GT+ V YVP+  G   I +KY    I  SP++   +      K  V                I      V  V+ K AG    V   +  P+G  + + +    +G +   Y     G + I V   G  +P SP+ V ++ T +     I       +G+  T   + +N   V  +   +        KG+IT  V    R   G+V +  + D        + DG  +V Y P E G + +++KY G  IP         Y            V +           HG VN    F +NTKD     L+  +  PS    +  I+  DN      + Y P   G + + V    + I GSPF   +      R++    G ++    ++ E  +         L+  +  PS  E  C  +   +G   +S+VP+  G + + IK   + I  SP +  I    +   S+V V             +E  +    +    L+  +  PSK+ +    +   +G   V++ P E G +++N+      +PGS F V V  E      K  ++ K     +AN G++   ++   +     +   +  PS    KAEI   + EN    ++++PTE G + ++V Y G++VPGSPF   V      G   V      +ER +  V A       E ++   E     L + V  PS        ED  +G+  + ++ +E G + VS+   D HI  SPF   V S +    +   AS   L++  + +N   +      GA G I   +  PS A  +   ++ D+   AV +   + G Y   +KFNG HI  SPF I V
Sbjct: 1161 EPAVETSGVKVFGPGVEGKGVFREATTDFTVDAR-------ALTKTG-GNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPV----TEGCDPARVRVHGPGL--QSGITNKPNKFTV---ETRGAGTGGLGLAMEGPSEAKMS-CTDN-KDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHDTVDPTKVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVV--DNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDP-----DGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKG-KVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQV-TVHTCHAHHLFIHISFISNSGQTLTNGQLGMNGLDVAGLRPFDLVIPFTIQKGEITGDV----RMPSGKVAKPDITD--------NKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDY------------VNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPS----KADISCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKITGDDSMRMSHLKVGSAADIPLDIGELDLSQ-------LTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINT--EDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTGE---GRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEI--MEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPA-------EFSIWTREAGAGGLSIAVEGPS--KAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPSDDARRLTVAS---LQESGLKVNQPASFAVSLNGAKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRV 2319          

HSP 12 Score: 137.502 bits (345), Expect = 1.070e-31
Identity = 100/281 (35.59%), Postives = 135/281 (48.04%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGL-KQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++  +  PSGN   A+++ +GDG Y V+++P E GTH V V  +  P+  SPFR+PV     DP  V   G GL   I +K  KF V T  AG+G L +A++GPS+  M+C + +DG     Y+   PG Y +N+TYGG   I GSPF+  V      T                                 K+ CQG GL    R N    F VDAS+AG   L V + GP    E   V   G+   TV YV    G + I V + D++IP SP+ V V
Sbjct: 1204 IKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTE-GCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCCVEYIPYEPGTYNLNVTYGGQ-PITGSPFSVPVHDTVDPT---------------------------------KVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKV 1449          

HSP 13 Score: 128.257 bits (321), Expect = 6.758e-29
Identity = 85/285 (29.82%), Postives = 141/285 (49.47%), Query Frame = 2
Query: 4847 EIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++ +L A++ TPSG  EP +++ + +G  G+ F P+E G HLV ++ N + I  SP  + +   +  D   V  +G+GLS A   + A+F ++T +AG G L+++I+GPSKV++N  + EDG  + TY  T PGNYIINI +  + H+ GS FT  V G              +++   + KR  +  A   S       C  L LK   ++  +             +   +  P     +  +    NN + + +V  E G H + V++  + +PGSPF   V
Sbjct: 1878 DLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKF-ADQHVPGSAFTVKVTG------------EGRMKESITRKRRAASVANVGSQ------CD-LSLKIPEISIAD-------------MTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTV 2129          

HSP 14 Score: 105.145 bits (261), Expect = 8.236e-22
Identity = 78/307 (25.41%), Postives = 136/307 (44.30%), Query Frame = 2
Query: 4781 HRENHREDAGGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHY-KADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYE-FTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
             R     + G    ++++  +  I  + A V +PSG +  A + +  +  Y ++F P E G H V V+   + + GSPF+  VG   +     V A G GL  A     A+F + T  AG+G L++A++GPSK  +   + +DG    +Y+   PG+Y ++I +  + HI  SPF   V                                   S +  ++    L     ++N   SF V  + A  G++   +  P    EE  V  +  +++ V ++ +E+G ++I V++    IPGSPF + V
Sbjct: 2047 RRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKF-NDEHIPDSPFVVPV--------------------------------ASPSDDARRLTVASLQESGLKVNQPASFAVSLNGA-KGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRV 2319          

HSP 15 Score: 102.064 bits (253), Expect = 6.918e-21
Identity = 81/304 (26.64%), Postives = 134/304 (44.08%), Query Frame = 2
Query: 4802 DAGGL----ISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            D  GL    + I    + GEI      V+ PSG +    +    DG   VK++P E G H + ++ +   I GSP +  V +  +  G V A G GL H +V+K A F VNT +AG G L++AI+GPSK +++C + +DG    +Y+   PG+Y I + Y  + +I GSPF + + G+ S                                         + +   ++ S     +D  +     L   +  P    E  ++K + N    + +V KE G H++ ++   + IP SP  V ++
Sbjct: 1683 DVAGLRPFDLVIPFTIQKGEI---TGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNS--GHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYNIIVKY-NDKNIPGSPFMSKITGDDS-----------------------------------------MRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMIN 1939          

HSP 16 Score: 97.8265 bits (242), Expect = 1.198e-19
Identity = 88/329 (26.75%), Postives = 150/329 (45.59%), Query Frame = 3
Query: 3795 EHLVNVY----EKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLE--KGLANQGNEFTIDTRDAGYGSLNISIEGPS----KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNV---EGDKV-VPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGF--TEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLE-KGF-IDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQ-DKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            EH V  Y     K    PG+P +  +      +  K +  G G+E    +  +   FT++T  AG G + + +E P+    +A++   +++N   +V Y+P   G + + V +AG+++  SPF V+V   +GD   V  +   +E        T        ++      + +++V +  PSG   T  C +ED GN + R  +   + G H + +      I  SP+   VG          TA G GL+ KG  +    EF +YT+ AG G++ V ++GP   E   ++     G  +  Y  S PG+Y  +I + G+HI  SPF +
Sbjct:  256 EHSVMTYLSQFPKAKLKPGAPLRPKL------NPKKARAYGPGIEPTGNVVMKKAVFTVETISAGQGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMAQGDSSKVTAQGPGLEPAGNIANKTTY-----FDVYTAGAGVGEVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEAC--NPSLCTAKGRGLQPKGLRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEV 571          

HSP 17 Score: 93.2041 bits (230), Expect = 3.798e-18
Identity = 93/302 (30.79%), Postives = 127/302 (42.05%), Query Frame = 2
Query: 4826 TVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQ--YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHA--IVDKKAKFFVNTSNAGSGSLNVAIDGPS--KVNMNCHETEDG---YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPV---RPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            T+ A  GE+      V+ P+G+ E A V    D    Y V + P+  G H V V    + I+ SPF + VG  + D   V A G GL  A  I +K   F V T+ AG G + V I  PS  K  + C   + G   Y  TY  T  G +II IT+ G   I  SP+T  V                                E  + ++     +GL  K  R+     F V    AG G L V I GP     PC++   K +G+  ++ DY     G +II + WG + IP SPF V +
Sbjct:  310 TISAGQGEV---LVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMAQGDSSKVTAQGPGLEPAGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGG-QISKSPYTVNV-------------------------------GEACNPSLCTAKGRGLQPKGLRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKK---KDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKI 573          

HSP 18 Score: 91.6633 bits (226), Expect = 1.051e-17
Identity = 93/353 (26.35%), Postives = 139/353 (39.38%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEP--AIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHA--IVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG---YEFTYVATAPGNYIINITYGGNFHIVGSPFTA-----------------------------VVE--GNKSATNVNQEEQHSQVEIEASDK---RC-VSQYAEKSSSNVEKIICQ-----------------------------GLGLKQARLN--SVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++E  +  PSG  +     V+  G+  Y   + P + G H++++      I+ SP+ + VG    +P +  A G GL      V + A+F V T  AG+G L V I GP  +   C + + G   Y F Y  + PGNYII IT+GG  HI  SPF                               VVE  G+   T     E  S  +IE  DK    C V  +  +       ++C+                             G GL+ + L+      F VDA   G   L +          +V VK  GN  ++  Y  ++   H +MV WG  +IP SPF +++
Sbjct:  417 EVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGE-ACNPSLCTAKGRGLQPKGLRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQ-HIPRSPFEVKIGSEAGPQQVRAWGPGLESGVVGKSADFVVEAVGDDVGTLGFSVEGPSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPLKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNI 767          

HSP 19 Score: 80.1073 bits (196), Expect = 2.918e-14
Identity = 78/287 (27.18%), Postives = 117/287 (40.77%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQ-IGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAI--DGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDA---SQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            K+ A V  PS    P  V+  +      V+F PR+ G + V +  +  PI GSPF I       DP  V  SG GL  A V +  +F V+ +NAG   L + I  D  ++  ++  +  DG Y  TYV   PG Y + I Y                G++   N      H +  +E S                 K+   G+  K     +   F VDA   ++ G   +   I  P     E +++ +G+  + V+Y   E GTH + V +    +P SPF V V
Sbjct: 1007 KVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEA-IAPTDPSKVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRY----------------GDQDVPNF-PARLHVEPAVETSGV---------------KVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPV 1260          

HSP 20 Score: 74.7146 bits (182), Expect = 1.304e-12
Identity = 70/265 (26.42%), Postives = 113/265 (42.64%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAG-SGSLNVAIDGPSKVNMNCHETEDGY-----EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            DG + VK++P + G   + V     PI  SPF + +     D   V  +G G S   V K  +  V +  AG  G +   + GPS  ++ C + E G      +  ++    G Y + +TY G   I GSPF                       IEA            + ++  K+ C G GL++A++     F VD + AG   L + I        EV ++  G+  +T+ YV    G + + +R+GD+D+P  P  +HV+
Sbjct:  934 DGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAP-SLDLSKVKVAGLG-SKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPC-KVEPGLSPETSQVRFIPRDKGPYEVELTYDGA-PIPGSPF----------------------PIEAI-----------APTDPSKVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVE 1161          

HSP 21 Score: 65.855 bits (159), Expect = 5.832e-10
Identity = 73/265 (27.55%), Postives = 107/265 (40.38%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHET---EDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVR---PCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDK-DIPGSPFMVHV 5695
            DG  GV +  +E G + V ++ N + I  SPF +PV     D   +  +    S   V++ A F V+  N   G ++  +  PS     C  T   ED Y   ++    G Y+I++ + G+ HI GSPF            V +  Q       A D   VS Y              G GL+     S   F V+ S AG G L V I GP +    C+E          + V Y     G ++I +++G    I GSPF   +
Sbjct: 2189 DGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPSDDARRLTVASLQESGLKVNQPASFAVSL-NGAKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGS-HIPGSPF---------KIRVGETGQ-------AGDPGMVSAY--------------GAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQEC------PEGYKVTYTPMAPGNYLISIKYGGPYHIVGSPFKAKI 2415          

HSP 22 Score: 59.6918 bits (143), Expect = 4.535e-8
Identity = 64/261 (24.52%), Postives = 101/261 (38.70%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNC--HETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            DG   V + P   G + + V+ N K I GSPF   +     D  M       +SH  V   A   ++        L   +  PS     C      +G+   ++V    G +++NI   G  HI  SP + ++               +Q EI                 +  ++   G GL +AR      F +D   AGYG L + I GP +   ++  +   +    V Y   E G +II +++ D+ +PGS F V V
Sbjct: 1816 DGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPF---MSKITGDDSMR------MSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGR-HIPSSPISVMI---------------NQSEI----------------GDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSK--VDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKV 2033          

HSP 23 Score: 55.8398 bits (133), Expect = 7.081e-7
Identity = 73/309 (23.62%), Postives = 117/309 (37.86%), Query Frame = 2
Query: 4823 ITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVD--KKAKFFVNTSNAGSGSLNVAID------GPSKVNMN---CHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQA--RLNSVNSFFVDASQAGYGILLVGIAGP-----VRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
             TV A+ G    L+   Q   GN     V+  G+G Y   ++PR+   H V V      I  SPFR+ +G     P  V  SG G++   +       F V+ + AG G +++ I       GP++ +++        D +   Y     G+Y I + +                        +Q    + + I+              S +  K+  +G GL ++   LN    F V+   AG   L     GP     VR   +++  H G +  TV Y   + G   + V +G   IP SPF V +
Sbjct:  699 FTVDAKLGGKAPLKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGA-GCHPNKVKVSGPGVAKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTVKYTPPGAGSYTIMVLF-----------------------ADQTIPMTPIRIKVD-----------PSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDF-DIIDNHDGTH--TVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAI 969          

HSP 24 Score: 55.8398 bits (133), Expect = 8.168e-7
Identity = 74/308 (24.03%), Postives = 116/308 (37.66%), Query Frame = 2
Query: 4799 EDAGGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVD--KKAKFFVNTSNAGSGSLNVAIDGPSK----VNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVR---PCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVH 5692
            E   G ISI ++   G +   EA +          I++   D  + VK++P   G++ + V    + I  +P RI V     D   V A G GLS + V+  K   F VNT  AG   L+    GP+K     + +  +  DG +   Y     GN  +N+TYGG+  I  SPF   +                                   S ++ K+   GLG K                 G G +   + GP     PC+  V   +      V ++ ++ G + + + +    IPGSPF + 
Sbjct:  802 EAGQGDISIGIKCAAGVVGPAEADIDF-------DIIRNDND-TFTVKYTPPGAGSYTIMVLFADQTIPMTPIRIKV-DPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGD-PIPKSPFAVAI---------------------------------APSLDLSKVKVAGLGSKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPCK--VEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIE 1064          
BLAST of Filamin-A vs. Ensembl Zebrafish
Match: flnca (filamin C, gamma a (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-070503-1])

HSP 1 Score: 739.954 bits (1909), Expect = 0.000e+0
Identity = 473/1259 (37.57%), Postives = 671/1259 (53.30%), Query Frame = 3
Query: 1230 KPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTV--EGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDA-SEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLR--PNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAG--------KDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEI--NTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGE-PVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTE---------------PGN-YVINVTYAGK-------------------------NVPGSPFNVNVEGDKVVPCETQ------KMERVQ-------------EAVKATQVGGN--------CEINLKID------------EMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPF 4718
            KP   + KV   G GLE+  A E A FT+D   A  A + + +  +   +A +   +N DGT  V Y     G++TI + Y    +P+SPI V V P    ++D S +   GPG+ P+GV ++    F VDA +     G   VK  + +PSG  T+  I +  +G Y V YT  E+G H I V Y+ + +  SPF V    G +   V A GPGL    VN+   F V+  GAG   LGL IEG ++A++ C DNKDG+C VEY P  AGDYDI++ +  + I  SPF V+V D V   KVK  GP    K+    P  FT+DCS+AG APLEV++  P   +   PV +K       GT  V Y P + GP  + VKY    +  SP+K N        KV+  G G+      + AS+P  F ++ +DAG    + V + +P G+P    I    +G YT  Y     G + I++   G  +P SPY V++ PTG+  KC +               IQ+++E+VIT++ K AGKG++TCTV+     +            + + V E+PDG   ++Y   E G+Y++ +++GGQ IP   F   AT              Q     +     F  +N  I    + G   +L+ +V  PSG      I   DN    + + +QP+E+G H++ +   G  I GSP QF+VD    G VTA+GPGL  GT N+ A FT++TK+AG GGLSL VEGPSK EI C+DN DGT  VSY+P  PG+YNII+KF +  I GSPFTA ITG+  +++SQ+ VG ++++ LKI  +DLS LTA +  PS  + PC++K++ N  +G+SFTPKE GEH V+V + G  +  SPFK+ V   E+G+A++VK  GKGL +    +  EF +DTR+AGYG L +SIEGPSK +I+C D E+G C V Y PTE               PG+ + + VT  G+                          +PG+ F +    +++    T+      + ER +                ++TQVGG          E  L  D            E  ++ +   V +P G     +I D+GN   R++FV  E G H V+V ++  H+ GSPFQFTVG +  GG   V A G GLE+    +  EF+I+TREAGAG +S+A+EGPSKAE+ F++ +D GSC V+Y V +PGDYE SIKFN EHI +SPF
Sbjct: 1175 KPALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEP----SVDTSGIKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVRAYGPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSGPGLANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTL--EPVVVKNNRD---GTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASKVRASGPGL--DTTGVAASLPVEFTIDARDAGKGL-LTVQILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGME------------LDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATD-------------QPVAPRDDTKPMFQPLNLVIPFTVQQG---ELSGEVRMPSGKTARPFI--RDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPGLCHGTVNKPASFTVVTKNAGQGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKITGDDSLRRSQLNVGTAADVSLKITETDLSYLTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINCDDVEDGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKVTGEGRMKQSITRKRQAASIASVGSTCDLNLKIPGNWFQMLSAQERLTRTFTRSSHTYTRTERTEISKTHGGETKREVHVEESTQVGGGGGDPFRDVFESFLGRDRLGSFGTIRQEGETGIQGMTAQVTSPGGNLADAEIVDSGNSTYRVRFVPTEMGSHTVNVKYRGEHVPGSPFQFTVGPLGEGGFHKVRAGGTGLERAVAKVPAEFSIWTREAGAGGLSIAVEGPSKAEINFEDRKD-GSCGVSYVVQEPGDYEVSIKFNNEHIPDSPF 2390          

HSP 2 Score: 356.681 bits (914), Expect = 4.391e-126
Identity = 345/1224 (28.19%), Postives = 548/1224 (44.77%), Query Frame = 3
Query: 1245 SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIE------GPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLR---PNHFTIDCSEAGKAPLEV--KVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTC-EYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTR-SVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF----FVDTKGEGRVTAFGPGLS-SGTTNEVAEFTII-----TKDAGPGGLSLIVEGPS--KTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANIT--GEPVKKSQVAVGNSSEIPLK-----IPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGL-EKGLANQGNEFTIDTRDAGYGSLNISIEGP--SKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKID--EMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQ---FTVGSVTPG------GSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQD-KGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAAR 4763
            + KV  +G GL+     + A F +++       +G ++EGP +A I+C D GDG+C V Y    PG Y ++V+ D+  I  SP +  + P  N ++    V A GPGL P GV  +   +FTVDA E    G+G +K   Q   G   +  I +  +G +V  Y PT+   H I +T+  + I  SPF V    G +   V   GPG+     K NE T F VD   AG G + + I+      GPA+A+I      N + T  V+YTP   G Y I V F D++I  SPF V+V       KV+++GP  +   ++   P HFTI    AGKA  EV  K +  G+ + D  +           ++ V Y     G   I V +   PI  SPFK  V     + KVKV G      N  +       F VNTK AG    V V + +P+G P+P  +E+      TC +Y   + G +K+ +  DG P+P+SP++V+ +   +P K        K   V + +  +I+TK AG G +  T++       G  E        K++ Q++ DG  SV Y+P E G+Y + + YG   IP   F      +    + T +   ++   + E+AS       F ++       +L  ++V  SG   EV I +N +      + Y P   G H + +   G+ +  SP        VDT G   +  +GPG+   G   EV    I+      K  G   + + +  PS   T+    D  DGT++V Y     G + I + + +  +  SPF  ++    +P +      G    I  K     + +    T    LT     +   + K   +G+  V + P   G++ +N+   G  IPGSPF+V VK+      +KVK SG GL  K  A+    FT+D   AG   L + + GP  +   +  K+N +G  TV Y P + G + ++V YA + VP SP+ VN         +  K+      +  T V  +  +   ID  +     L V +  P G  +   I D  +G   + +V   +G + +++ +   +I  SP+    F  G  +        G   V + GP ++   +       +  + AG G ++  ++ P+  E+    +++  G+  + Y   +PG Y  +I+F G+HI  SPF ++  D   +PVA R
Sbjct:  596 TQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAAN-DVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAREA---GKGGLKIYAQDAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRVLVGEGCHPDKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGPGRYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGPGINKTGVQVEIPTHFTIFTKGAGKAKPEVHFKTAAKGNAVKDFEIIDNHDY-----SYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAPSLDLGKVKVQG-----LNEKVEVGKDQEFIVNTKGAGGQGKVNVSITSPSGRPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVEGLMPADPSKVRAYGPGLKGGIVGQPAKFSIDTKGAGAGGLGLTLE-------GPCEA-------KIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVVKPALDAGKVTASGPGLERAKAGEVAS-------FTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKD--GTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSVDTSG---IKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVRAYGPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVD--VSKVKCSGPGLANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSH----DASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVESLGPNIQ---MSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATD---QPVAPR 1767          

HSP 3 Score: 117.857 bits (294), Expect = 4.391e-126
Identity = 100/338 (29.59%), Postives = 150/338 (44.38%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGN----KSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGL-----GL------------------------------------KQARLNSVNSFFVDA------------SQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            +L   V+ PSG      ++   DG   V+F P E G H + ++ +   I GSP +  V     + GMV A G GL H  V+K A F V T NAG G L++A++GPSK  ++C + +DG    +Y+ T PG+Y I + +  N HI GSPFTA + G+    +S  NV      S ++I  +D   ++   +  S   E  + + L     GL                                    + +R+ +     V+A              AGYG L + I GP +   ++    V +    V Y   E G +II +++ DK IPGSPF V V
Sbjct: 1789 ELSGEVRMPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVD--VTNSGMVTAYGPGLCHGTVNKPASFTVVTKNAGQGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTTPGDYNIIVKF-DNSHIPGSPFTAKITGDDSLRRSQLNVGTAADVS-LKITETDLSYLTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSK--VDINCDDVEDGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKV 2120          

HSP 4 Score: 370.163 bits (949), Expect = 9.361e-103
Identity = 441/1637 (26.94%), Postives = 701/1637 (42.82%), Query Frame = 3
Query:   96 VTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLND-GIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQAT---YTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIE---VCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQES----------PLITEEPILSEQIKTL----------KAGNPHNPMQKANPGKSNK--------------PYTALEEAIKEMK----ESAVESSKWPQSKPDQPS-SKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEK--TQFVVDLDGAGHGSLGLAI---EG-PADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXX-----------XXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVV-QPAQVEKVKVDGDGIIPQNGA--ILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEP------VKKSQVA----VGNSSEIPLKIPSSDLSTLTA-ELTTPSKIKVPCVIKKMNNGALGVSF---TPKETG-EHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVE-----GDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGA-GNISVAMEGPSKA-EMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            VT GG+ IP SPF I      +  K    ++ L   V++ + Q F V     G + +  V+++  +G    P+  K  S  T +AT   Y P + G + +  + DG PV ++P  V  +  +P +  K++  G  P ++   V  P  F + +  K      + + +  P    I        DGT  V ++P E G ++I     +  I  +P   K++ K  +       S P       K G+V    SFT+  D +     +  + ++S    Q                + P   G +++        +  SP  + V+ S          P +  + +L E               K GN H  ++  NP  +N                YTA E+ +  ++    E AV  S +  S  +    ++V  YG GLE     +   FT++++ A +A +G+T+EG  EA + C DN DG+C V Y     G Y IN+ Y    IP SP  V    +    +D+S V  SGPGL+ + V       FTVD S+    G   ++  +  P G     ++ N  +G + V YTP +EGPH ++V Y    +  SP+ V + P  +A  V ASGPGL +  V      +F +D   AG G L + I   EG P  A I  HDN+DGT  V Y P   G Y I++K+  ++I  SP++V+        K           V+S GP  + ++      T+D   AGK  +   V  P     D  VT         GTFD+ Y   E G  +I +++    I  SPF+     QP            + P++    +   +  V     +   ++ +V +    P+G+     I    +G  T ++Q  + G H++ +  DG  +P SP       T +    A   G      VNK +  T+ TK AG+G ++  V+   + ++                +++ DG  +V Y+P   G+Y + VK+    IP   F    T       +++ RS   Q++   A++    V+ +I   D     L A +  PSG  +E P         +I + + P E G H++ V   G+ +  SPF+  V     G   RV AFG GL    T EVAEF + T++AG GGL L +EGPSK +I C+D  DGT KV+Y P  PGNY I IKF D+ I GSPFT  +TGE        +K Q A    VG++ ++ LKIP +    L+A E  T +  +      +     +  +    T +E   E    V   G D     F+  +  + +G    ++  G+   +G+  Q                 ++  G + A+ +  D+ N    V+++PTE G++ +NV Y G++VPGSPF   V      G   V      +ER    V A       E ++   E     L + V  PS      + ED  +G+  + +V +E G + VS+   + HI  SPF   V +++    +    S   L++  + +N E +   +  GA G I   +  PS   E  +    D    A+ +   + G +   +KFNG HI  SPF + V
Sbjct:  969 VTHGGDPIPKSPFKITVAPSLDLGKV--KVQGLNEKVEVGKDQEFIVNTKGAGGQGKVNVSITSPSG---RPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVEGL--MPADPSKVRAYG--PGLKGGIVGQPAKFSIDT--KGAGAGGLGLTLEGPCEAKIECQDNG--DGTCSVVYLPTEAGDYNINILYGEAHIPGSP--FKAVVKPALDAGKVTASGPGLE--RAKAGEV---ASFTV--DCSRAGEAELTIEIVSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSVDTSGIKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGN-HVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVRAYGPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRV----QVKDVVDVSKVKCSGPGLANK-VTAHVPQTFTVDCSKA---GVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASI--HDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVESLGP--NIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTEN-----PDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATDQP------------VAPRDDTKPMFQPLNLVIPFTVQQGELSGEVRM----PSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPGLCHGT-VNKPASFTVVTKNAGQGGLSLAVEGPSKAEI--------------SCKDNKDGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKITGD-----DSLRRS---QLNVGTAAD----VSLKITETD--LSYLTASIKAPSG--KEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINCDDVEDGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKVTGEGRMKQSITRKRQAASIASVGSTCDLNLKIPGNWFQMLSAQERLTRTFTRSSHTYTRTERTEISKTHGGETKREVHVEESTQVGGGGGDPFRDVFESFLGRDRLGSFGTIRQEGETGIQGMTAQ-----------------VTSPGGNLADAEIVDSGNSTYRVRFVPTEMGSHTVNVKYRGEHVPGSPFQFTVGPLGEGGFHKVRAGGTGLERAVAKVPA-------EFSIWTREAGAGGLSIAVEGPS--KAEINFEDRKDGSCGVSYVVQEPGDYEVSIKFNNEHIPDSPFIVPVATLSDDARRLTVTS---LQEKDLKVNQEASFAVQRNGARGVIDAKVHAPSGVVEECYVTELDSDKNAIRFIPRENGVHSIDVKFNGSHIPGSPFKVRV 2489          

HSP 5 Score: 362.459 bits (929), Expect = 2.072e-100
Identity = 428/1608 (26.62%), Postives = 681/1608 (42.35%), Query Frame = 3
Query:  216 QPQTFKVKLNDGIKSEPCVTVSDKNGVPVEP-VLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPE-NVEKIKVEGLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENK---IIPIHKEAAPDGTKVTFVPKENGPHSIGCWVQDQPINETPCIV-------------KSLPKADIHEAINKKSSPAT-LAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLL-CEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPILSEQIKTLKAGNPHNPMQKA------NPGKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQ---------------------PSS------KVIVYGKGLE--KVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVID--CVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQ------SPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEK--TQFVVDLDGAGHGS----LGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEA-GKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTK--DAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCE--YQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQE--VRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF-FVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAV--GNSSEIPLKIPS--------SDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKG--LANQGNEFTIDTRDAGYGSLNISI---EG-PSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNV--EGDK-----VVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKV--NVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVE 4733
            +P  F V+  +    E  V V D  G   E  V+       T+  TY P   G+H +     G+ + K+P +V+V   + + N  + +  GL P   V    T+  +        D V V +++P+NK   +  I +    +  + T+ P   GPH+I      QPI  +P  V             K +P     +A N  +  AT   ++ K  +V +   FT+          +  V V  P   + +PVK   +  G+  C++ P K G Y++  +    PI  SP  + V +     +       +KT   G   + + +A        G S +  +  +    +  + + +   WP    D                      P++      KV  +G GLE   V   +   FT+D+++A    + +  +     VID    D GDGT   VY    P  +TI + +  V+IP+SP  V V     +      V   GPG+   G+  +    FTVD SE    GQG V   ++       P+    +  I   +N  + V+YTP   G + I V +    I  SPF VK  P  +A  V A GPG++   V  +  T F +   GAG          A +G A  + +  DN D +  V+YT +  G+  I V    + I  SPF + V   +   KVK +G  +  ++ +   F ++   A G+  + V ++ P    S RP+  K           V Y+P E G   +D+ Y+ +P+  SPF    + PA   KV+  G G+    G I+   PA F ++TK   AG     + G       P    IE + NG  TC   Y   + GD+ I++    A +P SP+     P  +  K        +  +  + +  T++   AG+ ++T    +I      Q E         V +Q + DG  SV Y P   G + + +KYGGQ +P          S     ++          +  E+ ++          TK G  V +  +++ PSG   +  IT  D      +++Y   E G H ++V      +  SPF+   V+     RV A+GPGL  G  N+   FT+ T+ AG  GL L +EG S+ ++ C+DN DG+  V Y+P   G+Y+I I +  QPI GSPF   +              G ++++   +P         + ++ L  +L  P     P V+K   +G   V++TP + G H V+V     ++P SP+KVN       DA+KV+ SG GL+     A+   EFTID RDAG G L + I   EG P KA I   DN +G  TV Y+P   G Y I + Y G N+P SP+NV     GD       V      +E +   ++ ++     E  + +D  A    KV   V TP+G     D+ +  +G   I + A E G + +++    +HI  SPFQ  + +  P   +D T       K      N    +T + G  +  V M     A    ++++D G+  V ++ ++ G +E  IK++G HI  SP    V+
Sbjct:  301 KPAVFTVETLEAGLGEVIVYVEDPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVLFAGQDIDKSPFMVNVAKALGDPNKVQARGPGLEPEGNVAHKPTYFDIYTAGAGAGD-VSVVIVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISEAHLKPPGAPKQIPPQK-KKASNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTG--ELKVSVKGPGGVE-VPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEVSKEAGTQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAREAGKGGLKIYAQDAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRVLV----GEGCHPDKVKVYGPGVEKTGLKANEPTYFTVDCSEA---GQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGPGRYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGPGINKTGVQVEIPTHFTIFTKGAGKAKPEVHFKTAAKGNAVKDFEIIDNHDYSYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAPSLDLGKVKVQGLNEKVEVGKDQEFIVNTKGAGGQGKVNVSITSP----SGRPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVEGLMPADPSKVRAYGPGL---KGGIVG-QPAKFSIDTKGAGAGGLGLTLEG-------PCEAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVVKPALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTI---EIVSDSGAQAE---------VCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSVDTSGIKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKI--RIINPSGANTDAYIT--DKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVRAYGPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSGPGLANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSH--DASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASI--HDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVESLGPNIQMSE-----ETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQ-VMATDQPVAPRDDT-------KPMFQPLNLVIPFTVQQGELSGEVRMPSGKTARPFIRDNKD-GTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVD 1847          

HSP 6 Score: 354.369 bits (908), Expect = 7.334e-98
Identity = 414/1650 (25.09%), Postives = 663/1650 (40.18%), Query Frame = 3
Query:   45 VTYRPQECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAP---MIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTI----VVQESPLITEEPILSEQIKTL----------KAGNPHNPMQKANPGKSNKP--------------YTALEE-----AIKEMKESAVESSKWPQSKPDQPSSKVIVYGKGLEK--VAAKEKAIFTIDSKDAPSAPIGVTV---EG-PGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKA-----------KPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQ--CHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAV-FHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESV--ITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPN----------------------------------------GKFFQTA------TYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTK----DGVPVD----------------------------LNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLKI---------PSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNV-KNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAG-KNVPGSPFNVNVEGDKV-----------VPCET----QKMERVQEAVKATQ-------------------VGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFT 4439
            V Y P E  +    +  +  G   IPGSPF        +  K   +   L+   K  +  +F V  +   ++E  + +   +G   E V ++     T+  TYTP   G H IT    G+ V K+P+ V V   +  +  K+   G+ P   + EV         +  K    + V ++++NP       +     DGT +V +   E+G H I  +  +  + ++P  V  +   D      +   P       + G VNKP  FT+  +          + +      + +   +K        E++P  AG Y +  +    PI GSP  +    VV  S +    P L+ ++             KAG     +Q   P  + +P              YT  +E     ++K   +    S     S P   +SKV   G GL+   VAA     FTID++DA    + V +   EG P +A I   DN DGT  V Y   + G YTI + Y   +IP SP  V  +P  + +  L TV+  G G+   G      ++ TV   +    G+G V   VQ+P+G + +  +    +G + + YT  E G + I + + G  I  SPF V A           KP F                +N    F V       G L   +  P+    +    DNKDGT  V++ P + G +++ +K++   I  SP    V              +    + +P  FT+    AG+  L + V  P    S   ++ K  +    GT  V Y+P   G   I VK++ S I GSPF             K+ GD  + ++   + +   V   +   D      +   +  P+G+  P  ++  PN      +   +VG+H++SV   G  +  SP+ +   P+   E   +KA     ++ +   V    ++T+ AG G +  +++   +              + +   +  DG   V Y P E G Y++ +K+  + IP                                         G +FQ        T +F     T TR+ + +IS          V+ E +T+     G P                              + A+V  P G + +  I  + N  + ++  + P+E G H + V  +G  + GSPFQF V   GEG   +V A G GL        AEF+I T++AG GGLS+ VEGPSK EI  ED  DG+  VSYV Q PG+Y + IKF ++ I  SPF   +        ++ V +  E  LK+          +     + A++  PS +   C + ++++    + F P+E G H ++V   G+ IPGSPFKV V + E VGD   V   G GLE G     +EF ++T  AG G+L+++I+GPSK ++DC + + G   + Y P  PGNY+I + Y G +++ GSPF   V G ++           V  ET     KM     ++ ++                    VG     ++   +     L V VH P    E   ++  GN    + +  +E G + V V   D  I GSPF  +
Sbjct: 1144 VVYLPTEAGD---YNINILYGEAHIPGSPFKAVVKPALDAGKVTASGPGLE-RAKAGEVASFTVDCSRAGEAELTIEIVSDSGAQAE-VCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSVDTSGIKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRV--RAYGPGL-----EGGIVNKPNCFTV--ETRGAGTAGLGLTIEGASEAKMLCKDNKD--GSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSGPGLANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIH--DNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVESLGPNIQ-MSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATDQPVAPRDDTKPMFQP--------------LNLVIPFTVQ-----QGELSGEVRMPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPGLCHGTVNKPASFTVVTKNAGQGGLSLAVEGP----SKAEISCKDNKD---GTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTA-----------KITGDDSLRRSQLNVGTAADVSLKITETDLSY---LTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSK--------------VDINCDDVEDGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKVTGEGRMKQSITRKRQAASIASVGSTCDLNLKIPGNWFQMLSAQERLTRTFTRSSHTYTRTERTEISKTHGGETKREVHVEESTQVGGGGGDPFRDVFESFLGRDRLGSFGTIRQEGETGIQGMTAQVTSPGGNLADAEIVDSGNSTYRVR--FVPTEMGSHTVNVKYRGEHVPGSPFQFTVGPLGEGGFHKVRAGGTGLERAVAKVPAEFSIWTREAGAGGLSIAVEGPSKAEINFEDRKDGSCGVSYVVQEPGDYEVSIKFNNEHIPDSPFIVPVATLSDDARRLTVTSLQEKDLKVNQEASFAVQRNGARGVIDAKVHAPSGVVEECYVTELDSDKNAIRFIPRENGVHSIDVKFNGSHIPGSPFKVRVGEAESVGDPGMVSAFGPGLEGGRTGVPSEFVVNTCKAGSGALSVTIDGPSKVKMDCNECQEGY-KISYTPMAPGNYLICIKYGGPQHIVGSPFKAKVIGMRLSGGHSLHETSSVIVETVTKSSKMAGAYSSLTSSMPTSDASKVVCHGAGLSKAFVGQKNSFSVDCSKAGTNMLMVGVHGPRTPCEDVTVKHMGNKLYNVTYTVKEKGNYVVIVKWGDETIPGSPFHVS 2717          

HSP 7 Score: 328.946 bits (842), Expect = 4.735e-90
Identity = 344/1214 (28.34%), Postives = 541/1214 (44.56%), Query Frame = 3
Query: 1233 PDQPSSKVIVYGKGLEKVAAKEK--AIFTIDSKDAPSAP--IGVTVEGPGEAVID--CVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQT-NGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQ-VEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVN----TKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKC-AIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKF-FQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF-FVDTKGEGRVTAFGPGL-SSGTTNEV-AEFTIITKDAGPGGLSLIV---EG-PSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI--TGEPVK-KSQVAVGNSSEIPL--KIPSSDLSTLTAELTTPSKIKVPCVIKKMN------------NGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPS--KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSP--FNVNVEGDKVVPCETQKM--ERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINN--EFAIYTREAGAGNISVAMEGPS-KAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            P   + KV   G G+ K   + +    FTI +K A  A   +       G AV D   +DN D +  V Y     G   I V +    IP+SP  + V P    +LDL  V   G     E V KD   +F V+       GQG V   + SPSG+     L  +       V+Y P EEG +K+++TY+G P+ +SPF V+     +   V A GPGL    V +  +F +D  GAG G LGL +EGP +A+I+C DN DGTC V Y P +AGDY+I++ + +  I  SPF   V   +   KV + GP ++ AK      FT+DCS AG+A L +++      +SD     +  ++    GTF V Y P   G   I +KY    +  SP    V        +KV G G+ P+   +L  +   F V+     K  G N  V + + NP+G     +I  + +G Y  EY   + G H I V  D   +PKSP+ V  +   +P +  A   G +  I VNK +  T+ET+ AG   +  T++                   K+  +++ DG  SV YMP   G+Y + + YGGQ IP   F  Q          +     + N+++  +         F ++        L  ++  P G +E V + +N +  H   ++Y P++ GPH + V    + +  SP++     +    +V A GPGL ++G    +  EFTI  +DAG G L++ +   EG P K  I   DN DGT+ VSYVP   G Y I IK+    I  SP+      TG+  K    V++G      L   I  S+ + +T +     K KV C ++  N            +G   + +T  E G++++ +   G  IP SPF+V   ++ V      K   + L     N    FT+       G L+  +  PS   A    +DN++G  TV++ PTE G + +++ Y G ++PGSP  F V+V    +V      +    V +    T V  N              L + V  PS     C  +D  +G   + ++    G +++ V   + HI GSPF   +                 L +  +++    + ++   E     ++ +++ PS K E    +        +++   + G++E S++ +G+H+ NSPF I+V
Sbjct:  888 PSHDAGKVRAEGPGINKTGVQVEIPTHFTIFTKGAGKAKPEVHFKTAAKGNAVKDFEIIDNHDYSYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAP----SLDLGKVKVQGLNEKVE-VGKD--QEFIVNTK--GAGGQGKVNVSITSPSGRPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVEGLMPADPSKVRAYGPGLKGGIVGQPAKFSIDTKGAGAGGLGLTLEGPCEAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVVKPALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTIEI------VSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSVDTSGIKVYGPGVEPK--GVLREVTTHFIVDARAHAKTKGGN-HVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVRAYGPGLEGGI-VNKPNCFTVETRGAGTAGLGLTIEGASEA--------------KMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSGPGLANKVTAHVPQ------TFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHT--VNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASI--HDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATDQPVAPRDDTKPMFQPL-----NLVIPFTVQQ-----GELSGEVRMPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPGLCHGTVNKPASFTVVTKNA---------GQGGLSLAVEGPSKAEISC--KDNKDGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKI------------TGDDSLRRSQLNVGTAADVSLKITETDLSYLTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMV 2025          

HSP 8 Score: 251.521 bits (641), Expect = 2.739e-66
Identity = 301/1153 (26.11%), Postives = 485/1153 (42.06%), Query Frame = 3
Query: 1506 VYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGK--YVVRYTPTEEGPHKINVTYEGLPIQDSPFIVK-AKPGFNAQLVTASGPGL--HSCKVNEKTQFVVDLDGAGHGSLGLAIEGPAD----AEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXX-------------XXXXXXXSKGPIKDAKLLRPN--------HFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCE--YQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGN---PEKC-AIKAGKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAK--VVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVD-TKGEGRVTAFGPGLS-SGTTNEV-AEFTIITKDAGPG----GLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEP------VK----KSQVAVGNSSEIPLKIP-SSDLSTLTAELTTPSKIKVPCVIKK-MNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVG-SVTPGGSKDVTASGPGLE-KGFI-DINNEFAI----YTREAGAGNISVAMEGPSKAEM-KFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAARA 4766
            +YPK  K        A GPG+ P+G      A FTV+  E    G G V   V+ P G      +   N+ K  + V Y P  EG HK+ V + G  I  SPF+V  AK   +   V A GPGL       ++ T F +   GAG G + + I  P +     E+   +  D      Y PV  G + I V F  + I  SPF V + +               K +   +       + L+P          FT+    AG   L+V V  PG    + PV +  V     G F   Y P + G   +++ +   PI  SPF+  V + A  +KV+  G G+  + G +  S   V      + G     I G       P    IE    G  +C+  Y   + GD+ + V  D   +  SP+    +P  N   PEK  A   G + T + VNK +  T++ +EAGKG +    +  E    G V        I +++ +  DG     Y+P +  ++ + + +G  +IP   F           +  +      +   +     +  V+     +  V + +     VV P+    +  I  NDN    +K  Y P   G + + V    + I  SPF+  VD +   G+V A GPG++ +G   E+   FTI TK AG            +G +  + +  DNHD ++ V Y     G   I++     PI  SPF   IT  P      VK      +V VG   E  +    +     +   +T+PS   +PC ++      A  V + P E G + V++   G  +P SPF  +V+     D +KV+  G GL+ G+  Q  +F+IDT+ AG G L +++EGP +A+I+C+DN +G C+V YLPTE G+Y IN+ Y   ++PGSPF   V+       +  K+      ++  + G      +        +L + + + SG      I++  +G   + +     G+H +++ +  + +  SP    V  SV   G K     GPG+E KG + ++   F +    + +  G  ++ + +  PS A    +   +  G+  V Y   + G +   + ++   +  SPF + V  +   P   RA
Sbjct:  280 LYPKKAK--------AYGPGIEPQGNMVLKPAVFTVETLEA---GLGEVIVYVEDPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVLFAGQDIDKSPFMVNVAKALGDPNKVQARGPGLEPEGNVAHKPTYFDIYTAGAGAGDVSVVIVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISEAHLKPPGAPKQIPPQKKKASNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKGPGG--VEVPVKVCDV---GDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEVSKEAGTQKVRAWGPGL--KTGMVGKSADFVVEAIGTEVGTLGFSIEG-------PSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAREAGKGGLKIYAQDAE----GCV--------IDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRVLVGEGCHPDKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVK--YTPPGPGRYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGPGINKTGVQVEIPTHFTIFTKGAGKAKPEVHFKTAAKGNAVKDFEIIDNHDYSYTVKYTALHQGEMAIVVTHGGDPIPKSPF--KITVAPSLDLGKVKVQGLNEKVEVGKDQEFIVNTKGAGGQGKVNVSITSPSGRPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPF--SVEGLMPADPSKVRAYGPGLKGGIVGQPAKFSIDTKGAGAGGLGLTLEGPCEAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVVK----PALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSVDTSGIK---VYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVV-EGCDPTRVRA 1381          

HSP 9 Score: 236.884 bits (603), Expect = 6.575e-62
Identity = 126/284 (44.37%), Postives = 175/284 (61.62%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKA--DPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQ-VEIEASDKRCVSQYAEKSSS----NVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMV 5689
            ++A V  PSG +E   V ++   +  ++F PRE G H + V+ N   I GSPF++ VG  ++  DPGMV A G GL        ++F VNT  AGSG+L+V IDGPSKV M+C+E ++GY+ +Y   APGNY+I I YGG  HIVGSPF A V G + +   +  E  S  VE      +    Y+  +SS    +  K++C G GL +A +   NSF VD S+AG  +L+VG+ GP  PCE+V VKH+GN  + V Y VKE G ++++V+WGD+ IPGSPF V
Sbjct: 2433 IDAKVHAPSGVVEECYVTELDSDKNAIRFIPRENGVHSIDVKFNGSHIPGSPFKVRVGEAESVGDPGMVSAFGPGLEGGRTGVPSEFVVNTCKAGSGALSVTIDGPSKVKMDCNECQEGYKISYTPMAPGNYLICIKYGGPQHIVGSPFKAKVIGMRLSGGHSLHETSSVIVETVTKSSKMAGAYSSLTSSMPTSDASKVVCHGAGLSKAFVGQKNSFSVDCSKAGTNMLMVGVHGPRTPCEDVTVKHMGNKLYNVTYTVKEKGNYVVIVKWGDETIPGSPFHV 2716          

HSP 10 Score: 212.231 bits (539), Expect = 2.547e-54
Identity = 130/357 (36.41%), Postives = 195/357 (54.62%), Query Frame = 3
Query: 3681 LSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVN---------VHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSV-TPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNG-EHIVNSPF 4718
            +  +TA++T+P        I    N    V F P E G H VNV  +G  +PGSPF+  V     G   KV+  G GLE+ +A    EF+I TR+AG G L+I++EGPSKAEI+ +D ++G C V Y+  EPG+Y +++ +  +++P SPF        +VP  T   +  +  V + Q     E +LK+++ A   ++ N         VH PSG  E C + +  +    I+F+ RE+G+H + V     HI GSPF+  VG   + G    V+A GPGLE G   + +EF + T +AG+G +SV ++GPSK +M   E Q+     ++Y    PG+Y   IK+ G +HIV SPF
Sbjct: 2240 IQGMTAQVTSPGGNLADAEIVDSGNSTYRVRFVPTEMGSHTVNVKYRGEHVPGSPFQFTVGPLGEGGFHKVRAGGTGLERAVAKVPAEFSIWTREAGAGGLSIAVEGPSKAEINFEDRKDGSCGVSYVVQEPGDYEVSIKFNNEHIPDSPF--------IVPVATLSDDARRLTVTSLQ-----EKDLKVNQEASFAVQRNGARGVIDAKVHAPSGVVEECYVTELDSDKNAIRFIPRENGVHSIDVKFNGSHIPGSPFKVRVGEAESVGDPGMVSAFGPGLEGGRTGVPSEFVVNTCKAGSGALSVTIDGPSKVKMDCNECQE--GYKISYTPMAPGNYLICIKYGGPQHIVGSPF 2581          

HSP 11 Score: 135.576 bits (340), Expect = 4.884e-31
Identity = 99/352 (28.12%), Postives = 169/352 (48.01%), Query Frame = 2
Query: 4802 DAGGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGN-KSATNVNQEEQHSQV------------------EIEASDKRCVSQYAEKSSS---------------------NVEKIICQGLG------------LKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            + G    ++++  + ++  L AS++ PSG  EP +++++ +   G+ F+P+E G H V V  + K +N SPF+I VG  +  +   V A G+GL  A   + A+FFV+T NAG G L ++I+GPSKV++NC + EDG  + TY  T PGNYIINI +  + HI GSPFT  V G  +   ++ ++ Q + +                  ++ ++ +R    +   S +                     +VE+    G G            L + RL S  +   +  + G   +   +  P     +  +   GN+ + V +V  E G+H + V++  + +PGSPF   V
Sbjct: 1950 NVGTAADVSLKITETDLSYLTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINCDDVEDGTCKVTYCPTEPGNYIINIKF-ADKHIPGSPFTVKVTGEGRMKQSITRKRQAASIASVGSTCDLNLKIPGNWFQMLSAQERLTRTFTRSSHTYTRTERTEISKTHGGETKREVHVEESTQVGGGGGDPFRDVFESFLGRDRLGSFGTIRQEG-ETGIQGMTAQVTSPGGNLADAEIVDSGNSTYRVRFVPTEMGSHTVNVKYRGEHVPGSPFQFTV 2299          

HSP 12 Score: 114.005 bits (284), Expect = 1.831e-24
Identity = 89/303 (29.37%), Postives = 139/303 (45.87%), Query Frame = 2
Query: 4796 REDAGGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGM--VHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            R+  G   +I    E G I  + A V +P GN+  A +   G+  Y V+F P E G+H V V+   + + GSPF+  VG    + G   V A G GL  A+    A+F + T  AG+G L++A++GPSK  +N  + +DG    +YV   PG+Y ++I +  N HI  SPF   V                                   S +  ++    L  K  ++N   SF V  + A  G++   +  P    EE  V  + +++  + ++ +E+G H I V++    IPGSPF V V
Sbjct: 2223 RDRLGSFGTIRQEGETG-IQGMTAQVTSPGGNLADAEIVDSGNSTYRVRFVPTEMGSHTVNVKYRGEHVPGSPFQFTVGPL-GEGGFHKVRAGGTGLERAVAKVPAEFSIWTREAGAGGLSIAVEGPSKAEINFEDRKDGSCGVSYVVQEPGDYEVSIKF-NNEHIPDSPFIVPV--------------------------------ATLSDDARRLTVTSLQEKDLKVNQEASFAVQRNGA-RGVIDAKVHAPSGVVEECYVTELDSDKNAIRFIPRENGVHSIDVKFNGSHIPGSPFKVRV 2489          

HSP 13 Score: 110.923 bits (276), Expect = 1.577e-23
Identity = 88/273 (32.23%), Postives = 126/273 (46.15%), Query Frame = 2
Query: 4880 PSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSV-NSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVH 5692
            PSG    A +   GDG Y V+++  E G HL+ V  ++  +  SPF++ V     DP  V A G GL   IV+K   F V T  AG+  L + I+G S+  M C + +DG     Y+    G+Y INI YGG   I GSPF                                 +   K   +V K+ C G GL       V  +F VD S+AG   L V + GP    E VVVK+  +   TV+Y   + G H + V++ ++++P SP+ V+
Sbjct: 1321 PSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVE-GCDPTRVRAYGPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQ-PIPGSPF---------------------------------RVQVKDVVDVSKVKCSGPGLANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVN 1558          

HSP 14 Score: 110.538 bits (275), Expect = 1.819e-23
Identity = 88/283 (31.10%), Postives = 131/283 (46.29%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQIGDGQYG-VKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            K+  S+ +PSG   P  ++     +   VK+ P E G + V +  +  P+  SPF +  G   ADP  V A G GL   IV + AKF ++T  AG+G L + ++GP +  + C +  DG     Y+ T  G+Y INI Y G  HI GSPF AVV                                 K + +  K+   G GL++A+   V SF VD S+AG   L + I        EV +++  +  F+V Y     G H I +++G + +P SP  V V+
Sbjct: 1023 KVNVSITSPSGRPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVE-GLMPADPSKVRAYGPGLKGGIVGQPAKFSIDTKGAGAGGLGLTLEGPCEAKIECQDNGDGTCSVVYLPTEAGDYNINILY-GEAHIPGSPFKAVV---------------------------------KPALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVE 1270          

HSP 15 Score: 102.064 bits (253), Expect = 7.822e-21
Identity = 139/547 (25.41%), Postives = 217/547 (39.67%), Query Frame = 3
Query:    9 ETKPTKTP--DLYEVTYRPQECPNSKALHP-KVTVGGEDIPGSPFTIPFTKKDEDSKYIGTL-------EDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAP------DGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVV----------------QESPLITEEPILSEQIKTLKA--GNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQP------------SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPV 1508
            E KP K    D  + TY     P+    +   +  GG++IP SP+ +      + SK + T+       E L PN+++ +     V      K +   TV   NG+ ++ + V +    T+   YT  + G+++IT    G+ + K+P  V   D+            +AP  +     T  +  P  ++ P  V    L+ E ++ P  K A P      DGT  V F P E G H +        I  +P           +  +               G VNKP SFT+V  N         + V  P   + I  K  K        ++P   G Y+++   DN+ I GSP T  +                 +  L   E  LS    ++KA  G     + K  P +    +  L    KE+ E  V   K  +   + P            +S+V  +GKGL +    E A F +D+++A    +G+++EGP +  I+C D  DGTC V Y    PG Y IN+ + + HIP SP  V V
Sbjct: 1608 EGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELD-MDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATDQP-----------VAPRDD-----TKPMFQPLNLVIPFTVQQGELSGEVRM-PSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPL--------QFYVDVTNSGMVTAYGPGLCHGTVNKPASFTVVTKNAGQG--GLSLAVEGPSKAE-ISCKDNK-DGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKITGDDSLRRSQLNVGTAADVSLKITETDLSYLTASIKAPSGKEEPCLLKRLPNR----HIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINCDDVEDGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKV 2120          

HSP 16 Score: 92.0485 bits (227), Expect = 8.330e-18
Identity = 84/284 (29.58%), Postives = 125/284 (44.01%), Query Frame = 2
Query: 4871 VQTPSGNMEPAIVQQIGDGQ--YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHA--IVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNC-----HETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            V+ P G+ E A V    D +  + V + P+  G H V V    + I+ SPF + V     DP  V A G GL     +  K   F + T+ AG+G ++V I  P   N        ++ ++ +  TY     G + I++T+ G   I  SPF            VN  E H  ++   + K+   Q  + S++N  +   +GL  K  R+  V  F V    AG G L V + GP      V V  VG+  F  DY   + G + + + WG + IP SPF V V
Sbjct:  321 VEDPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVLFAGQDIDKSPFMVNVAKALGDPNKVQARGPGLEPEGNVAHKPTYFDIYTAGAGAGDVSVVIVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQ-PIPSSPF-----------KVNISEAH--LKPPGAPKQIPPQKKKASNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKGPGGVEVPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEV 590          

HSP 17 Score: 91.2781 bits (225), Expect = 1.186e-17
Identity = 80/281 (28.47%), Postives = 121/281 (43.06%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            +L+ SV+ P G   P  V  +GDG +   + P + G + V +    +PI  SPF + V   +A    V A G GL   +V K A F V       G+L  +I+GPS+  + C +  DG  +  Y  T PG+Y +++    +  I  SPF A +    +A +V                     + EK      K    GL      +N    F VDA +AG G L +          ++ +   G+  F   YV  +   H I++ WG+ +IP SPF V V
Sbjct:  533 ELKVSVKGPGGVEVPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEVSK-EAGTQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVIC-DDEDIKDSPFMAHIL--PAANDV---------------------FPEKV-----KAFGPGLEPTGVTVNKSTQFTVDAREAGKGGLKIYAQDAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRVLV 783          

HSP 18 Score: 80.1073 bits (196), Expect = 2.898e-14
Identity = 76/295 (25.76%), Postives = 120/295 (40.68%), Query Frame = 2
Query: 4820 SITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKK--AKFFVNTSNAGSGSLNVAIDGP--SKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMV 5689
            + TV      +  LE  +  P G +EP +V+   DG + V ++P + G H V V+   + +  SP+++       D   V ASG GL    V      +F ++  +AG G L V I  P       + H+  DG Y  +YV    G Y I I YGG+ +I  SP+                    Q        +C+   +            + LG    +++      VDA  AG G +   +  P     ++ V    +  F + Y   E G ++I +R+G + IP SPF V
Sbjct: 1490 TFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAP-SHDASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGD-NIPYSPYNV------------------QAFPTGDASKCLLTVSIGGHG------VESLG-PNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQV 1757          

HSP 19 Score: 78.1814 bits (191), Expect = 1.189e-13
Identity = 78/286 (27.27%), Postives = 111/286 (38.81%), Query Frame = 2
Query: 4904 IVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRI--------PVGHYKADP---------GMVHASGEGLSHAIVDKK--AKFFVNTSNAGSGSLNVAIDGPSKVNMN---CHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            I++  GD  +   + P   G H + V    +PI  SPF++        P G  K  P             A+G GL    V  K  A F V T  AG+G L V++ GP  V +    C   +  ++  Y    PG Y +NIT+GG   I  SPF                      E+E S +           +  +K+   G GLK   +     F V+A     G L   I GP +   ++     G+    V Y   E G + + V   D+DI  SPFM H+
Sbjct:  434 ILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISEAHLKPPGAPKQIPPQKKKASNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKGPGGVEVPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQ-PIPRSPF----------------------EVEVSKE-----------AGTQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGTLGFSIEGPSQ--AKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHI 683          

HSP 20 Score: 76.2554 bits (186), Expect = 4.340e-13
Identity = 84/274 (30.66%), Postives = 114/274 (41.61%), Query Frame = 2
Query: 4919 GDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKAD--PGMVHASGEGL--SHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG---YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVV-EGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIA---GPVRPCEEVV---VKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            GDG   V++ P E G + V V  + + I  SPF   +     D  P  V A G GL  +   V+K  +F V+   AG G L +         ++   T+ G   +   YV T P  + I IT+G   +I  SPF  +V EG                        C     +     VEK      GLK    N    F VD S+AG G + +GI    G V P E  +   +    N+ FTV Y     G + IMV + D++IP SPF V VD
Sbjct:  647 GDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAREAGKGGLKIYAQDAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIIITWG-EVNIPKSPFRVLVGEG------------------------CHPDKVKVYGPGVEKT-----GLKA---NEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGPGRYTIMVVFADQEIPSSPFKVKVD 887          

HSP 21 Score: 67.3958 bits (163), Expect = 2.391e-10
Identity = 77/261 (29.50%), Postives = 115/261 (44.06%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAI-VDKKAKFFVNTSNAG-SGSLNVAIDGPSKVNMNCH----ETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCE-EVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPF 5683
            D  Y VK++    G   + V +   PI  SPF+I V     D G V    +GL+  + V K  +F VNT  AG  G +NV+I  PS   + C     +T++     Y+    G+Y ++ITY GN  +  SPF+  VEG   A                               +  K+   G GLK   +     F +D   AG G L + + GP   CE ++  +  G+   +V Y+  E+G + I + +G+  IPGSPF
Sbjct:  950 DYSYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAP-SLDLGKVKV--QGLNEKVEVGKDQEFIVNTKGAGGQGKVNVSITSPSGRPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGN-PVPESPFS--VEGLMPA-------------------------------DPSKVRAYGPGLKGGIVGQPAKFSIDTKGAGAGGLGLTLEGP---CEAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPF 1170          

HSP 22 Score: 60.8474 bits (146), Expect = 2.217e-8
Identity = 73/312 (23.40%), Postives = 118/312 (37.82%), Query Frame = 2
Query: 4796 REDAGGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGL----------SHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG---YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVH 5692
            R  AG + S TV        +L   + + SG      +Q   DG + V ++P   G H + ++   + +  SP  + V     D   +   G G+          +H IVD +A    +    G   + + I  PS  N + + T+ G   Y   Y A   G ++I + Y     +  SPF   V                   +E  D   V  Y              G GL+   +N  N F V+   AG   L + I G      +++ K   +   +V+Y+   +G + I + +G + IPGSPF V 
Sbjct: 1192 RAKAGEVASFTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKV-EPSVDTSGIKVYGPGVEPKGVLREVTTHFIVDARA----HAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYD-EVAVPKSPFKVSV-------------------VEGCDPTRVRAY--------------GPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASE--AKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQ 1462          

HSP 23 Score: 56.9954 bits (136), Expect = 3.607e-7
Identity = 75/356 (21.07%), Postives = 127/356 (35.67%), Query Frame = 2
Query: 4817 ISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRI---PVGHYKADPGMVHASGEGLS----HAIVDKKAKFFVNTSNAGSGSLNVAIDGPS--KVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSAT-----------------NVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLN--------SVNSFFVDASQAGY----------------------------GILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            +  T+ A D     L   +  P G  + A +    DG Y V + P   G + + ++     I  SP+ +   P G        V   G G+     +  + ++    V+   AG G +   +  P+  +++M+  E  DG ++  Y A  PG Y+I I +GG  HI  SPF  +      A                   V Q E   +V + +           K  +   +      GL +  +         S   F+VD + +G                             G L + + GP +   E+  K   +   TV Y+    G + I+V++ +  IPGSPF   +
Sbjct: 1586 VEFTIDARDAGKGLLTVQILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQ-HIPKSPFQVMATDQPVAPRDDTKPMFQPLNLVIPFTVQQGELSGEVRMPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPGLCHGTVNKPASFTVVTKNAGQGGLSLAVEGPSK--AEISCKDNKDGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKI 1938          
BLAST of Filamin-A vs. Ensembl Zebrafish
Match: flnca (filamin C, gamma a (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-070503-1])

HSP 1 Score: 738.799 bits (1906), Expect = 0.000e+0
Identity = 473/1260 (37.54%), Postives = 671/1260 (53.25%), Query Frame = 3
Query: 1230 KPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTV--EGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDA-SEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLR--PNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKC---------AIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEI--NTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGE-PVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTE---------------PGN-YVINVTYAGK-------------------------NVPGSPFNVNVEGDKVVPCETQ------KMERVQ-------------EAVKATQVGGN--------CEINLKID------------EMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPF 4718
            KP   + KV   G GLE+  A E A FT+D   A  A + + +  +   +A +   +N DGT  V Y     G++TI + Y    +P+SPI V V P    ++D S +   GPG+ P+GV ++    F VDA +     G   VK  + +PSG  T+  I +  +G Y V YT  E+G H I V Y+ + +  SPF V    G +   V A GPGL    VN+   F V+  GAG   LGL IEG ++A++ C DNKDG+C VEY P  AGDYDI++ +  + I  SPF V+V D V   KVK  GP    K+    P  FT+DCS+AG APLEV++  P   +   PV +K       GT  V Y P + GP  + VKY    +  SP+K N        KV+  G G+      + AS+P  F ++ +DAG    + V + +P G+P    I    +G YT  Y     G + I++   G  +P SPY V++ PTG+  KC          +       IQ+++E+VIT++ K AGKG++TCTV+     +            + + V E+PDG   ++Y   E G+Y++ +++GGQ IP   F   AT              Q     +     F  +N  I    + G   +L+ +V  PSG      I   DN    + + +QP+E+G H++ +   G  I GSP QF+VD    G VTA+GPGL  GT N+ A FT++TK+AG GGLSL VEGPSK EI C+DN DGT  VSY+P  PG+YNII+KF +  I GSPFTA ITG+  +++SQ+ VG ++++ LKI  +DLS LTA +  PS  + PC++K++ N  +G+SFTPKE GEH V+V + G  +  SPFK+ V   E+G+A++VK  GKGL +    +  EF +DTR+AGYG L +SIEGPSK +I+C D E+G C V Y PTE               PG+ + + VT  G+                          +PG+ F +    +++    T+      + ER +                ++TQVGG          E  L  D            E  ++ +   V +P G     +I D+GN   R++FV  E G H V+V ++  H+ GSPFQFTVG +  GG   V A G GLE+    +  EF+I+TREAGAG +S+A+EGPSKAE+ F++ +D GSC V+Y V +PGDYE SIKFN EHI +SPF
Sbjct: 1157 KPALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEP----SVDTSGIKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVRAYGPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSGPGLANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTL--EPVVVKN---NRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASKVRASGPGL--DTTGVAASLPVEFTIDARDAGKGL-LTVQILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVAESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGME------------LDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATD-------------QPVAPRDDTKPMFQPLNLVIPFTVQQG---ELSGEVRMPSGKTARPFI--RDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPGLCHGTVNKPASFTVVTKNAGQGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKITGDDSLRRSQLNVGTAADVSLKITETDLSYLTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINCDDVEDGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKVTGEGRMKQSITRKRQAASIASVGSTCDLNLKIPGNWFQMLSAQERLTRTFTRSSHTYTRTERTEISKTHGGETKREVHVEESTQVGGGGGDPFRDVFESFLGRDRLGSFGTIRQEGETGIQGMTAQVTSPGGNLADAEIVDSGNSTYRVRFVPTEMGSHTVNVKYRGEHVPGSPFQFTVGPLGEGGFHKVRAGGTGLERAVAKVPAEFSIWTREAGAGGLSIAVEGPSKAEINFEDRKD-GSCGVSYVVQEPGDYEVSIKFNNEHIPDSPF 2373          

HSP 2 Score: 362.844 bits (930), Expect = 6.317e-128
Identity = 410/1535 (26.71%), Postives = 655/1535 (42.67%), Query Frame = 3
Query:  450 PENVEKIKVEGLAPMIE-----VCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGTK---VTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQV-NKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIP--VKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESP---------------LITEEPILSEQIKTLKAGNPHNPMQKANPGKSNKPYTALE--EAIKEMKESAVESSKWP-------QSKPDQP----------SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIE------GPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLR---PNHFTIDCSEAGKAPLEV--KVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTC-EYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTR-SVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF----FVDTKGEGRVTAFGPGLS-SGTTNEVAEFTII-----TKDAGPGGLSLIVEGPS--KTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANIT--GEPVKKSQVAVGNSSEIPLK-----IPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGL-EKGLANQGNEFTIDTRDAGYGSLNISIEGP--SKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKID--EMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQ---FTVG-------SVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQD-KGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAAR 4763
            P+ +   K +   P IE     V  P  F V + E  +   +V V+  +PE         A  D  +   VT+VPK  G H +      Q I+++P +V ++ KA       +   P      E EG V +KP  F I          D  VV++ P N       +   K      C + P   GP+++  +    PI  SP  + + E+                 +  + +    + T  AG     +    PG    P    +  + + +     V+  K+        Q  P  P          + KV  +G GL+     + A F +++       +G ++EGP +A I+C D GDG+C V Y    PG Y ++V+ D+  I  SP +  + P  N ++    V A GPGL P GV  +   +FTVDA E    G+G +K   Q   G   +  I +  +G +V  Y PT+   H I +T+  + I  SPF V    G +   V   GPG+     K NE T F VD   AG G + + I+      GPA+A+I      N + T  V+YTP   G Y I V F D++I  SPF V+V       KV+++GP  +   ++   P HFTI    AGKA  EV  K +  G+ + D  +           ++ V Y     G   I V +   PI  SPFK  V     + KVKV G      N  +       F VNTK AG    V V + +P+G P+P  +E+      TC +Y   + G +K+ +  DG P+P+SP++V+ +   +P K        K   V + +  +I+TK AG G +  T++       G  E        K++ Q++ DG  SV Y+P E G+Y + + YG   IP   F      +    + T +   ++   + E+AS       F ++       +L  ++V  SG   EV I +N +      + Y P   G H + +   G+ +  SP        VDT G   +  +GPG+   G   EV    I+      K  G   + + +  PS   T+    D  DGT++V Y     G + I + + +  +  SPF  ++    +P +      G    I  K     + +    T    LT     +   + K   +G+  V + P   G++ +N+   G  IPGSPF+V VK+      +KVK SG GL  K  A+    FT+D   AG   L + + GP  +   +  K+N +G  TV Y P + G + ++V YA + VP SP+ VN         +  K+      +  T V  +  +   ID  +     L V +  P G  +   I D  +G   + +V   +G + +++ +   +I  SP+    F  G       +V+ GG     + GP ++   +       +  + AG G ++  ++ P+  E+    +++  G+  + Y   +PG Y  +I+F G+HI  SPF ++  D   +PVA R
Sbjct:  277 PKQLYPKKAKAYGPGIEPQGNMVLKPAVFTVETLEAGLGEVIVYVE--DPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVLFAGQDIDKSPFMV-NVAKALGDPNKVQARGPGL----EPEGNVAHKPTYFDIYTAGAG--AGDVSVVIVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISEASNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKGPGGVEVPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEVSKEAGTQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAAN-DVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAREA---GKGGLKIYAQDAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRVLVGEGCHPDKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGPGRYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGPGINKTGVQVEIPTHFTIFTKGAGKAKPEVHFKTAAKGNAVKDFEIIDNHDY-----SYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAPSLDLGKVKVQG-----LNEKVEVGKDQEFIVNTKGAGGQGKVNVSITSPSGRPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVEGLMPADPSKVRAYGPGLKGGIVGQPAKFSIDTKGAGAGGLGLTLE-------GPCEA-------KIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVVKPALDAGKVTASGPGLERAKAGEVAS-------FTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKD--GTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSVDTSG---IKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVRAYGPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVD--VSKVKCSGPGLANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSH----DASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVAESLGPNIQ---MSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATD---QPVAPR 1750          

HSP 3 Score: 117.857 bits (294), Expect = 6.317e-128
Identity = 100/338 (29.59%), Postives = 150/338 (44.38%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGN----KSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGL-----GL------------------------------------KQARLNSVNSFFVDA------------SQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            +L   V+ PSG      ++   DG   V+F P E G H + ++ +   I GSP +  V     + GMV A G GL H  V+K A F V T NAG G L++A++GPSK  ++C + +DG    +Y+ T PG+Y I + +  N HI GSPFTA + G+    +S  NV      S ++I  +D   ++   +  S   E  + + L     GL                                    + +R+ +     V+A              AGYG L + I GP +   ++    V +    V Y   E G +II +++ DK IPGSPF V V
Sbjct: 1772 ELSGEVRMPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVD--VTNSGMVTAYGPGLCHGTVNKPASFTVVTKNAGQGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTTPGDYNIIVKF-DNSHIPGSPFTAKITGDDSLRRSQLNVGTAADVS-LKITETDLSYLTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSK--VDINCDDVEDGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKV 2103          

HSP 4 Score: 370.548 bits (950), Expect = 7.163e-103
Identity = 444/1636 (27.14%), Postives = 701/1636 (42.85%), Query Frame = 3
Query:   96 VTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLND-GIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQAT---YTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIE---VCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQES----------PLITEEPILSEQIKTL----------KAGNPHNPMQKANPGKSNK--------------PYTALEEAIKEMK----ESAVESSKWPQSKPDQPS-SKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEK--TQFVVDLDGAGHGSLGLAI---EG-PADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXX---XXXXXXXXXXSKGPIKDAKLLRPNH-------FTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVV-QPAQVEKVKVDGDGIIPQNGA--ILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEP------VKKSQVA----VGNSSEIPLKIPSSDLSTLTA-ELTTPSKIKVPCVIKKMNNGALGVSF---TPKETG-EHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVE-----GDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGA-GNISVAMEGPSKA-EMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            VT GG+ IP SPF I      +  K    ++ L   V++ + Q F V     G + +  V+++  +G    P+  K  S  T +AT   Y P + G + +  + DG PV ++P  V  +  +P +  K++  G  P ++   V  P  F + +  K      + + +  P    I        DGT  V ++P E G ++I     +  I  +P   K++ K  +       S P       K G+V    SFT+  D +     +  + ++S    Q                + P   G +++        +  SP  + V+ S          P +  + +L E               K GN H  ++  NP  +N                YTA E+ +  ++    E AV  S +  S  +    ++V  YG GLE     +   FT++++ A +A +G+T+EG  EA + C DN DG+C V Y     G Y IN+ Y    IP SP  V    +    +D+S V  SGPGL+ + V       FTVD S+    G   ++  +  P G     ++ N  +G + V YTP +EGPH ++V Y    +  SP+ V + P  +A  V ASGPGL +  V      +F +D   AG G L + I   EG P  A I  HDN+DGT  V Y P   G Y I++K+  ++I  SP++V+     D  K     S G    A+ L PN         T+D   AGK  +   V  P     D  VT         GTFD+ Y   E G  +I +++    I  SPF+     QP            + P++    +   +  V     +   ++ +V +    P+G+     I    +G  T ++Q  + G H++ +  DG  +P SP       T +    A   G      VNK +  T+ TK AG+G ++  V+   + ++                +++ DG  +V Y+P   G+Y + VK+    IP   F    T       +++ RS   Q++   A++    V+ +I   D     L A +  PSG  +E P         +I + + P E G H++ V   G+ +  SPF+  V     G   RV AFG GL    T EVAEF + T++AG GGL L +EGPSK +I C+D  DGT KV+Y P  PGNY I IKF D+ I GSPFT  +TGE        +K Q A    VG++ ++ LKIP +    L+A E  T +  +      +     +  +    T +E   E    V   G D     F+  +  + +G    ++  G+   +G+  Q                 ++  G + A+ +  D+ N    V+++PTE G++ +NV Y G++VPGSPF   V      G   V      +ER    V A       E ++   E     L + V  PS      + ED  +G+  + +V +E G + VS+   + HI  SPF   V +++    +    S   L++  + +N E +   +  GA G I   +  PS   E  +    D    A+ +   + G +   +KFNG HI  SPF + V
Sbjct:  951 VTHGGDPIPKSPFKITVAPSLDLGKV--KVQGLNEKVEVGKDQEFIVNTKGAGGQGKVNVSITSPSG---RPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVEGL--MPADPSKVRAYG--PGLKGGIVGQPAKFSIDT--KGAGAGGLGLTLEGPCEAKIECQDNG--DGTCSVVYLPTEAGDYNINILYGEAHIPGSP--FKAVVKPALDAGKVTASGPGLE--RAKAGEV---ASFTV--DCSRAGEAELTIEIVSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSVDTSGIKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGN-HVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVRAYGPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRV----QVKDVVDVSKVKCSGPGLANK-VTAHVPQTFTVDCSKA---GVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASI--HDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVAESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTEN-----PDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATDQP------------VAPRDDTKPMFQPLNLVIPFTVQQGELSGEVRM----PSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPGLCHGT-VNKPASFTVVTKNAGQGGLSLAVEGPSKAEI--------------SCKDNKDGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKITGD-----DSLRRS---QLNVGTAAD----VSLKITETD--LSYLTASIKAPSG--KEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINCDDVEDGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKVTGEGRMKQSITRKRQAASIASVGSTCDLNLKIPGNWFQMLSAQERLTRTFTRSSHTYTRTERTEISKTHGGETKREVHVEESTQVGGGGGDPFRDVFESFLGRDRLGSFGTIRQEGETGIQGMTAQ-----------------VTSPGGNLADAEIVDSGNSTYRVRFVPTEMGSHTVNVKYRGEHVPGSPFQFTVGPLGEGGFHKVRAGGTGLERAVAKVPA-------EFSIWTREAGAGGLSIAVEGPS--KAEINFEDRKDGSCGVSYVVQEPGDYEVSIKFNNEHIPDSPFIVPVATLSDDARRLTVTS---LQEKDLKVNQEASFAVQRNGARGVIDAKVHAPSGVVEECYVTELDSDKNAIRFIPRENGVHSIDVKFNGSHIPGSPFKVRV 2472          

HSP 5 Score: 369.777 bits (948), Expect = 1.161e-102
Identity = 427/1592 (26.82%), Postives = 680/1592 (42.71%), Query Frame = 3
Query:  216 QPQTFKVKLNDGIKSEPCVTVSDKNGVPVEP-VLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPE-NVEKIKVEGLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENK---IIPIHKEAAPDGTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPAT-LAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLL-CEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPILSEQIKTLKAGNPHNPMQKA------NPGKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQ---------------------PSS------KVIVYGKGLE--KVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVID--CVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQ------SPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEK--TQFVVDLDGAGHGS----LGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEA-GKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTK--DAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCE--YQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQE--VRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF-FVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAV--GNSSEIPLKIPS--------SDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKG--LANQGNEFTIDTRDAGYGSLNISI---EG-PSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNV----EGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKV--NVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVE 4733
            +P  F V+  +    E  V V D  G   E  V+       T+  TY P   G+H +     G+ + K+P +V+V   + + N  + +  GL P   V    T+  +        D V V +++P+NK   +  I +    +  + T+ P   GPH+I      QPI  +P       K +I EA N  +  AT   ++ K  +V +   FT+          +  V V  P   + +PVK   +  G+  C++ P K G Y++  +    PI  SP  + V +     +       +KT   G   + + +A        G S +  +  +    +  + + +   WP    D                      P++      KV  +G GLE   V   +   FT+D+++A    + +  +     VID    D GDGT   VY    P  +TI + +  V+IP+SP  V V     +      V   GPG+   G+  +    FTVD SE    GQG V   ++       P+    +  I   +N  + V+YTP   G + I V +    I  SPF VK  P  +A  V A GPG++   V  +  T F +   GAG          A +G A  + +  DN D +  V+YT +  G+  I V    + I  SPF + V   +   KVK +G  +  ++ +   F ++   A G+  + V ++ P    S RP+  K           V Y+P E G   +D+ Y+ +P+  SPF    + PA   KV+  G G+    G I+   PA F ++TK   AG     + G       P    IE + NG  TC   Y   + GD+ I++    A +P SP+     P  +  K        +  +  + +  T++   AG+ ++T    +I      Q E         V +Q + DG  SV Y P   G + + +KYGGQ +P          S     ++          +  E+ ++          TK G  V +  +++ PSG   +  IT  D      +++Y   E G H ++V      +  SPF+   V+     RV A+GPGL  G  N+   FT+ T+ AG  GL L +EG S+ ++ C+DN DG+  V Y+P   G+Y+I I +  QPI GSPF   +              G ++++   +P         + ++ L  +L  P     P V+K   +G   V++TP + G H V+V     ++P SP+KVN       DA+KV+ SG GL+     A+   EFTID RDAG G L + I   EG P KA I   DN +G  TV Y+P   G Y I + Y G N+P SP+NV      +  K +   +     V E++    +  + E  + +D  A    KV   V TP+G     D+ +  +G   I + A E G + +++    +HI  SPFQ  + +  P   +D T       K      N    +T + G  +  V M     A    ++++D G+  V ++ ++ G +E  IK++G HI  SP    V+
Sbjct:  301 KPAVFTVETLEAGLGEVIVYVEDPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVLFAGQDIDKSPFMVNVAKALGDPNKVQARGPGLEPEGNVAHKPTYFDIYTAGAGAGD-VSVVIVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPF------KVNISEASNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTG--ELKVSVKGPGGVE-VPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEVSKEAGTQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAREAGKGGLKIYAQDAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRVLV----GEGCHPDKVKVYGPGVEKTGLKANEPTYFTVDCSEA---GQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGPGRYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGPGINKTGVQVEIPTHFTIFTKGAGKAKPEVHFKTAAKGNAVKDFEIIDNHDYSYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAPSLDLGKVKVQGLNEKVEVGKDQEFIVNTKGAGGQGKVNVSITSP----SGRPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVEGLMPADPSKVRAYGPGL---KGGIVG-QPAKFSIDTKGAGAGGLGLTLEG-------PCEAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVVKPALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTI---EIVSDSGAQAE---------VCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSVDTSGIKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKI--RIINPSGANTDAYIT--DKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVRAYGPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSGPGLANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSH--DASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASI--HDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVAESL-GPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQ-VMATDQPVAPRDDT-------KPMFQPLNLVIPFTVQQGELSGEVRMPSGKTARPFIRDNKD-GTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVD 1830          

HSP 6 Score: 353.984 bits (907), Expect = 9.091e-98
Identity = 409/1649 (24.80%), Postives = 661/1649 (40.08%), Query Frame = 3
Query:   45 VTYRPQECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAP---MIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTI----VVQESPLITEEPILSEQIKTL----------KAGNPHNPMQKANPGKSNKP--------------YTALEE-----AIKEMKESAVESSKWPQSKPDQPSSKVIVYGKGLEK--VAAKEKAIFTIDSKDAPSAPIGVTV---EG-PGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKA-----------KPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQ--CHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESV--ITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPN----------------------------------------GKFFQTA------TYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTK----DGVPVD----------------------------LNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSEIPLKI---------PSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNV-KNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAG-KNVPGSPFNVNVEGDKV-----------VPCET----QKMERVQEAVKATQ-------------------VGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFT 4439
            V Y P E  +    +  +  G   IPGSPF        +  K   +   L+   K  +  +F V  +   ++E  + +   +G   E V ++     T+  TYTP   G H IT    G+ V K+P+ V V   +  +  K+   G+ P   + EV         +  K    + V ++++NP       +     DGT +V +   E+G H I  +  +  + ++P  V  +   D      +   P       + G VNKP  FT+  +          + +      + +   +K        E++P  AG Y +  +    PI GSP  +    VV  S +    P L+ ++             KAG     +Q   P  + +P              YT  +E     ++K   +    S     S P   +SKV   G GL+   VAA     FTID++DA    + V +   EG P +A I   DN DGT  V Y   + G YTI + Y   +IP SP  V  +P  + +  L TV+  G G++         ++ TV   +    G+G V   VQ+P+G + +  +    +G + + YT  E G + I + + G  I  SPF V A           KP F                +N    F V       G L   +  P+    +    DNKDGT  V++ P + G +++ +K++   I  SP    V              +    + +P  FT+    AG+  L + V  P    S   ++ K  +    GT  V Y+P   G   I VK++ S I GSPF   +     + + +++          +  +      +   D      +   +  P+G+  P  ++  PN      +   +VG+H++SV   G  +  SP+ +   P+   E   +KA     ++ +   V    ++T+ AG G +  +++   +              + +   +  DG   V Y P E G Y++ +K+  + IP                                         G +FQ        T +F     T TR+ + +IS          V+ E +T+     G P                              + A+V  P G + +  I  + N  + ++  + P+E G H + V  +G  + GSPFQF V   GEG   +V A G GL        AEF+I T++AG GGLS+ VEGPSK EI  ED  DG+  VSYV Q PG+Y + IKF ++ I  SPF   +        ++ V +  E  LK+          +     + A++  PS +   C + ++++    + F P+E G H ++V   G+ IPGSPFKV V + E VGD   V   G GLE G     +EF ++T  AG G+L+++I+GPSK ++DC + + G   + Y P  PGNY+I + Y G +++ GSPF   V G ++           V  ET     KM     ++ ++                    VG     ++   +     L V VH P    E   ++  GN    + +  +E G + V V   D  I GSPF  +
Sbjct: 1126 VVYLPTEAGD---YNINILYGEAHIPGSPFKAVVKPALDAGKVTASGPGLE-RAKAGEVASFTVDCSRAGEAELTIEIVSDSGAQAE-VCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSVDTSGIKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRV--RAYGPGL-----EGGIVNKPNCFTV--ETRGAGTAGLGLTIEGASEAKMLCKDNKD--GSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSGPGLANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIH--DNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVAESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATDQPVAPRDDTKPMFQP--------------LNLVIPFTVQ-----QGELSGEVRMPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPGLCHGTVNKPASFTVVTKNAGQGGLSLAVEGP----SKAEISCKDNK---DGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKITGDDSLRRSQLN----------VGTAADVSLKITETDLSY---LTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSK--------------VDINCDDVEDGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKVTGEGRMKQSITRKRQAASIASVGSTCDLNLKIPGNWFQMLSAQERLTRTFTRSSHTYTRTERTEISKTHGGETKREVHVEESTQVGGGGGDPFRDVFESFLGRDRLGSFGTIRQEGETGIQGMTAQVTSPGGNLADAEIVDSGNSTYRVR--FVPTEMGSHTVNVKYRGEHVPGSPFQFTVGPLGEGGFHKVRAGGTGLERAVAKVPAEFSIWTREAGAGGLSIAVEGPSKAEINFEDRKDGSCGVSYVVQEPGDYEVSIKFNNEHIPDSPFIVPVATLSDDARRLTVTSLQEKDLKVNQEASFAVQRNGARGVIDAKVHAPSGVVEECYVTELDSDKNAIRFIPRENGVHSIDVKFNGSHIPGSPFKVRVGEAESVGDPGMVSAFGPGLEGGRTGVPSEFVVNTCKAGSGALSVTIDGPSKVKMDCNECQEGY-KISYTPMAPGNYLICIKYGGPQHIVGSPFKAKVIGMRLSGGHSLHETSSVIVETVTKSSKMAGAYSSLTSSMPTSDASKVVCHGAGLSKAFVGQKNSFSVDCSKAGTNMLMVGVHGPRTPCEDVTVKHMGNKLYNVTYTVKEKGNYVVIVKWGDETIPGSPFHVS 2700          

HSP 7 Score: 327.02 bits (837), Expect = 1.971e-89
Identity = 343/1215 (28.23%), Postives = 542/1215 (44.61%), Query Frame = 3
Query: 1233 PDQPSSKVIVYGKGLEKVAAKEK--AIFTIDSKDAPSAP--IGVTVEGPGEAVID--CVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQT-NGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQ-VEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVN----TKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKC-AIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKF-FQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF-FVDTKGEGRVTAFGPGL-SSGTTNEV-AEFTIITKDAGPGGLSLIV---EG-PSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI--TGEPVK-KSQVAVGN---SSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMN------------NGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPS--KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSP--FNVNVEGDKVVPCETQKM--ERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINN--EFAIYTREAGAGNISVAMEGPS-KAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            P   + KV   G G+ K   + +    FTI +K A  A   +       G AV D   +DN D +  V Y     G   I V +    IP+SP  + V P    +LDL  V   G     E V KD   +F V+       GQG V   + SPSG+     L  +       V+Y P EEG +K+++TY+G P+ +SPF V+     +   V A GPGL    V +  +F +D  GAG G LGL +EGP +A+I+C DN DGTC V Y P +AGDY+I++ + +  I  SPF   V   +   KV + GP ++ AK      FT+DCS AG+A L +++      +SD     +  ++    GTF V Y P   G   I +KY    +  SP    V        +KV G G+ P+   +L  +   F V+     K  G N  V + + NP+G     +I  + +G Y  EY   + G H I V  D   +PKSP+ V  +   +P +  A   G +  I VNK +  T+ET+ AG   +  T++                   K+  +++ DG  SV YMP   G+Y + + YGGQ IP   F  Q          +     + N+++  +         F ++        L  ++  P G +E V + +N +  H   ++Y P++ GPH + V    + +  SP++     +    +V A GPGL ++G    +  EFTI  +DAG G L++ +   EG P K  I   DN DGT+ VSYVP   G Y I IK+    I  SP+      TG+  K    V++G    +  +   I  S+ + +T +     K KV C ++  N            +G   + +T  E G++++ +   G  IP SPF+V   ++ V      K   + L     N    FT+       G L+  +  PS   A    +DN++G  TV++ PTE G + +++ Y G ++PGSP  F V+V    +V      +    V +    T V  N              L + V  PS     C  +D  +G   + ++    G +++ V   + HI GSPF   +                 L +  +++    + ++   E     ++ +++ PS K E    +        +++   + G++E S++ +G+H+ NSPF I+V
Sbjct:  870 PSHDAGKVRAEGPGINKTGVQVEIPTHFTIFTKGAGKAKPEVHFKTAAKGNAVKDFEIIDNHDYSYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAP----SLDLGKVKVQGLNEKVE-VGKD--QEFIVNTK--GAGGQGKVNVSITSPSGRPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVEGLMPADPSKVRAYGPGLKGGIVGQPAKFSIDTKGAGAGGLGLTLEGPCEAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVVKPALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTIEI------VSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSVDTSGIKVYGPGVEPK--GVLREVTTHFIVDARAHAKTKGGN-HVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVRAYGPGLEGGI-VNKPNCFTVETRGAGTAGLGLTIEGASEA--------------KMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSGPGLANKVTAHVPQ------TFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHT--VNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASI--HDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVAESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATDQPVAPRDDTKPMFQPL-----NLVIPFTVQQ-----GELSGEVRMPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPGLCHGTVNKPASFTVVTKNA---------GQGGLSLAVEGPSKAEISC--KDNKDGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKI------------TGDDSLRRSQLNVGTAADVSLKITETDLSYLTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMV 2008          

HSP 8 Score: 259.996 bits (663), Expect = 6.267e-69
Identity = 301/1135 (26.52%), Postives = 484/1135 (42.64%), Query Frame = 3
Query: 1506 VYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGK--YVVRYTPTEEGPHKINVTYEGLPIQDSPFIVK-AKPGFNAQLVTASGPGL--HSCKVNEKTQFVVDLDGAGHGSLGLAIEGPAD----AEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNH---FTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCE--YQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGN---PEKC-AIKAGKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAK--VVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVD-TKGEGRVTAFGPGLS-SGTTNEV-AEFTIITKDAGPG----GLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEP------VK----KSQVAVGNSSEIPLKIP-SSDLSTLTAELTTPSKIKVPCVIKK-MNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVG-SVTPGGSKDVTASGPGLE-KGFI-DINNEFAI----YTREAGAGNISVAMEGPSKAEM-KFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAARA 4766
            +YPK  K        A GPG+ P+G      A FTV+  E    G G V   V+ P G      +   N+ K  + V Y P  EG HK+ V + G  I  SPF+V  AK   +   V A GPGL       ++ T F +   GAG G + + I  P +     E+   +  D      Y PV  G + I V F  + I  SPF V + +       ++ G     K +R      FT+    AG   L+V V  PG    + PV +  V     G F   Y P + G   +++ +   PI  SPF+  V + A  +KV+  G G+  + G +  S   V      + G     I G       P    IE    G  +C+  Y   + GD+ + V  D   +  SP+    +P  N   PEK  A   G + T + VNK +  T++ +EAGKG +    +  E    G V        I +++ +  DG     Y+P +  ++ + + +G  +IP   F           +  +      +   +     +  V+     +  V + +     VV P+    +  I  NDN    +K  Y P   G + + V    + I  SPF+  VD +   G+V A GPG++ +G   E+   FTI TK AG            +G +  + +  DNHD ++ V Y     G   I++     PI  SPF   IT  P      VK      +V VG   E  +    +     +   +T+PS   +PC ++      A  V + P E G + V++   G  +P SPF  +V+     D +KV+  G GL+ G+  Q  +F+IDT+ AG G L +++EGP +A+I+C+DN +G C+V YLPTE G+Y IN+ Y   ++PGSPF   V+       +  K+      ++  + G      +        +L + + + SG      I++  +G   + +     G+H +++ +  + +  SP    V  SV   G K     GPG+E KG + ++   F +    + +  G  ++ + +  PS A    +   +  G+  V Y   + G +   + ++   +  SPF + V  +   P   RA
Sbjct:  280 LYPKKAK--------AYGPGIEPQGNMVLKPAVFTVETLEA---GLGEVIVYVEDPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVLFAGQDIDKSPFMVNVAKALGDPNKVQARGPGLEPEGNVAHKPTYFDIYTAGAGAGDVSVVIVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISEASNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKGPGG--VEVPVKVCDV---GDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEVSKEAGTQKVRAWGPGL--KTGMVGKSADFVVEAIGTEVGTLGFSIEG-------PSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAREAGKGGLKIYAQDAE----GCV--------IDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRVLVGEGCHPDKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVK--YTPPGPGRYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGPGINKTGVQVEIPTHFTIFTKGAGKAKPEVHFKTAAKGNAVKDFEIIDNHDYSYTVKYTALHQGEMAIVVTHGGDPIPKSPF--KITVAPSLDLGKVKVQGLNEKVEVGKDQEFIVNTKGAGGQGKVNVSITSPSGRPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPF--SVEGLMPADPSKVRAYGPGLKGGIVGQPAKFSIDTKGAGAGGLGLTLEGPCEAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVVK----PALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSVDTSGIK---VYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVV-EGCDPTRVRA 1363          

HSP 9 Score: 236.884 bits (603), Expect = 7.819e-62
Identity = 126/284 (44.37%), Postives = 175/284 (61.62%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKA--DPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQ-VEIEASDKRCVSQYAEKSSS----NVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMV 5689
            ++A V  PSG +E   V ++   +  ++F PRE G H + V+ N   I GSPF++ VG  ++  DPGMV A G GL        ++F VNT  AGSG+L+V IDGPSKV M+C+E ++GY+ +Y   APGNY+I I YGG  HIVGSPF A V G + +   +  E  S  VE      +    Y+  +SS    +  K++C G GL +A +   NSF VD S+AG  +L+VG+ GP  PCE+V VKH+GN  + V Y VKE G ++++V+WGD+ IPGSPF V
Sbjct: 2416 IDAKVHAPSGVVEECYVTELDSDKNAIRFIPRENGVHSIDVKFNGSHIPGSPFKVRVGEAESVGDPGMVSAFGPGLEGGRTGVPSEFVVNTCKAGSGALSVTIDGPSKVKMDCNECQEGYKISYTPMAPGNYLICIKYGGPQHIVGSPFKAKVIGMRLSGGHSLHETSSVIVETVTKSSKMAGAYSSLTSSMPTSDASKVVCHGAGLSKAFVGQKNSFSVDCSKAGTNMLMVGVHGPRTPCEDVTVKHMGNKLYNVTYTVKEKGNYVVIVKWGDETIPGSPFHV 2699          

HSP 10 Score: 211.46 bits (537), Expect = 3.587e-54
Identity = 130/357 (36.41%), Postives = 195/357 (54.62%), Query Frame = 3
Query: 3681 LSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVN---------VHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSV-TPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNG-EHIVNSPF 4718
            +  +TA++T+P        I    N    V F P E G H VNV  +G  +PGSPF+  V     G   KV+  G GLE+ +A    EF+I TR+AG G L+I++EGPSKAEI+ +D ++G C V Y+  EPG+Y +++ +  +++P SPF        +VP  T   +  +  V + Q     E +LK+++ A   ++ N         VH PSG  E C + +  +    I+F+ RE+G+H + V     HI GSPF+  VG   + G    V+A GPGLE G   + +EF + T +AG+G +SV ++GPSK +M   E Q+     ++Y    PG+Y   IK+ G +HIV SPF
Sbjct: 2223 IQGMTAQVTSPGGNLADAEIVDSGNSTYRVRFVPTEMGSHTVNVKYRGEHVPGSPFQFTVGPLGEGGFHKVRAGGTGLERAVAKVPAEFSIWTREAGAGGLSIAVEGPSKAEINFEDRKDGSCGVSYVVQEPGDYEVSIKFNNEHIPDSPF--------IVPVATLSDDARRLTVTSLQ-----EKDLKVNQEASFAVQRNGARGVIDAKVHAPSGVVEECYVTELDSDKNAIRFIPRENGVHSIDVKFNGSHIPGSPFKVRVGEAESVGDPGMVSAFGPGLEGGRTGVPSEFVVNTCKAGSGALSVTIDGPSKVKMDCNECQE--GYKISYTPMAPGNYLICIKYGGPQHIVGSPF 2564          

HSP 11 Score: 135.191 bits (339), Expect = 5.439e-31
Identity = 99/352 (28.12%), Postives = 169/352 (48.01%), Query Frame = 2
Query: 4802 DAGGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGN-KSATNVNQEEQHSQV------------------EIEASDKRCVSQYAEKSSS---------------------NVEKIICQGLG------------LKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            + G    ++++  + ++  L AS++ PSG  EP +++++ +   G+ F+P+E G H V V  + K +N SPF+I VG  +  +   V A G+GL  A   + A+FFV+T NAG G L ++I+GPSKV++NC + EDG  + TY  T PGNYIINI +  + HI GSPFT  V G  +   ++ ++ Q + +                  ++ ++ +R    +   S +                     +VE+    G G            L + RL S  +   +  + G   +   +  P     +  +   GN+ + V +V  E G+H + V++  + +PGSPF   V
Sbjct: 1933 NVGTAADVSLKITETDLSYLTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINCDDVEDGTCKVTYCPTEPGNYIINIKF-ADKHIPGSPFTVKVTGEGRMKQSITRKRQAASIASVGSTCDLNLKIPGNWFQMLSAQERLTRTFTRSSHTYTRTERTEISKTHGGETKREVHVEESTQVGGGGGDPFRDVFESFLGRDRLGSFGTIRQEG-ETGIQGMTAQVTSPGGNLADAEIVDSGNSTYRVRFVPTEMGSHTVNVKYRGEHVPGSPFQFTV 2282          

HSP 12 Score: 113.62 bits (283), Expect = 1.939e-24
Identity = 89/303 (29.37%), Postives = 139/303 (45.87%), Query Frame = 2
Query: 4796 REDAGGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGM--VHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            R+  G   +I    E G I  + A V +P GN+  A +   G+  Y V+F P E G+H V V+   + + GSPF+  VG    + G   V A G GL  A+    A+F + T  AG+G L++A++GPSK  +N  + +DG    +YV   PG+Y ++I +  N HI  SPF   V                                   S +  ++    L  K  ++N   SF V  + A  G++   +  P    EE  V  + +++  + ++ +E+G H I V++    IPGSPF V V
Sbjct: 2206 RDRLGSFGTIRQEGETG-IQGMTAQVTSPGGNLADAEIVDSGNSTYRVRFVPTEMGSHTVNVKYRGEHVPGSPFQFTVGPL-GEGGFHKVRAGGTGLERAVAKVPAEFSIWTREAGAGGLSIAVEGPSKAEINFEDRKDGSCGVSYVVQEPGDYEVSIKF-NNEHIPDSPFIVPV--------------------------------ATLSDDARRLTVTSLQEKDLKVNQEASFAVQRNGA-RGVIDAKVHAPSGVVEECYVTELDSDKNAIRFIPRENGVHSIDVKFNGSHIPGSPFKVRV 2472          

HSP 13 Score: 110.538 bits (275), Expect = 1.742e-23
Identity = 88/273 (32.23%), Postives = 126/273 (46.15%), Query Frame = 2
Query: 4880 PSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSV-NSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVH 5692
            PSG    A +   GDG Y V+++  E G HL+ V  ++  +  SPF++ V     DP  V A G GL   IV+K   F V T  AG+  L + I+G S+  M C + +DG     Y+    G+Y INI YGG   I GSPF                                 +   K   +V K+ C G GL       V  +F VD S+AG   L V + GP    E VVVK+  +   TV+Y   + G H + V++ ++++P SP+ V+
Sbjct: 1303 PSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVE-GCDPTRVRAYGPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQ-PIPGSPF---------------------------------RVQVKDVVDVSKVKCSGPGLANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVN 1540          

HSP 14 Score: 110.538 bits (275), Expect = 2.096e-23
Identity = 88/283 (31.10%), Postives = 131/283 (46.29%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQIGDGQYG-VKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            K+  S+ +PSG   P  ++     +   VK+ P E G + V +  +  P+  SPF +  G   ADP  V A G GL   IV + AKF ++T  AG+G L + ++GP +  + C +  DG     Y+ T  G+Y INI Y G  HI GSPF AVV                                 K + +  K+   G GL++A+   V SF VD S+AG   L + I        EV +++  +  F+V Y     G H I +++G + +P SP  V V+
Sbjct: 1005 KVNVSITSPSGRPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVE-GLMPADPSKVRAYGPGLKGGIVGQPAKFSIDTKGAGAGGLGLTLEGPCEAKIECQDNGDGTCSVVYLPTEAGDYNINILY-GEAHIPGSPFKAVV---------------------------------KPALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVE 1252          

HSP 15 Score: 102.064 bits (253), Expect = 7.004e-21
Identity = 139/548 (25.36%), Postives = 216/548 (39.42%), Query Frame = 3
Query:    9 ETKPTKTP--DLYEVTYRPQECPNSKALHP-KVTVGGEDIPGSPFTIPFTKKDEDSKYI--------GTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAP------DGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVV----------------QESPLITEEPILSEQIKTLKA--GNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQP------------SSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPV 1508
            E KP K    D  + TY     P+    +   +  GG++IP SP+ +      + SK +        G  E L PN+++ +     V      K +   TV   NG+ ++ + V +    T+   YT  + G+++IT    G+ + K+P  V   D+            +AP  +     T  +  P  ++ P  V    L+ E ++ P  K A P      DGT  V F P E G H +        I  +P           +  +               G VNKP SFT+V  N         + V  P   + I  K  K        ++P   G Y+++   DN+ I GSP T  +                 +  L   E  LS    ++KA  G     + K  P +    +  L    KE+ E  V   K  +   + P            +S+V  +GKGL +    E A F +D+++A    +G+++EGP +  I+C D  DGTC V Y    PG Y IN+ + + HIP SP  V V
Sbjct: 1590 EGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVAESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELD-MDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATDQP-----------VAPRDD-----TKPMFQPLNLVIPFTVQQGELSGEVRM-PSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPL--------QFYVDVTNSGMVTAYGPGLCHGTVNKPASFTVVTKNAGQG--GLSLAVEGPSKAE-ISCKDNK-DGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKITGDDSLRRSQLNVGTAADVSLKITETDLSYLTASIKAPSGKEEPCLLKRLPNR----HIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINCDDVEDGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKV 2103          

HSP 16 Score: 91.2781 bits (225), Expect = 1.344e-17
Identity = 80/281 (28.47%), Postives = 121/281 (43.06%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            +L+ SV+ P G   P  V  +GDG +   + P + G + V +    +PI  SPF + V   +A    V A G GL   +V K A F V       G+L  +I+GPS+  + C +  DG  +  Y  T PG+Y +++    +  I  SPF A +    +A +V                     + EK      K    GL      +N    F VDA +AG G L +          ++ +   G+  F   YV  +   H I++ WG+ +IP SPF V V
Sbjct:  515 ELKVSVKGPGGVEVPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEVSK-EAGTQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVIC-DDEDIKDSPFMAHIL--PAANDV---------------------FPEKV-----KAFGPGLEPTGVTVNKSTQFTVDAREAGKGGLKIYAQDAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRVLV 765          

HSP 17 Score: 82.4185 bits (202), Expect = 6.706e-15
Identity = 74/269 (27.51%), Postives = 110/269 (40.89%), Query Frame = 2
Query: 4904 IVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKK--AKFFVNTSNAGSGSLNVAIDGPSKVNMN---CHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            I++  GD  +   + P   G H + V    +PI  SPF++ +    ++     A+G GL    V  K  A F V T  AG+G L V++ GP  V +    C   +  ++  Y    PG Y +NIT+GG   I  SPF                      E+E S +           +  +K+   G GLK   +     F V+A     G L   I GP +   ++     G+    V Y   E G + + V   D+DI  SPFM H+
Sbjct:  434 ILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISE-ASNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKGPGGVEVPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQ-PIPRSPF----------------------EVEVSKE-----------AGTQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGTLGFSIEGPSQ--AKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHI 665          

HSP 18 Score: 82.0333 bits (201), Expect = 8.702e-15
Identity = 79/284 (27.82%), Postives = 117/284 (41.20%), Query Frame = 2
Query: 4871 VQTPSGNMEPAIVQQIGDGQ--YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHA--IVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNC-----HETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            V+ P G+ E A V    D +  + V + P+  G H V V    + I+ SPF + V     DP  V A G GL     +  K   F + T+ AG+G ++V I  P   N        ++ ++ +  TY     G + I++T+ G   I  SPF   +                               +E S++N  +   +GL  K  R+  V  F V    AG G L V + GP      V V  VG+  F  DY   + G + + + WG + IP SPF V V
Sbjct:  321 VEDPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVLFAGQDIDKSPFMVNVAKALGDPNKVQARGPGLEPEGNVAHKPTYFDIYTAGAGAGDVSVVIVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQ-PIPSSPFKVNI-------------------------------SEASNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKGPGGVEVPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEV 572          

HSP 19 Score: 82.0333 bits (201), Expect = 9.308e-15
Identity = 76/295 (25.76%), Postives = 121/295 (41.02%), Query Frame = 2
Query: 4820 SITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKK--AKFFVNTSNAGSGSLNVAIDGP--SKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMV 5689
            + TV      +  LE  +  P G +EP +V+   DG + V ++P + G H V V+   + +  SP+++       D   V ASG GL    V      +F ++  +AG G L V I  P       + H+  DG Y  +YV    G Y I I YGG+ +I  SP+                    Q        +C+   +          + + LG    +++      VDA  AG G +   +  P     ++ V    +  F + Y   E G ++I +R+G + IP SPF V
Sbjct: 1472 TFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAP-SHDASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGD-NIPYSPYNV------------------QAFPTGDASKCLLTVSIGGHG-----VAESLG-PNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQV 1740          

HSP 20 Score: 76.2554 bits (186), Expect = 5.045e-13
Identity = 84/274 (30.66%), Postives = 114/274 (41.61%), Query Frame = 2
Query: 4919 GDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKAD--PGMVHASGEGL--SHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG---YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVV-EGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIA---GPVRPCEEVV---VKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            GDG   V++ P E G + V V  + + I  SPF   +     D  P  V A G GL  +   V+K  +F V+   AG G L +         ++   T+ G   +   YV T P  + I IT+G   +I  SPF  +V EG                        C     +     VEK      GLK    N    F VD S+AG G + +GI    G V P E  +   +    N+ FTV Y     G + IMV + D++IP SPF V VD
Sbjct:  629 GDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAREAGKGGLKIYAQDAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIIITWG-EVNIPKSPFRVLVGEG------------------------CHPDKVKVYGPGVEKT-----GLKA---NEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGPGRYTIMVVFADQEIPSSPFKVKVD 869          

HSP 21 Score: 67.0106 bits (162), Expect = 2.757e-10
Identity = 77/261 (29.50%), Postives = 115/261 (44.06%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAI-VDKKAKFFVNTSNAG-SGSLNVAIDGPSKVNMNCH----ETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCE-EVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPF 5683
            D  Y VK++    G   + V +   PI  SPF+I V     D G V    +GL+  + V K  +F VNT  AG  G +NV+I  PS   + C     +T++     Y+    G+Y ++ITY GN  +  SPF+  VEG   A                               +  K+   G GLK   +     F +D   AG G L + + GP   CE ++  +  G+   +V Y+  E+G + I + +G+  IPGSPF
Sbjct:  932 DYSYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAP-SLDLGKVKV--QGLNEKVEVGKDQEFIVNTKGAGGQGKVNVSITSPSGRPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGN-PVPESPFS--VEGLMPA-------------------------------DPSKVRAYGPGLKGGIVGQPAKFSIDTKGAGAGGLGLTLEGP---CEAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPF 1152          

HSP 22 Score: 60.8474 bits (146), Expect = 2.215e-8
Identity = 73/313 (23.32%), Postives = 118/313 (37.70%), Query Frame = 2
Query: 4793 HREDAGGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGL----------SHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG---YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVH 5692
             R  AG + S TV        +L   + + SG      +Q   DG + V ++P   G H + ++   + +  SP  + V     D   +   G G+          +H IVD +A    +    G   + + I  PS  N + + T+ G   Y   Y A   G ++I + Y     +  SPF   V                   +E  D   V  Y              G GL+   +N  N F V+   AG   L + I G      +++ K   +   +V+Y+   +G + I + +G + IPGSPF V 
Sbjct: 1173 ERAKAGEVASFTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKV-EPSVDTSGIKVYGPGVEPKGVLREVTTHFIVDARA----HAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYD-EVAVPKSPFKVSV-------------------VEGCDPTRVRAY--------------GPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASE--AKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQ 1444          

HSP 23 Score: 59.6918 bits (143), Expect = 4.601e-8
Identity = 75/357 (21.01%), Postives = 129/357 (36.13%), Query Frame = 2
Query: 4817 ISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRI---PVGHYKADPGMVHASGEGLSHAI-----VDKKAKFFVNTSNAGSGSLNVAIDGPS--KVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSAT-----------------NVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLN--------SVNSFFVDASQAGY----------------------------GILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            +  T+ A D     L   +  P G  + A +    DG Y V + P   G + + ++     I  SP+ +   P G        V   G G++ ++     + ++    V+   AG G +   +  P+  +++M+  E  DG ++  Y A  PG Y+I I +GG  HI  SPF  +      A                   V Q E   +V + +           K  +   +      GL +  +         S   F+VD + +G                             G L + + GP +   E+  K   +   TV Y+    G + I+V++ +  IPGSPF   +
Sbjct: 1568 VEFTIDARDAGKGLLTVQILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVAESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQ-HIPKSPFQVMATDQPVAPRDDTKPMFQPLNLVIPFTVQQGELSGEVRMPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPGLCHGTVNKPASFTVVTKNAGQGGLSLAVEGPSK--AEISCKDNKDGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKI 1921          
BLAST of Filamin-A vs. Ensembl Xenopus
Match: coq2 (coenzyme Q2 4-hydroxybenzoate polyprenyltransferase [Source:Xenbase;Acc:XB-GENE-967037])

HSP 1 Score: 820.846 bits (2119), Expect = 0.000e+0
Identity = 578/1635 (35.35%), Postives = 846/1635 (51.74%), Query Frame = 3
Query:   96 VTVGGEDIPGSPFTIPFTKKDEDSK---YIGTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGV--PVEPVL---VKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLA---PMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPD---------GTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIH----EAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLL--CEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPILSEQIKTLKAGNP-------------------HNPM------QKANPGKSNKPYTALEEAIKEMK----ESAVESSKWPQS-KPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTV--EGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPI--KDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAG---------KDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTAT--------YSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGE-PVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAARA 4766
            +T GG +IP SP+ +   +    +K   Y   +E  K  +K  +P  F V  ++  + +  + +    GV  P E  +   + K   +T+   YTP   G++ I      + +  +P  V V  +   +  K++ EG       +EV  P  F V +  K      +DVQ          I  EA  D            V +   + G  ++       PI ++P  V   P  D+     + +N K              V K   F+I            DV + SP + +PIP K +      +   +++P + GPY +  S D +P+ GSP ++     P  ++       +K    G P                     P       Q    G  +  Y   E     +     ES +  S +    +P    SKV   G GLEK  A E A FT+D   A  A + + +  +   +A +   +N DGT  + Y    PG YTI + Y    +P+ P+ V V P     +D S V   GPG+ P GV ++   +FTVDA  +++ G   V   +  PSG  T   + +  +G Y V+YT  E+G H I V Y+ +P+  SPF V    G +   V A GPGL    +N+  +F V+  GAG G LGLAIEGP++A++ C DNKDG+C VEY P   GDYD+++ F    I  SPF V V + V P KVK  GP      +   P  FT+DCS+AG APLEV V  P SG+++ PV I+       GT  V Y P   GP  + V+Y    +  SPFK  V+      KV+  G G+      I AS+P  F ++ +DAG    + V + +P G+P   +I    +G YT  Y     G + I++   G  +P SP+ + ++PTG+  KC +               +IQ+ +E+VIT++ K AGKG++TC V   +  +            + V V E+ DG   ++Y   E G+Y++ +++GG+ IPN  F    +         SF  ++ T    V  +  + +       + F +   +     +  +V  PSG      IT  DN    + + + P E+G H++ +   G  I GSP QF+VD      V+A+GPGLS G  N+ A FTI+TKDAG GGLSL VEGPSK EI C+DN DGT  VSY+P APG+YNII++F D+ I GSPFT+ ITG+  ++ SQ+ VG S+++ LKI  SDLS LTA +  PS  + PC++K++ N  +G+SFTPKE GEH+V+V + G  +  SPFK+ V   E+GDA+KVKVSGKGL +G+  +  EF +DTR+AGYG L +SIEGPSK +I+C+D E+G C V Y PTEPG Y+IN+ +A K+VPGSPF V V G+  +    + + R ++A     +G  C++NLKI E   +++   V +PSG T   +I D  +    ++FV +E G H VSV ++ +H+ GSPFQFTVG +  GG+  V A GPGLE+G   +  EF+I+TREAGAG +S+A+EGPSKAE+ F++ +D GSC V+Y V + GDYE SIKFN EHI +SPF        + PVA+R+
Sbjct:  723 ITWGGVNIPNSPYRVSVGEGSHPNKVKVYGPGVE--KTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGKYTIMVLFADQEIPTSPFRVKV--DPSHDASKVRAEGPGLNRTGVEVGKPTHFTVYT--KGAGKAKLDVQFAGS------IKGEAVQDFEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNVAPPLDLSKVKVQGLNNKV------------DVGKDQEFSIDTSGAGGQ-GKVDVKITSP-SRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDSSKVRAYGPGLKGGFVGKPAPFAIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIRPVFDPSKVTASGPGLEKGKAGEVATFTVDCSKAGDAELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNVEPA----VDTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVTEGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKEIVDPSKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLAPLEVLVQGP-SGLAE-PVDIRD---NGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKVLPTHDASKVRASGPGL--NTAGIPASLPVEFTIDARDAGEGL-LTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVPTGDASKCLVTVSIGGHGLGTCLGPSIQIGEETVITVDAKAAGKGKVTCKVSTPDGAE------------LDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVVSKQEVMKIFLSFHPIQATEEPVVPVENLDTMLRPFNLVIPFTVQKGE-----ITGEVRMPSGKTARPNIT--DNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDASKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVSYCPTEPGTYIINIKFAEKHVPGSPFMVKVTGEGRM---KESITRRRQAPSIASIGSTCDLNLKIPEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFEDRKD-GSCGVSYIVQEAGDYEVSIKFNDEHIPDSPF--------VVPVASRS 2288          

HSP 2 Score: 243.432 bits (620), Expect = 0.000e+0
Identity = 128/286 (44.76%), Postives = 182/286 (63.64%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK--ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVS-----QYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++A V TPSG +E   V ++   +Y ++F PRE G H + V+ N + I GSPF+I VG      DPG+V A G GL   +  + ++F V+T NAG+GSL+V IDGPSKV ++C ++ +GY+ +Y   APGNY+I+I YGG  HIVGSPF A V G + +   +  E  S V +E   K   S       A K SS+  K++ +G GL +A +   N+F VD S+AG  +L+VG+ GP  PCEEV VKH+GN  + V Y VK+ G +I++V+WGD+++PGSPF V V
Sbjct: 2323 IDAKVHTPSGMVEECYVSEVDSDKYSIRFIPRENGVHSIDVKFNGRHIPGSPFKIRVGEQSQAGDPGLVTAYGLGLEGGVTGRPSEFIVSTLNAGAGSLSVTIDGPSKVKLDCQDSPEGYKVSYTPMAPGNYLISIKYGGPQHIVGSPFKARVTGVRLSGGHSLHET-STVLVETVTKSSASVGGYAMTAPKFSSDASKVVSRGPGLSKAFVGQKNTFTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHMGNRLYNVTYTVKDKGDYILIVKWGDQNVPGSPFQVAV 2607          

HSP 3 Score: 519.62 bits (1337), Expect = 2.434e-150
Identity = 494/1640 (30.12%), Postives = 747/1640 (45.55%), Query Frame = 3
Query:   84 LHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLND-GIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIE---VCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQES----------PLITEEPILSE-------QIKTL-KAGNPHNPMQKANP--------------GKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQPS------SKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKV--NEKTQFVVDLDGAGHGSLGLAI---EG-PADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXX---XXXXXXXXXSKGPIKDAKLLRPNH-------FTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNP-DVIVGLFNPNGE-----PMPLHIEARPN------GLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQV----------AVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVN---------VHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKD-VTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNG-EHIVNSPF 4718
            L   VT GG+ IP SPF +      + SK    ++ L   V + + Q F +  +  G + +  V ++  +  P+   +   V+ + +   Y P + G + +  S DG PV  +P  V  V  +P +  K++  G  P ++   V  P  F + +  K      + + V  P    I        DG+  V+++P E G +SI     +  I  +P       KADI    +     A+    EK G+  +  +FT+      D   +  + +LS    +   +            +IP   G Y++      + +   P  + V+ +          P +    +L E         ++L K G  H   +   P              G  +  YTA E+ +  + E   +    P+S    P       S+V  YG GLE     +   FT++++ A +  +G+ +EGP EA + C DN DG+C V Y    PG Y +N+ +    IP SP  VPV     + +D S V  SGPGL   GV       FTVD S+    G   ++ LVQ PSG      I +  +G + V YTP  +GP+ ++V Y    +  SPF +K  P  +A  V ASGPGL++  +  +   +F +D   AG G L + I   EG P  A I+   N DGT  V Y P  AG Y I++K+  ++I  SPF +  V   D  K     S G       L P+         T+D   AGK  +  KVS P     D  V   Q      GTFD+ Y   E G  +I +++    I  SPF   VV   +V K       I      I A+   V  V   D  + P ++++      GE      MP    ARPN      G  T ++   + G H++ +  DG  +P SP         +    A   G    + VNK +  TI TK+AG+G ++  V+   + ++                +++ DG  +V YMP   G+Y + V++  + IP   F    T       ++M  S       +L       V+ +I   D     L A +  PSG  E   +    N   +I I + P E G H + V   G+ +  SPF+  V     G   +V   G GL  G T EVAEF + T++AG GGL L +EGPSK +I CED  DGT KVSY P  PG Y I IKF ++ + GSPF   +TGE   K  +          ++G++ ++ LKIP +    +TA++T+PS       I    +    V F P+E G H V+V  +G  +PGSPF+  V     G A KV+  G GLE+G+A    EF+I TR+AG G L+I++EGPSKAEI  +D ++G C V Y+  E G+Y +++ +  +++P SPF        VVP  ++  +  +  V + Q     E  + +++ A   +++N         VHTPSG  E C + +  +    I+F+ RE+G+H + V    RHI GSPF+  VG  +  G    VTA G GLE G     +EF + T  AGAG++SV ++GPSK ++  Q+S +     V+Y    PG+Y  SIK+ G +HIV SPF
Sbjct:  921 LTVSVTYGGDPIPKSPFNVNVAPPLDLSKV--KVQGLNNKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAV--MPPDSSKVRAYG--PGLKGGFVGKPAPFAIDT--KGAGTGGLGLTVEGPCEAKIECQDNG--DGSCSVSYLPTEPGEYSINILFAESHIPGSPF------KADIRPVFDPSKVTASGPGLEK-GKAGEVATFTVDCSKAGD--AELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNVEPAVDTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGV-HLIEVLYDDVPVPKSPFRVPVTEGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPV----KEIVDPSKVKCSGPGLG-SGVRAHVPQTFTVDCSKA---GLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKVLPTHDASKVRASGPGLNTAGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIR--GNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVPTGDASKCLVTVSIGGHGLGTCLGPSIQIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVDVVENQ-----DGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHV-VVSKQEVMK-------IFLSFHPIQATEEPVVPVENLDTMLRPFNLVIPFTVQKGEITGEVRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGM-VNKPATFTIVTKDAGEGGLSLAVEGPSKAEI--------------TCKDNKDGTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKITGD-----DSMRTS-------QLNVGTSTDVSLKITESD--LSLLTASIRAPSGNEEPCLLKRLPN--RHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDASKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVSYCPTEPGTYIINIKFAEKHVPGSPFMVKVTGEGRMKESITRRRQAPSIASIGSTCDLNLKIPEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFEDRKDGSCGVSYIVQEAGDYEVSIKFNDEHIPDSPF--------VVPVASRSDDARRLTVTSLQ-----ETGIIVNQPASFAVQLNGARGVIDAKVHTPSGMVEECYVSEVDSDKYSIRFIPRENGVHSIDVKFNGRHIPGSPFKIRVGEQSQAGDPGLVTAYGLGLEGGVTGRPSEFIVSTLNAGAGSLSVTIDGPSKVKLDCQDSPE--GYKVSYTPMAPGNYLISIKYGGPQHIVGSPF 2471          

HSP 4 Score: 398.667 bits (1023), Expect = 8.163e-140
Identity = 363/1229 (29.54%), Postives = 565/1229 (45.97%), Query Frame = 3
Query: 1224 QSKPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIE------GPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP---IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIE-ARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTR-SVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF----FVDTKGEGRVTAFGPGLS-SGTTNEV-AEFTI----ITKDAGPGGLSLIVEGPSK--TEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQV----------AVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGL-ANQGNEFTIDTRDAGYGSLNISIEGPSKAE--IDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPC-ETQKMERVQEAVKATQVGGNCEINLKIDEMALKD--LKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQF----------TVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQ--ESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSI 4745
            Q  P+    KV  +G GLE     + A F +++       +G ++EGP +A I+C D GDG+C V Y    PG Y ++V+ D+  I  SP +  + P  NK      V A G GL P G   +  A+FT+DA      G   +K   Q   G   +  I +  +  YV  Y PT+   H I +T+ G+ I +SP+ V    G +   V   GPG+     K NE T F VD   AG G + + I+      GPA+A+I      N + T  V+YTP  AG Y I V F D++I  SPF V+V       KV+++GP       ++ +P HFT+    AGKA L+V+ +     I    V   ++      ++ V Y   + G   + V Y   PI  SPF  NV  P  + KVKV G      N  +       F ++T  AG    V V + +P+  P+P  +E    + ++T +Y   + G +K+ +  DG P+P SP++V+++   +  K        K   V K +   I+TK AG G +  TV+       G  E        K++ Q++ DG  SV Y+P E GEY + + +    IP   F       F   + T +   ++   + E+A+       F ++       +L  +++  SG   EV I +N +  ++I   Y P+  G + + +   G  +   P +      VDT G   V  FGPG+   G   EV  EFT+    +TK  G    + I+ GPS   TE    DN DGT+ V Y     G + I + + D P+  SPF   +T E    S+V           +  S+   ++   +    L   +  PS+ K+ C  K   +G+  V + P   G++ VN+   G  IPGSPF+V VK  E+ D +KVK SG GL  G+ A+    FT+D   AG   L + ++GPS     +D +DN +G  TV Y P   G Y ++V YA + VP SPF +     KV+P  +  K+      +    +  +  +   ID     +  L V +  P G  +  +I   G+G   + +V   +G + +++ +    I  SPF+            + +V+ GG    T  GP ++ G   +     +  + AG G ++  +  P  AE+     E+QD G+  + Y   +PG Y  +I+F GEHI NSPFH++V    +
Sbjct:  545 QVSPEVGLQKVRAWGPGLETGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIKDSPFIAHILPASNKGFP-EKVKAYGQGLEPTGCIVEHPAEFTIDARAA---GTAELKIYAQDAEGSPIDIKIKDNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSVGEGSHPNKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGKYTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNRTGVEVGKPTHFTVYTKGAGKAKLDVQFA---GSIKGEAVQDFEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNVAPPLDLSKVKVQG-----LNNKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDSSKVRAYGPGLKGGFVGKPAPFAIDTKGAGTGGLGLTVE-------GPCEA-------KIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIRPVFDPSKVTASGPGLEKGKAGEVAT-------FTVDCSKAGDAELTIEILSDSGSKAEVLIQNNSDGTYSIT--YIPACPGAYTITIKYGGHAVPKFPVRVNVEPAVDTSG---VKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRIL-GPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVT-EGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSC--KDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVK--EIVDPSKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKI-----KVLPTHDASKVRASGPGLNTAGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVPTGDASKCLVTVSIGGHGLGTCLGPSIQIGEETV---ITVDAKAAGKGKVTCKVSTPDGAELDVDVVENQD-GTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVVSKQEV 1720          

HSP 5 Score: 122.094 bits (305), Expect = 8.163e-140
Identity = 102/350 (29.14%), Postives = 156/350 (44.57%), Query Frame = 2
Query: 4817 ISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKS----------ATNVNQEEQHSQVEIEASDKRCVSQYAE--------------------------------KSSSN--------------VEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            + I    + GEI      V+ PSG      +    DG   VKF+P E G H + ++ +   I GSP +  V    +    V A G GLSH +V+K A F + T +AG G L++A++GPSK  + C + +DG    +Y+ TAPG+Y I + +  + HI GSPFT+ + G+ S          +T+V+ +   S + +  +  R  S   E                                K  +N                K+   G GL +     V  F VD   AGYG L + I GP +   ++  + + +    V Y   E GT+II +++ +K +PGSPFMV V
Sbjct: 1752 LVIPFTVQKGEI---TGEVRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDAINSR--HVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYMPTAPGDYNIIVRF-DDKHIPGSPFTSKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDASKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSK--VDINCEDMEDGTCKVSYCPTEPGTYIINIKFAEKHVPGSPFMVKV 2093          

HSP 6 Score: 349.362 bits (895), Expect = 3.911e-109
Identity = 351/1219 (28.79%), Postives = 546/1219 (44.79%), Query Frame = 3
Query: 1245 SSKVIVYGKGLEKVA--AKEKAIFTIDSKDAPSAPIGVTVEGPG------EAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTV--DASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLL------------RPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGL------FNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKA-GKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDG-----VPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF-FVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI-----------TGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLE-KGLANQ-GNEFTIDTRD---AGYGSLNISIEGPSKA--EIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNV-EGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGF-IDINNEFAIYTREAGAGNISVAMEGPSK-AEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            ++KV   G GLE V   A +   F I +  A S  +GV +  P       E +++  D GD      Y   + G + + + +    IP+ P VV +    N N       A+G GL P+GV     A F V    +EV +N +  +K  V+   G +    I +  +G Y   Y P   G + + +T+ G  I  SPF V+  P    Q V A GPGL +  V +   FVV+  G   G+LG +IEGP+ A+I+C D  DG+C V Y P + G+Y + V  +DEDI DSPF              +KG  +  K               P  FTID   AG A L++            P+ IK ++     T+   YVP +     I + +    I  SP++ +V + +   KVKV G G+  +   + A+ P  F V+  +AG   DV +G+        P    +   I    N  +T +Y     G + I V      +P SP+ VK  P+ +  K   +  G ++T ++V K +  T+ TK AGK        K++ Q  G ++   V D    ++ ++ D   +V Y   ++G   V V YGG  IP   F         ++ +   + + N++      +      F I+T        V V + +   RP  C  E  +TS+    H +K  Y P E GP+++ ++  G P+ GSPF    V      +V A+GPGL  G   + A F I TK AG GGL L VEGP + +I+C+DN DG+  VSY+P  PG Y+I I F +  I GSPF A+I           +G  ++K +   G  +   +    +  + LT E+ + S  K   +I+  ++G   +++ P   G + + +   G  +P  P +VNV  E   D + VKV G G+E +G+  +   EFT+D R     G   +   I GPS A  E    DN +G   V+Y   E G ++I V Y    VP SPF V V EG     C+  ++      ++   +  +    ++        L + +  PS     C  +D  +G+  ++++    G + V++    R I GSPF+  V  +       V  SGPGL  G    +   F +   +AG   + V ++GPS  AE         G+  V Y  +  G Y  S+++  + +  SPF I V
Sbjct:  355 ANKVTARGPGLEPVGNVANKPTYFDIYTAGAGSGDVGVIIVDPQNHQDTVEVILE--DKGDNIYRCTYRPNMEGPHKVFITFAGSQIPKCPYVVNISEACNPN----ACRATGRGLQPKGVRVKEVADFKVFTKGAEV-ENLKSLLKGQVK---GTEEPVKIRDAGDGVYECDYYPVLPGKYTVTITWGGYAIPRSPFEVQVSPEVGLQKVRAWGPGLETGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIKDSPF------IAHILPASNKGFPEKVKAYGQGLEPTGCIVEHPAEFTIDARAAGTAELKIYAQD----AEGSPIDIK-IKDNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSVGEGSHPNKVKVYGPGV--EKTGLKANEPTYFTVDCSEAG-QGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGKYTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNRTGVEVGKPTHFTVYTKGAGKA-------KLDVQFAGSIKGEAVQD---FEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNVAPPL-DLSKVKVQGLNNKV------DVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGVTSD---IHTVK--YMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDSSKVRAYGPGLKGGFVGKPAPFAIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIRPVFDPSKVTASGPGLEKGK--AGEVATFTVDCSKAGDAELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNV--EPAVDTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVTEG-----CDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSC--KDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKEIV--DPSKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKV 1514          

HSP 7 Score: 69.3218 bits (168), Expect = 3.911e-109
Identity = 75/309 (24.27%), Postives = 124/309 (40.13%), Query Frame = 2
Query: 4817 ISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRI---PVGHYKADPGMVHASGEGLSHAI-----VDKKAKFFVNTSNAGSGSLNVAIDGP--SKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVR-PCEEVVVKHVGNNQ---FTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            +  T+ A D     L   +  P G  + A ++  GDG Y V + P   G + + ++     I  SPFRI   P G        V   G GL   +     + ++    V+   AG G +   +  P  ++++++  E +DG ++  Y A  PG Y+I I +GG  HI  SPF  VV               S+ E+     +    +    ++    +  + L       N V  F V   +         I G VR P  +    ++ +N+    TV +   E G H + +++    IPGSP   +VD
Sbjct: 1541 VEFTIDARDAGEGLLTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVPTGDASKCLVTVSIGGHGLGTCLGPSIQIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGE-HIPNSPFHVVV---------------SKQEV----MKIFLSFHPIQATEEPVVPVENLDTMLRPFNLVIPFTVQKGE---------ITGEVRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVD 1820          

HSP 8 Score: 319.701 bits (818), Expect = 4.426e-105
Identity = 339/1217 (27.86%), Postives = 531/1217 (43.63%), Query Frame = 3
Query: 1251 KVIVYGKGLEKVA--AKEKAIFTIDSKDAPSAPIGVTVEGPG----EAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQ--TNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAE---IQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQV---EKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNG--LYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKA-GKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRP--SGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLS------SGTTNEV-----AEFTIITKDA-GPGGLSLIVEGPSKTEIKCEDNHDGT---FKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVA---------VGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISI--EGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMAL-----KDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGS-KDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVED 4736
            K   YG G+E       + A FT+++ +A    + V VE P     EA +   ++ + T  V Y   V GL+ + VL+   +I +SP  V V        D + VTA GPGL P G   +    F +     +  G G V  ++  P   Q     ++++  +  Y   Y P  EGPHK+ +T+ G  I   P++V      N     A+G GL     +V E   F V   GA   +L   ++G        ++  D  DG    +Y PV  G Y +++ +    I  SPF V+V  EV  +KV++ GP ++   + +   F ++        +  +V   G  I        + +    G+ DV Y P E G   + V  +   I  SPF  +++  +     EKVK  G G+ P     +   PA F ++ + AG      + ++  + E  P+ I+ + NG   Y C Y       H I +   G  +P SPY V      +P K  +   G +KT ++ N+ +  T++  EAG+G ++  + K     VG  E     D IK     + +   +V Y P   G+Y + V +  Q IP   F      S    +        N+   E+        +F + TK      L+ +         +++  I  N +Y + +K  Y   ++G   + V   G PI  SPF   V            P L        G  N+V      EF+I T  A G G + + +  PS+  I C+     T     V Y+P   G Y + I +   P+ GSPF+      P      A         VG  +   +    +    L   +  P + K+ C  +   +G+  VS+ P E GE+ +N+    + IPGSPFK +++   V D +KV  SG GLEKG A +   FT+D   AG   L I I  +  SKAE+  ++N +G  ++ Y+P  PG Y I + Y G  VP  P  VNVE       +T  ++     V+   V         +D  +L       +   +  PSG      + D G+G   +++ A E G+H + VL+ D  +  SPF+     VT G     V A GPGLE G ++ +N F + TR AG G + +A+EGPS+A+M  ++++D GSC+V Y    PGDY+ +I F G  I  SPF + V++
Sbjct:  257 KANAYGPGIEPHGNMVLKPAYFTVETINAGLGEVLVFVEDPEGHTEEAKVIPNNDKNRTYSVSYVPKVAGLHKVTVLFAGQNINKSPFNVNVAMALG---DANKVTARGPGLEPVGNVANKPTYFDI---YTAGAGSGDVGVIIVDPQNHQDTVEVILEDKGDNIYRCTYRPNMEGPHKVFITFAGSQIPKCPYVVNISEACNPNACRATGRGLQPKGVRVKEVADFKVFTKGAEVENLKSLLKGQVKGTEEPVKIRDAGDGVYECDYYPVLPGKYTVTITWGGYAIPRSPFEVQVSPEVGLQKVRAWGPGLETGMVGKSADFVVEA-------IGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIKDSPFIAHILPASNKGFPEKVKAYGQGLEPT--GCIVEHPAEFTIDARAAGTAE---LKIYAQDAEGSPIDIKIKDNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSVGEGSHPNKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGI-KCAPGVVGPAEADIDFDIIK-----NDNDTFTVKYTPPGAGKYTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNRTGVEVGKPT----HFTVYTKGAGKAKLDVQFAGSIKGEAVQDFEIIDNHDYSYTVK--YTAVQQGTLTVSVTYGGDPIPKSPFNVNV-----------APPLDLSKVKVQGLNNKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDSSKVRAYGPGLKGGFVGKPAPFAIDTKGAGTGGLGLTVEGPCEAKIEC--QDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIR--PVFDPSKVTASGPGLEKGKAGEVATFTVDCSKAGDAELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNVE----PAVDTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRV---PVTEGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKD-GSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKE 1420          

HSP 9 Score: 85.5001 bits (210), Expect = 4.426e-105
Identity = 89/302 (29.47%), Postives = 125/302 (41.39%), Query Frame = 2
Query: 4820 SITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKK--AKFFVNTSNAGSGSLNVAIDGP--SKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFT--AVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGL---KQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            + TV      +  LE  VQ PSG  EP  ++  GDG + V ++P   G + V V    + +  SPF+I V     D   V ASG GL+ A +      +F ++  +AG G L V I  P       N     DG Y  +YV    G Y I I YGG+  I  SPF   AV  G+ S                    +C+   +         I   GLG       ++       VDA  AG G +   ++ P     +V V    +  F + Y   E G ++I +R+G + IP SPF V V
Sbjct: 1445 TFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKV-LPTHDASKVRASGPGLNTAGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKYGGD-EIPYSPFRIHAVPTGDAS--------------------KCLVTVS---------IGGHGLGTCLGPSIQIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVV 1715          

HSP 10 Score: 363.614 bits (932), Expect = 1.125e-100
Identity = 407/1579 (25.78%), Postives = 653/1579 (41.36%), Query Frame = 3
Query:   45 VTYRPQECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAP---MIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLC--EFIPKKAGPYSLVASVDNNPIKGSPQTIVVQE----SPLITEEPILSEQIKT----------LKAGNP------HNPMQKANP----------------GKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQPSSKVIVYGKGLEK--VAAKEKAIFTIDSKDAPSAPIGVTV---EG-PGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAI-----EGPADAEIQC----------HDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPT--GNPEKCAIKAGKDKTIQVNKE-SVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSE--IPLKIPSSDLSTLT-------AELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNV-KNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAG-KNVPGSPFNVNVEGDKV---------------------------------VPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV 4442
            V+Y P E P   +++  +      IPGSPF        + SK   +   L+   K  +  TF V  +    +E  + +   +G   E VL++  S  TY  TY P   G + IT    G  V K PV V+V   +  +  K+   G+ P   + EV    T    S  K      V  ++L P   +         DGT  V +   E+G H I     D P+ ++P  V      D      +   P       + G +NK   FT+  +          + +  P   +     S K  K   C  E+IP   G Y +  +    PI GSP  + V+E    S +    P L   ++            KAG          P   A P                  ++ PYT    +++   +    S    +  P   +SKV   G GL    + A     FTID++DA    + V +   EG P +A I    NGDGT  V Y   + G YTI + Y    IP SP  +   P  + +  L TV+  G GL           + TV   +    G+G V   V +P G + +  +    +G + + YT  E G + I + + G  I +SPF V      + Q V       H  +  E+    V+          L I     +G    E++            DNKDGT  V++ PV+ G +++ +K++   I  SP    V              +    + +P  FTI   +AG+  L + V  P    S   +T K  +    GT  V Y+P   G   I V+++   I GSPF + +     +   +++          +  S      +   D  +   +   +  P+G   P  ++  PN      +   +VG+H +SV  +G  +  SP+ +   P+  G+  K  + +GK     V  E +   ++T+ AG G +  +++   +              + +  ++  DG   V Y P E G Y++ +K+  + +P   F    T   + ++E++TR  Q      + S      +  +   +    ++ A+V  PSG   +  I   ++  ++++  + P E G H + V  +G+ + GSPFQF V   GEG   +V A GPGL  G     AEF+I T++AG GGLS+ VEGPSK EI  ED  DG+  VSY+ Q  G+Y + IKF D+ I  SPF   +        ++ V +  E  I +  P+S    L        A++ TPS +   C + ++++    + F P+E G H ++V   G  IPGSPFK+ V +  + GD   V   G GLE G+  + +EF + T +AG GSL+++I+GPSK ++DC+D+  G   V Y P  PGNY+I++ Y G +++ GSPF   V G ++                                    +  K+      +    VG      +   +     L V VH P    E   ++  GN    + +  ++ G + + V   D+++ GSPFQ  V
Sbjct: 1100 VSYLPTE-PGEYSIN--ILFAESHIPGSPFKADIRPVFDPSKVTASGPGLEKG-KAGEVATFTVDCSKAGDAELTIEILSDSGSKAE-VLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNVEPAVDTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKT-GGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVTEGCDPSRV--RAYGPGL-----EGGLLNKSNRFTV--ETRGAGTGGLGLAIEGPSEAK----MSCKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKEIVDPSKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTV---SVRYADQEVPRSPFKIKVLPTHDASKVRASGPGLNTAGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIR--GNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVPTGDASKCLVTVSIGGHGLGTCLGPSIQIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVV----SKQEVMKIFLSFHPIQATEEPVVPVENLDTMLRPFNLVIPFTVQKGEITGEVRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGP----SKAEITCKDNKD---GTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKITGDDSMRTSQLN----------VGTSTDVSLKITESDLSL---LTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDASKVKV-SGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSK--------------VDINCEDMEDGTCKVSYCPTEPGTYIINIKFAEKHVPGSPFMVKVTGEGR-MKESITRRRQAPSIASIGSTC----DLNLKIPEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVR--FVPQEMGAHTVSVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFEDRKDGSCGVSYIVQEAGDYEVSIKFNDEHIPDSPFVVPVASRSDDARRLTVTSLQETGIIVNQPASFAVQLNGARGVIDAKVHTPSGMVEECYVSEVDSDKYSIRFIPRENGVHSIDVKFNGRHIPGSPFKIRVGEQSQAGDPGLVTAYGLGLEGGVTGRPSEFIVSTLNAGAGSLSVTIDGPSKVKLDCQDSPEGY-KVSYTPMAPGNYLISIKYGGPQHIVGSPFKARVTGVRLSGGHSLHETSTVLVETVTKSSASVGGYAMTAPKFSSDASKVVSRGPGLSKAFVGQKNTFTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHMGNRLYNVTYTVKDKGDYILIVKWGDQNVPGSPFQVAV 2607          

HSP 11 Score: 301.982 bits (772), Expect = 1.288e-81
Identity = 332/1253 (26.50%), Postives = 528/1253 (42.14%), Query Frame = 3
Query: 1248 SKVIVYGKGL-EKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAV--IDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQ--LVTAS--GPGLHSC-----KVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAK-----------LLRPNHFTIDCS-EAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPN--GLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVK-----SMPTGNPEKCAIKAGKDKTIQVNKE--SVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGR----VTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCE--DNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI------------TGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNE--NGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKD-RHIRGSPFQFTVGSVTPGG-----------------------------------SKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGP-SKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            SKV   G GL   V A     FT+D   A  AP+ V V+GP      +D  DNGDGT  V Y     G YT++V Y +  +P+SP  + V P      D S V ASGPGL+  G+      +FT+DA +    G+G +   +  P GK     I    +G Y V Y P   G + I + Y G  I  SPF + A P  +A   LVT S  G GL +C     ++ E+T   VD   AG G +   +  P  AE+     +N+DGT  + YT  + G Y I+++F  E I +SPFHV V  +   +   S  PI+  +           +LRP +  I  + + G+   EV++    SG + RP     +     GT  V + P E G   +D+KY+ + I GSP +   V       V   G G+   +G  + + PA F + TKDAG       GL      P    I  + N  G  T  Y     GD+ I V  D   +P SP+T K     SM T    +  +    D ++++ +   S++T   +     +  C +K++  + +G                        + + PKE GE++V VK  G+ + N  F      S  E+ +     V  +    L    F    F ++T++     L   +  PS    +V I   D      K+ Y P+E G + + +    + + GSPF   V   GEGR    +T      S  +     +  +   +AG   ++  V  PS      E  D  D T+ V +VPQ  G + + +K++ Q + GSPF   +             G P  +  VA G  +E  +    +    L+  +  PSK ++    +   +G+ GVS+  +E G++ V++      IP SPF V V +    DA ++ V+       + NQ   F +    A  G ++  +  PS    +C  +E  +   +++++P E G + I+V + G+++PGSPF + V G++    +   +      ++    G   E  +         L V +  PS     C  +D+  G  ++ +     G + +S+ +   +HI GSPF+  V  V   G                                   +  V + GPGL K F+   N F +   +AG   + V + GP +  E  + +        VTY V   GDY   +K+  +++  SPF + V
Sbjct: 1425 SKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKVLPTH----DASKVRASGPGLNTAGIPASLPVEFTIDARDA---GEGLLTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVPTGDASKCLVTVSIGGHGLGTCLGPSIQIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVVSKQEVMKIFLSFHPIQATEEPVVPVENLDTMLRPFNLVIPFTVQKGEITGEVRMP---SGKTARP----NITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQF-YVDAINSRHVSAYGPGL--SHG--MVNKPATFTIVTKDAGEG-----GLSLAVEGPSKAEITCKDNKDGTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKITGDDSMRT---SQLNVGTSTDVSLKITESDLSLLTASIRAPSGNEEPCLLKRLPNRHIG------------------------ISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPS--EIGDASKVKVSGK--GLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPS----KVDINCEDMEDGTCKVSYCPTEPGTYIINIKFAEKHVPGSPF--MVKVTGEGRMKESITRRRQAPSIASIGSTCDLNLKIPEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVA-GVPAEFSIWTREAGAGGLSIAVEGPSKAEI--TFEDRKDGSCGVSYIVQEAGDYEVSIKFNDEHIPDSPFVVPVASRS-DDARRLTVTSLQETGIIVNQPASFAVQLNGA-RGVIDAKVHTPSGMVEECYVSEVDSDKYSIRFIPRENGVHSIDVKFNGRHIPGSPFKIRV-GEQSQAGDPGLVTAYGLGLEGGVTGRPSEFIVSTLNAGAGSLSVTIDGPSKVKLDC--QDSPEG-YKVSYTPMAPGNYLISIKYGGPQHIVGSPFKARVTGVRLSGGHSLHETSTVLVETVTKSSASVGGYAMTAPKFSSDASKVVSRGPGLSKAFVGQKNTFTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHMGNRLYNVTYTVKDKGDYILIVKWGDQNVPGSPFQVAV 2607          

HSP 12 Score: 291.197 bits (744), Expect = 2.417e-78
Identity = 320/1219 (26.25%), Postives = 527/1219 (43.23%), Query Frame = 3
Query: 1230 KPDQPSSKVIVYGKGLEKVAAKEKAI--FTIDSKDAP---SAPIGVTVEGPGEAVIDCV--DNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHS-CKVNEKTQFVVDLDGAGHGSLGLAIEGPADAE--IQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLL---RPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEK----VKVDGDGIIPQNG-AILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVK-KIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNG--KFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKC-----EDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANIT-GEPVKKSQVAVGNS----------SEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTR--DAGYGSLNISIEGPSKAEIDCK--DNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVE-----GDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGA-GNISVAMEGPS-KAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDS 4742
            +P   +S V V+G G+E      +    FT+D++       + +   + GP  AV +    DNGDGT  V Y     G++ I VLYD+V +P+SP  VPV     +  D S V A GPGL  EG   +   +FTV   E    G G +   ++ PS  + +   DN  +G   V Y P   G + +N+T+ G PI  SPF V  K   +   V  SGPGL S  + +    F VD   AG   L + ++GP+     +   DN DGT  V YTP   G Y +SV++ D+++  SPF ++V+      KV++ GP  +   +    P  FTID  +AG+  L V++  P      +P     + G   GT+ V YVP+  G   I +KY    I  SPF+ + V      K    V + G G+    G +I      V  V+ K AG    V   +  P+G  + + +    +G +   Y   + G + I++   G  +P SP+ V      + ++          IQ  +E V+ +E  +         +   +++ ++    ++    + +  + ++ DG  +V + P E+G + +++KY G  IP    +F+  A  S           + + + N+ A+       F I TKD     L+  V  PS    +  IT  DN      + Y P+  G + + V    + I GSPF   +      R +    G S+  + ++ E  +         L+  +  PS  E  C      + H G   +S+ P+  G + + +K   + +  SPF   +   E    S+V V             +E  +   ++    L   +  PSK+ + C  + M +G   VS+ P E G +++N+      +PGSPF V V  E      K  ++ +     +A+ G+   ++ +  +AG   +   +  PS    D +  D E+   +V+++P E G + ++V Y G++VPGSPF   V      G   V      +ER    V A       E ++   E     L + V  PS        ED  +G+  + ++ +E+G + VS+   D HI  SPF   V S +    +    S   L++  I +N   +   +  GA G I   +  PS   E  +    D    ++ +   + G +   +KFNG HI  SPF I V + S
Sbjct: 1226 EPAVDTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPV----TEGCDPSRVRAYGPGL--EGGLLNKSNRFTV---ETRGAGTGGLGLAIEGPSEAKMS-CKDN-KDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKEIVDPSKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKVLPTHDASKVRASGPGLNTAGIPASLPVEFTIDARDAGEGLLTVQILDP----EGKPKK-ANIRGNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVPTGDASKCLVTVSIGGHGLGTCLGPSIQIGEETVITVDAKAAGKG-KVTCKVSTPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHV----VVSKQEVMKIFLSFHPIQATEEPVVPVENLDTMLRPFNLVIPFTVQKGEITGEVRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDAINSRH--VSAYGPGLSHGMVNKPAT-------FTIVTKDAGEGGLSLAVEGPS----KAEITCKDNKDGTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKITGDDSMRTSQLNVGTSTDVSLKITESDLSL-------LTASIRAPSGNEEPCLLKRLPNRHIG---ISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDASKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSKVDINC--EDMEDGTCKVSYCPTEPGTYIINIKFAEKHVPGSPFMVKVTGE---GRMKESITRRRQAPSIASIGSTCDLNLKIPEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAGVPA-------EFSIWTREAGAGGLSIAVEGPS--KAEITFEDRKDGSCGVSYIVQEAGDYEVSIKFNDEHIPDSPFVVPVASRSDDARRLTVTS---LQETGIIVNQPASFAVQLNGARGVIDAKVHTPSGMVEECYVSEVDSDKYSIRFIPRENGVHSIDVKFNGRHIPGSPFKIRVGEQS 2383          

HSP 13 Score: 244.973 bits (624), Expect = 3.347e-64
Identity = 290/1146 (25.31%), Postives = 475/1146 (41.45%), Query Frame = 3
Query: 1503 PVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLI--DNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGF-NAQLVTASGPGLHSCK--VNEKTQFVVDLDGAGHGSLGLAIEGPAD----AEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIK-QVEG---------AAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCE--YQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGN---PEKC-AIKAGKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDG------VPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVD-TKGEGRVTAFGPGLSSGTTNEVAE---FTIITKDAGPGGLSLIVEGPSKTE----IKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVA---------VGNSSEIPLKIP-SSDLSTLTAELTTPSKIKVPCVIKK-MNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPC-ETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLE-KGFI-DINNEFAIYTR---EAGAGNISVAMEGPSKAEMK-FQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAARA 4766
            P  P  +K L      A GPG+ P G      A FTV   E    G G V   V+ P G      +  +N  N  Y V Y P   G HK+ V + G  I  SPF V       +A  VTA GPGL       N+ T F +   GAG G +G+ I  P +     E+   D  D      Y P   G + + + F    I   P+ V + +   P   ++ G     + L+P    +      K   + KV   G+ + +    +K QV+G         A  G ++  Y P   G   + + +    I  SPF+  V     ++KV+  G G+  + G +  S   V      + G     I G       P    IE    G  +C+  Y   + G++ + V  D   +  SP+    +P  N   PEK  A   G + T   V   +  TI+ + AG  ++    +  E               I +K++++ D      Y+P +  ++ + + +GG +IPN  +      S  E        V      +    A     F ++  +       + +     VV P+    +  I  NDN    +K  Y P   G + + V    + I  SPF+  VD +    +V A GPGL+  T  EV +   FT+ TK AG   L +   G  K E     +  DNHD ++ V Y     G   + + +   PI  SPF  N+   P+  S+V          VG   E  +    +     +  ++T+PS+  +PC ++  + +    V + P E G + V++   G  +PGSPF V        D++KV+  G GL+ G   +   F IDT+ AG G L +++EGP +A+I+C+DN +G C+V YLPTEPG Y IN+ +A  ++PGSPF  ++      P  +  K+      ++  + G      +   +    +L + + + SG      I++  +G   I ++    G + +++ +    +   P +  V       +  V   GPG+E +G + ++  EF +  R   + G  +++  + GPS A  + F      G+  V Y   + G +   + ++   +  SPF + V  +   P   RA
Sbjct:  244 PGAPLRSKQLHPKKANAYGPGIEPHGNMVLKPAYFTV---ETINAGLGEVLVFVEDPEGHTEEAKVIPNNDKNRTYSVSYVPKVAGLHKVTVLFAGQNINKSPFNVNVAMALGDANKVTARGPGLEPVGNVANKPTYFDIYTAGAGSGDVGVIIVDPQNHQDTVEVILEDKGDNIYRCTYRPNMEGPHKVFITFAGSQIPKCPYVVNISEACNPNACRATG-----RGLQPKGVRV------KEVADFKVFTKGAEVENLKSLLKGQVKGTEEPVKIRDAGDGVYECDYYPVLPGKYTVTITWGGYAIPRSPFEVQVSPEVGLQKVRAWGPGL--ETGMVGKSADFVVEAIGTEVGTLGFSIEG-------PSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIKDSPFIAHILPASNKGFPEKVKAYGQGLEPTGCIVEHPAEFTIDARAAGTAELKIYAQDAEGS------------PIDIKIKDNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPY----RVSVGEGSHPNKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVK--YTPPGAGKYTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNR-TGVEVGKPTHFTVYTKGAGKAKLDVQFAGSIKGEAVQDFEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNVA-PPLDLSKVKVQGLNNKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPP--DSSKVRAYGPGLKGGFVGKPAPFAIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIR-----PVFDPSKVTASGPGLEKGKAGEVATFTVDCSKAGDAELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNVEPAV--DTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVT-EGCDPSRVRA 1336          

HSP 14 Score: 140.198 bits (352), Expect = 2.622e-32
Identity = 89/300 (29.67%), Postives = 149/300 (49.67%), Query Frame = 2
Query: 4802 DAGGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK-ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            + G    ++++  + ++  L AS++ PSGN EP +++++ +   G+ F+P+E G H+V V+ N K +  SPF+I VG  +  D   V  SG+GL   +  + A+F V+T NAG G L ++I+GPSKV++NC + EDG  + +Y  T PG YIINI +    H+ GSPF   V G                  E   K  +++  +  S               A + S     +   +AG   +   +  P     +  +    +N ++V +V +E G H + V++  + +PGSPF   V
Sbjct: 1923 NVGTSTDVSLKITESDLSLLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDASKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVSYCPTEPGTYIINIKFAEK-HVPGSPFMVKVTG------------------EGRMKESITRRRQAPSI--------------ASIGSTCDLNLKIPEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQHVPGSPFQFTV 2189          

HSP 15 Score: 125.176 bits (313), Expect = 9.020e-28
Identity = 91/274 (33.21%), Postives = 133/274 (48.54%), Query Frame = 2
Query: 4880 PSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQA-RLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            PSG +  + +   GDG Y V+++  E G HL+ V  +  P+  SPFR+PV     DP  V A G GL   +++K  +F V T  AG+G L +AI+GPS+  M+C + +DG     Y+   PG+Y +NIT+GG   I GSPF   V                                 K   +  K+ C G GL    R +   +F VD S+AG   L V + GP    E V ++  G+   TV+Y     G + + VR+ D+++P SPF + V
Sbjct: 1276 PSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVTE-GCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGR-PIPGSPFRVPV---------------------------------KEIVDPSKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKV 1514          

HSP 16 Score: 100.908 bits (250), Expect = 2.376e-20
Identity = 77/298 (25.84%), Postives = 132/298 (44.30%), Query Frame = 2
Query: 4808 GGLISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHY-KADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            G    + ++  +    ++ A V +PSG    A +    D  Y V+F P+E G H V V+   + + GSPF+  VG   +     V A G GL   +    A+F + T  AG+G L++A++GPSK  +   + +DG    +Y+    G+Y ++I +  + HI  SPF   V                                   S +  ++    L      +N   SF V  + A  G++   +  P    EE  V  V ++++++ ++ +E+G H I V++  + IPGSPF + V
Sbjct: 2116 GSTCDLNLKIPEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFEDRKDGSCGVSYIVQEAGDYEVSIKF-NDEHIPDSPFVVPVASR--------------------------------SDDARRLTVTSLQETGIIVNQPASFAVQLNGA-RGVIDAKVHTPSGMVEECYVSEVDSDKYSIRFIPRENGVHSIDVKFNGRHIPGSPFKIRV 2379          

HSP 17 Score: 90.5077 bits (223), Expect = 3.178e-17
Identity = 77/283 (27.21%), Postives = 127/283 (44.88%), Query Frame = 2
Query: 4856 KLEASVQTPSGNMEPAIVQQ-IGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            K++  + +PS    P  V+  +    + VK+ P E G + V +  +  P+ GSPF +       D   V A G GL    V K A F ++T  AG+G L + ++GP +  + C +  DG    +Y+ T PG Y INI +  + HI GSPF A                         D R V         +  K+   G GL++ +   V +F VD S+AG   L + I        EV++++  +  +++ Y+    G + I +++G   +P  P  V+V+
Sbjct:  979 KVDVKITSPSRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEA-VMPPDSSKVRAYGPGLKGGFVGKPAPFAIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYSINILFAES-HIPGSPFKA-------------------------DIRPV--------FDPSKVTASGPGLEKGKAGEVATFTVDCSKAGDAELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNVE 1226          

HSP 18 Score: 83.1889 bits (204), Expect = 5.188e-15
Identity = 71/263 (27.00%), Postives = 111/263 (42.21%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAI-VDKKAKFFVNTSNAGSGSLNVAIDGPSKVN--MNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVN--SFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVH 5692
            DG   V++ P   G + V +    +PI GSPFR+PV     DP  V  SG GL   +       F V+ S AG   L V + GPS +   ++  +  DG +   Y     G Y +++ Y                        +QE   S  +I+              + +  K+   G GL  A + +     F +DA  AG G+L V I  P    ++  ++  G+  +TV YV   +G + I +++G  +IP SPF +H
Sbjct: 1383 DGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKEI-VDPSKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSVRYA-----------------------DQEVPRSPFKIKV-----------LPTHDASKVRASGPGLNTAGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIH 1610          

HSP 19 Score: 80.4925 bits (197), Expect = 3.163e-14
Identity = 83/273 (30.40%), Postives = 118/273 (43.22%), Query Frame = 2
Query: 4919 GDGQYGVKFSPREFGTHLVFVENNKKPINGSPF--RIPVGHYKADPGMVHASGEGL--SHAIVDKKAKFFVNTSNAGSGSLNV-AIDGP-SKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGI---AGPVRPCEEVV---VKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            GDG   V++ P E G + V V  + + I  SPF   I     K  P  V A G+GL  +  IV+  A+F ++   AG+  L + A D   S +++   +  D  Y   YV T P  + I IT+GG  +I  SP+   V                                E S  N  K+   G+     + N    F VD S+AG G + +GI    G V P E  +   +    N+ FTV Y    +G + IMV + D++IP SPF V VD
Sbjct:  603 GDGSCDVRYWPTEPGEYAVHVICDDEDIKDSPFIAHILPASNKGFPEKVKAYGQGLEPTGCIVEHPAEFTIDARAAGTAELKIYAQDAEGSPIDIKIKDNGDNTYVCVYVPTKPIKHTIIITWGG-VNIPNSPYRVSV-------------------------------GEGSHPNKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGKYTIMVLFADQEIPTSPFRVKVD 843          

HSP 20 Score: 77.411 bits (189), Expect = 3.385e-13
Identity = 75/273 (27.47%), Postives = 112/273 (41.03%), Query Frame = 2
Query: 4886 GNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGM--VHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            G  EP  ++  GDG Y   + P   G + V +      I  SPF + V     + G+  V A G GL   +V K A F V       G+L  +I+GPS+  + C +  DG  +  Y  T PG Y +++    +  I  SPF A +                   + AS+K     + EK      K   QGL      +     F +DA  AG   L +          ++ +K  G+N +   YV  +   H I++ WG  +IP SP+ V V
Sbjct:  499 GTEEPVKIRDAGDGVYECDYYPVLPGKYTVTITWGGYAIPRSPFEVQV---SPEVGLQKVRAWGPGLETGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVIC-DDEDIKDSPFIAHI-------------------LPASNK----GFPEKV-----KAYGQGLEPTGCIVEHPAEFTIDARAAGTAELKIYAQDAEGSPIDIKIKDNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSV 739          

HSP 21 Score: 65.0846 bits (157), Expect = 1.806e-9
Identity = 77/285 (27.02%), Postives = 109/285 (38.25%), Query Frame = 2
Query: 4871 VQTPSGNMEPAIVQQIGDGQ--YGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHA--IVDKKAKFFVNTSNAGSGSLNVAIDGP----SKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVV-VKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            V+ P G+ E A V    D    Y V + P+  G H V V    + IN SPF + V     D   V A G GL     + +K   F + T+ AGSG + V I  P      V +   +  D  Y  TY     G + + IT+ G+  I   P+                               V   +E  + N  +   +GL  K  R+  V  F V    A    L   + G V+  EE V ++  G+  +  DY     G + + + WG   IP SPF V V
Sbjct:  294 VEDPEGHTEEAKVIPNNDKNRTYSVSYVPKVAGLHKVTVLFAGQNINKSPFNVNVAMALGDANKVTARGPGLEPVGNVANKPTYFDIYTAGAGSGDVGVIIVDPQNHQDTVEVILEDKGDNIYRCTYRPNMEGPHKVFITFAGS-QIPKCPY-------------------------------VVNISEACNPNACRATGRGLQPKGVRVKEVADFKVFTKGAEVENLKSLLKGQVKGTEEPVKIRDAGDGVYECDYYPVLPGKYTVTITWGGYAIPRSPFEVQV 546          

HSP 22 Score: 64.3142 bits (155), Expect = 2.843e-9
Identity = 70/265 (26.42%), Postives = 109/265 (41.13%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETE---DGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVR---PCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRW-GDKDIPGSPFMVHV 5695
            DG  GV +  +E G + V ++ N + I  SPF +PV     D   +  +    +  IV++ A F V   N   G ++  +  PS +   C+ +E   D Y   ++    G + I++ + G  HI GSPF   V G +S               +A D   V+ Y              GLGL+       + F V    AG G L V I GP +    C++          + V Y     G ++I +++ G + I GSPF   V
Sbjct: 2249 DGSCGVSYIVQEAGDYEVSIKFNDEHIPDSPFVVPVASRSDDARRLTVTSLQETGIIVNQPASFAVQL-NGARGVIDAKVHTPSGMVEECYVSEVDSDKYSIRFIPRENGVHSIDVKFNGR-HIPGSPFKIRV-GEQS---------------QAGDPGLVTAY--------------GLGLEGGVTGRPSEFIVSTLNAGAGSLSVTIDGPSKVKLDCQD------SPEGYKVSYTPMAPGNYLISIKYGGPQHIVGSPFKARV 2475          

HSP 23 Score: 58.5362 bits (140), Expect = 1.476e-7
Identity = 73/268 (27.24%), Postives = 115/268 (42.91%), Query Frame = 2
Query: 4922 DGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADP-GMVHASGEGLSHAI-VDKKAKFFVNTSNA-GSGSLNVAIDGPSKVNMNCH----ETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFT--AVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCE-EVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            D  Y VK++  + GT  V V     PI  SPF + V    A P  +     +GL++ + V K  +F ++TS A G G ++V I  PS+  + C      T D +   Y+    G Y ++I+Y G+  + GSPF+  AV+  + S                                   K+   G GLK   +     F +D   AG G L + + G   PCE ++  +  G+   +V Y+  E G + I + + +  IPGSPF   +
Sbjct:  906 DYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNV----APPLDLSKVKVQGLNNKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGH-PVPGSPFSVEAVMPPDSS-----------------------------------KVRAYGPGLKGGFVGKPAPFAIDTKGAGTGGLGLTVEG---PCEAKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADI 1130          
BLAST of Filamin-A vs. Ensembl Xenopus
Match: coq2 (coenzyme Q2 4-hydroxybenzoate polyprenyltransferase [Source:Xenbase;Acc:XB-GENE-967037])

HSP 1 Score: 818.92 bits (2114), Expect = 0.000e+0
Identity = 576/1616 (35.64%), Postives = 838/1616 (51.86%), Query Frame = 3
Query:   96 VTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLA---PMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPD---------GTKVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIH----EAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLL--CEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPILSEQIKTLKAGNP-------------------HNPM------QKANPGKSNKPYTALEEAIKEMK----ESAVESSKWPQS-KPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTV--EGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPI--KDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQ----ISNELASNAFHGVNFEI--NTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGE-PVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAARA 4766
            +T GG +IP SP+ + ++        IG             P  F+  ++ GIK  P V    +  +  +   + K   +T+   YTP   G++ I      + +  +P  V V  +   +  K++ EG       +EV  P  F V +  K      +DVQ          I  EA  D            V +   + G  ++       PI ++P  V   P  D+     + +N K              V K   F+I            DV + SP + +PIP K +      +   +++P + GPY +  S D +P+ GSP ++     P  ++       +K    G P                     P       Q    G  +  Y   E     +     ES +  S +    +P    SKV   G GLEK  A E A FT+D   A  A + + +  +   +A +   +N DGT  + Y    PG YTI + Y    +P+ P+ V V P     +D S V   GPG+ P GV ++   +FTVDA  +++ G   V   +  PSG  T   + +  +G Y V+YT  E+G H I V Y+ +P+  SPF V    G +   V A GPGL    +N+  +F V+  GAG G LGLAIEGP++A++ C DNKDG+C VEY P   GDYD+++ F    I  SPF V V + V P KVK  GP      +   P  FT+DCS+AG APLEV V  P SG+++ PV I+       GT  V Y P   GP  + V+Y    +  SPFK  V+      KV+  G G+      I AS+P  F ++ +DAG    + V + +P G+P   +I    +G YT  Y     G + I++   G  +P SP+ + ++PTG+  KC +         + +E+VIT++ K AGKG++TC V   +  +            + V V E+ DG   ++Y   E G+Y++ +++GG+ IPN  F      S QEV ++ +++        +  E         N  I    + G   ++  +V  PSG      IT  DN    + + + P E+G H++ +   G  I GSP QF+VD      V+A+GPGLS G  N+ A FTI+TKDAG GGLSL VEGPSK EI C+DN DGT  VSY+P APG+YNII++F D+ I GSPFT+ ITG+  ++ SQ+ VG S+++ LKI  SDLS LTA +  PS  + PC++K++ N  +G+SFTPKE GEH+V+V + G  +  SPFK+ V   E+GDA+KVKVSGKGL +G+  +  EF +DTR+AGYG L +SIEGPSK +I+C+D E+G C V Y PTEPG Y+IN+ +A K+VPGSPF V V G+  +    + + R ++A     +G  C++NLKI E   +++   V +PSG T   +I D  +    ++FV +E G H VSV ++ +H+ GSPFQFTVG +  GG+  V A GPGLE+G   +  EF+I+TREAGAG +S+A+EGPSKAE+ F++ +D GSC V+Y V + GDYE SIKFN EHI +SPF        + PVA+R+
Sbjct:  723 ITWGGVNIPNSPYRVSYS-------LIGLC--------FSSPLFFR-DVSIGIKCAPGVVGPAEADIDFD---IIKNDNDTFTVKYTPPGAGKYTIMVLFADQEIPTSPFRVKV--DPSHDASKVRAEGPGLNRTGVEVGKPTHFTVYT--KGAGKAKLDVQFAGS------IKGEAVQDFEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNVAPPLDLSKVKVQGLNNKV------------DVGKDQEFSIDTSGAGGQ-GKVDVKITSP-SRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDSSKVRAYGPGLKGGFVGKPAPFAIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIRPVFDPSKVTASGPGLEKGKAGEVATFTVDCSKAGDAELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNVEPA----VDTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVTEGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKEIVDPSKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLAPLEVLVQGP-SGLAE-PVDIRD---NGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKVLPTHDASKVRASGPGL--NTAGIPASLPVEFTIDARDAGEGL-LTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVPTGDASKCLVTGEP----AIGEETVITVDAKAAGKGKVTCKVSTPDGAE------------LDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFH--VVVSKQEVMKSASKAPAATEEPVVPVENLDTMLRPFNLVIPFTVQKG---EITGEVRMPSGKTARPNIT--DNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDASKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVSYCPTEPGTYIINIKFAEKHVPGSPFMVKVTGEGRM---KESITRRRQAPSIASIGSTCDLNLKIPEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFEDRKD-GSCGVSYIVQEAGDYEVSIKFNDEHIPDSPF--------VVPVASRS 2248          

HSP 2 Score: 243.817 bits (621), Expect = 0.000e+0
Identity = 128/286 (44.76%), Postives = 182/286 (63.64%), Query Frame = 2
Query: 4859 LEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYK--ADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGYEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVS-----QYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ++A V TPSG +E   V ++   +Y ++F PRE G H + V+ N + I GSPF+I VG      DPG+V A G GL   +  + ++F V+T NAG+GSL+V IDGPSKV ++C ++ +GY+ +Y   APGNY+I+I YGG  HIVGSPF A V G + +   +  E  S V +E   K   S       A K SS+  K++ +G GL +A +   N+F VD S+AG  +L+VG+ GP  PCEEV VKH+GN  + V Y VK+ G +I++V+WGD+++PGSPF V V
Sbjct: 2283 IDAKVHTPSGMVEECYVSEVDSDKYSIRFIPRENGVHSIDVKFNGRHIPGSPFKIRVGEQSQAGDPGLVTAYGLGLEGGVTGRPSEFIVSTLNAGAGSLSVTIDGPSKVKLDCQDSPEGYKVSYTPMAPGNYLISIKYGGPQHIVGSPFKARVTGVRLSGGHSLHET-STVLVETVTKSSASVGGYAMTAPKFSSDASKVVSRGPGLSKAFVGQKNTFTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHMGNRLYNVTYTVKDKGDYILIVKWGDQNVPGSPFQVAV 2567          

HSP 3 Score: 522.316 bits (1344), Expect = 2.745e-151
Identity = 489/1630 (30.00%), Postives = 744/1630 (45.64%), Query Frame = 3
Query:   84 LHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLND-GIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAPMIE---VCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQES----------PLITEEPILSE-------QIKTL-KAGNPHNPMQKANP--------------GKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQPS------SKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKV--NEKTQFVVDLDGAGHGSLGLAI---EG-PADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNP-DVIVGLFNPNGE-----PMPLHIEARPN------GLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQV----------AVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVN---------VHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKD-VTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNG-EHIVNSPF 4718
            L   VT GG+ IP SPF +      + SK    ++ L   V + + Q F +  +  G + +  V ++  +  P+   +   V+ + +   Y P + G + +  S DG PV  +P  V  V  +P +  K++  G  P ++   V  P  F + +  K      + + V  P    I        DG+  V+++P E G +SI     +  I  +P       KADI    +     A+    EK G+  +  +FT+      D   +  + +LS    +   +            +IP   G Y++      + +   P  + V+ +          P +    +L E         ++L K G  H   +   P              G  +  YTA E+ +  + E   +    P+S    P       S+V  YG GLE     +   FT++++ A +  +G+ +EGP EA + C DN DG+C V Y    PG Y +N+ +    IP SP  VPV     + +D S V  SGPGL   GV       FTVD S+    G   ++ LVQ PSG      I +  +G + V YTP  +GP+ ++V Y    +  SPF +K  P  +A  V ASGPGL++  +  +   +F +D   AG G L + I   EG P  A I+   N DGT  V Y P  AG Y I++K+  ++I  SPF +  V      K    G   +  +      T+D   AGK  +  KVS P     D  V   Q      GTFD+ Y   E G  +I +++    I  SPF   VV   +V K           + A  A+   V  V   D  + P ++++      GE      MP    ARPN      G  T ++   + G H++ +  DG  +P SP         +    A   G    + VNK +  TI TK+AG+G ++  V+   + ++                +++ DG  +V YMP   G+Y + V++  + IP   F    T       ++M  S       +L       V+ +I   D     L A +  PSG  E   +    N   +I I + P E G H + V   G+ +  SPF+  V     G   +V   G GL  G T EVAEF + T++AG GGL L +EGPSK +I CED  DGT KVSY P  PG Y I IKF ++ + GSPF   +TGE   K  +          ++G++ ++ LKIP +    +TA++T+PS       I    +    V F P+E G H V+V  +G  +PGSPF+  V     G A KV+  G GLE+G+A    EF+I TR+AG G L+I++EGPSKAEI  +D ++G C V Y+  E G+Y +++ +  +++P SPF        VVP  ++  +  +  V + Q     E  + +++ A   +++N         VHTPSG  E C + +  +    I+F+ RE+G+H + V    RHI GSPF+  VG  +  G    VTA G GLE G     +EF + T  AGAG++SV ++GPSK ++  Q+S +     V+Y    PG+Y  SIK+ G +HIV SPF
Sbjct:  896 LTVSVTYGGDPIPKSPFNVNVAPPLDLSKV--KVQGLNNKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAV--MPPDSSKVRAYG--PGLKGGFVGKPAPFAIDT--KGAGTGGLGLTVEGPCEAKIECQDNG--DGSCSVSYLPTEPGEYSINILFAESHIPGSPF------KADIRPVFDPSKVTASGPGLEK-GKAGEVATFTVDCSKAGD--AELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNVEPAVDTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGV-HLIEVLYDDVPVPKSPFRVPVTEGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPV----KEIVDPSKVKCSGPGLG-SGVRAHVPQTFTVDCSKA---GLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKVLPTHDASKVRASGPGLNTAGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIR--GNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVPTGDASKCLVTG---EPAIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVDVVENQ-----DGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHV-VVSKQEVMK---------SASKAPAATEEPVVPVENLDTMLRPFNLVIPFTVQKGEITGEVRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGM-VNKPATFTIVTKDAGEGGLSLAVEGPSKAEI--------------TCKDNKDGTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKITGD-----DSMRTS-------QLNVGTSTDVSLKITESD--LSLLTASIRAPSGNEEPCLLKRLPN--RHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDASKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVSYCPTEPGTYIINIKFAEKHVPGSPFMVKVTGEGRMKESITRRRQAPSIASIGSTCDLNLKIPEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFEDRKDGSCGVSYIVQEAGDYEVSIKFNDEHIPDSPF--------VVPVASRSDDARRLTVTSLQ-----ETGIIVNQPASFAVQLNGARGVIDAKVHTPSGMVEECYVSEVDSDKYSIRFIPRENGVHSIDVKFNGRHIPGSPFKIRVGEQSQAGDPGLVTAYGLGLEGGVTGRPSEFIVSTLNAGAGSLSVTIDGPSKVKLDCQDSPE--GYKVSYTPMAPGNYLISIKYGGPQHIVGSPF 2431          

HSP 4 Score: 370.163 bits (949), Expect = 3.001e-131
Identity = 354/1228 (28.83%), Postives = 565/1228 (46.01%), Query Frame = 3
Query: 1224 QSKPDQPSSKVIVYGKGLEKVAAKEKAIFTIDSKDAPSAPIGVTVEGPGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGL----AIEGPADAEIQCH--DNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKD---AKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIE-ARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTR-SVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF----FVDTKGEGRVTAFGPGLS-SGTTNEVA-EFTI----ITKDAGPGGLSLIVEGPSK--TEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQV----------AVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGL-ANQGNEFTIDTRDAGYGSLNISIEGPSKAE--IDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPC-ETQKMERVQEAVKATQVGGNCEINLKIDEMALKD--LKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASG-PGL-EKGFIDINNEFAIYTREAGAGNISVAMEGPSKAEMKFQ--ESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIVEDDSIKPVAARAVSSS 4778
            Q  P+    KV  +G GLE     + A F +++       +G ++EGP +A I+C D GDG+C V Y    PG Y ++V+ D+  I  SP +  + P  NK      V A G GL P G   +  A+FT+DA      G   +K   Q   G   +  I +  +  YV  Y PT+   H I +T+ G+ I +SP+ V     ++   +  S P            F  D+      S+G+     + GPA+A+I      N + T  V+YTP  AG Y I V F D++I  SPF V+V       KV+++GP  +    ++ +P HFT+    AGKA L+V+ +     I    V   ++      ++ V Y   + G   + V Y   PI  SPF  NV  P  + KVKV G      N  +       F ++T  AG    V V + +P+  P+P  +E    + ++T +Y   + G +K+ +  DG P+P SP++V+++   +  K        K   V K +   I+TK AG G +  TV+       G  E        K++ Q++ DG  SV Y+P E GEY + + +    IP   F       F   + T +   ++   + E+A+       F ++       +L  +++  SG   EV I +N +  ++I   Y P+  G + + +   G  +   P +      VDT G   V  FGPG+   G   EV  EFT+    +TK  G    + I+ GPS   TE    DN DGT+ V Y     G + I + + D P+  SPF   +T E    S+V           +  S+   ++   +    L   +  PS+ K+ C  K   +G+  V + P   G++ VN+   G  IPGSPF+V VK  E+ D +KVK SG GL  G+ A+    FT+D   AG   L + ++GPS     +D +DN +G  TV Y P   G Y ++V YA + VP SPF +     KV+P  +  K+      +    +  +  +   ID     +  L V +  P G  +  +I   G+G   + +V   +G + +++ +    I  SPF+  + +V  G +     +G P + E+  I ++       + AG G ++  +  P  AE+     E+QD G+  + Y   +PG Y  +I+F GEHI NSPFH++V    +   A++A +++
Sbjct:  545 QVSPEVGLQKVRAWGPGLETGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIKDSPFIAHILPASNKGFP-EKVKAYGQGLEPTGCIVEHPAEFTIDARAA---GTAELKIYAQDAEGSPIDIKIKDNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVS----YSLIGLCFSSP-----------LFFRDV------SIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGKYTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNRTGVEVGKPTHFTVYTKGAGKAKLDVQFA---GSIKGEAVQDFEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNVAPPLDLSKVKVQG-----LNNKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDSSKVRAYGPGLKGGFVGKPAPFAIDTKGAGTGGLGLTVE-------GPCEA-------KIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIRPVFDPSKVTASGPGLEKGKAGEVAT-------FTVDCSKAGDAELTIEILSDSGSKAEVLIQNNSDGTYSIT--YIPACPGAYTITIKYGGHAVPKFPVRVNVEPAVDTSG---VKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRIL-GPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVT-EGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSC--KDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVK--EIVDPSKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKI-----KVLPTHDASKVRASGPGLNTAGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFR--IHAVPTGDASKCLVTGEPAIGEETVITVD------AKAAGKGKVTCKVSTPDGAELDVDVVENQD-GTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVVSKQEVMKSASKAPAAT 1693          

HSP 5 Score: 122.479 bits (306), Expect = 3.001e-131
Identity = 102/350 (29.14%), Postives = 156/350 (44.57%), Query Frame = 2
Query: 4817 ISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGPSKVNMNCHETEDGY-EFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKS----------ATNVNQEEQHSQVEIEASDKRCVSQYAE--------------------------------KSSSN--------------VEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            + I    + GEI      V+ PSG      +    DG   VKF+P E G H + ++ +   I GSP +  V    +    V A G GLSH +V+K A F + T +AG G L++A++GPSK  + C + +DG    +Y+ TAPG+Y I + +  + HI GSPFT+ + G+ S          +T+V+ +   S + +  +  R  S   E                                K  +N                K+   G GL +     V  F VD   AGYG L + I GP +   ++  + + +    V Y   E GT+II +++ +K +PGSPFMV V
Sbjct: 1712 LVIPFTVQKGEI---TGEVRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDAINSR--HVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYMPTAPGDYNIIVRF-DDKHIPGSPFTSKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDASKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSK--VDINCEDMEDGTCKVSYCPTEPGTYIINIKFAEKHVPGSPFMVKV 2053          

HSP 6 Score: 354.369 bits (908), Expect = 3.176e-107
Identity = 357/1201 (29.73%), Postives = 526/1201 (43.80%), Query Frame = 3
Query: 1266 GKGLE--KVAAKEKAIFTIDSKDAPSAPIGVTVEGP---GEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDA--SEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQL---VTASGPGLH--SCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAE-----IQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMP-LHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEA-GKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGE-GRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLS--LIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEP-VKKSQVAV--------GNSSEIPLK-------IPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEI----NLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFI--DINNEFAIYTREAGAGNISVAM---EG-PSKAEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHI 4724
            G+GL+   V  KE A F + +K A    +   ++G     E  +   D GDG     Y   +PG YT+ + +    IP+SP  V V P+    + L  V A GPGL    V K   A F V+A  +EV     GT+   ++ PS  Q     D+  +G   VRY PTE G + ++V  +   I+DSPFI    P  N      V A G GL    C V    +F +D   AG   L +  +   DAE     I+  DN D T +  Y P K   + I + +   +I +SP+ V                       R     I C+     P E  +        D  +     +     TF V Y P   G   I V +    I  SPF+  V       KV+ +G G+      +    P  F V TK AG     +    +  GE +    I    +  YT +Y     G   +SV   G P+PKSP+ V   P  +  K  ++ G +  + V K+   +I+T  A G+G++   +    R+ +            KV+     D I +V YMP EEG Y V++ Y G  +P   F      S + V    +  V+                F I+TK      L   V  P     E  I   DN   +  + Y P+E G + + +      I GSPF+  +    +  +VTA GPGL  G   EVA FT+    AG   L+  ++ +  SK E+  ++N DGT+ ++Y+P  PG Y I IK+    +   P   N+  EP V  S V V        G   E+  +       +  +  S +T  +  PS       +    +G   V +T  E G HL+ V      +P SPF+V V   E  D ++V+  G GLE GL N+ N FT++TR AG G L ++IEGPS+A++ CKDN++G C+V+Y+P  PG+Y +N+T+ G+ +PGSPF V V+       E     +V+ +      G    +     +   +  L  L+V V  PSG  EP DI D G+G   + +     G + VSV + D+ +  SPF+  V  +    +  V ASGPGL    I   +  EF I  R+AG G ++V +   EG P KA ++       G+  V+Y     G Y  +IK+ G+ I  SPF I
Sbjct:  461 GRGLQPKGVRVKEVADFKVFTKGAEVENLKSLLKGQVKGTEEPVKIRDAGDGVYECDYYPVLPGKYTVTITWGGYAIPRSPFEVQVSPE----VGLQKVRAWGPGLETGMVGKS--ADFVVEAIGTEV-----GTLGFSIEGPS--QAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIKDSPFIAHILPASNKGFPEKVKAYGQGLEPTGCIVEHPAEFTIDARAAGTAELKIYAQ---DAEGSPIDIKIKDNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSYSLIGLC--------FSSPLFFRDVSIGIKCAPGVVGPAEADI--------DFDIIKNDND-----TFTVKYTPPGAGKYTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGL--NRTGVEVGKPTHFTVYTKGAGKAKLDVQFAGSIKGEAVQDFEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNVAPPLDLSKVKVQ-GLNNKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPI----------PCKVETGVTSD-IHTVKYMPPEEGPYKVDISYDGHPVPGSPF------SVEAVMPPDSSKVRAYGPGLKGGFVGKPAPFAIDTKGAGTGGLGLTVEGPC----EAKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIRPVFDPSKVTASGPGLEKGKAGEVATFTVDCSKAGDAELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNV--EPAVDTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVT--EGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVK-------EIVDPSKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKV--LPTHDASKVRASGPGLNTAGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIR---GNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRI 1584          

HSP 7 Score: 57.7658 bits (138), Expect = 3.176e-107
Identity = 73/300 (24.33%), Postives = 114/300 (38.00%), Query Frame = 2
Query: 4823 ITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRIPVGHYKADPGMVHASGEGLSHAI----VDKKAKFF--VNTSNAGSGSLNVAIDGPS--KVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEKIICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVRPCEEVVVKHVGNNQFTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHV 5695
            ITV A+     K+   V TP G      V +  DG + + ++  E G +++ +    + I  SPF + V   +       A        +    +D   + F  V       G +   +  PS      N  + +DG     +     G + ++I Y GN HI GSP                     Q  ++A + R VS Y              G GL    +N   +F +    AG G L + + GP +   E+  K   +   TV Y+    G + I+VR+ DK IPGSPF   +
Sbjct: 1609 ITVDAKAAGKGKVTCKVSTPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVVSKQEVMKSASKAPAATEEPVVPVENLDTMLRPFNLVIPFTVQKGEITGEVRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGN-HIPGSPL--------------------QFYVDAINSRHVSAY--------------GPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSK--AEITCKDNKDGTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKI 1871          

HSP 8 Score: 330.487 bits (846), Expect = 5.182e-104
Identity = 341/1213 (28.11%), Postives = 531/1213 (43.78%), Query Frame = 3
Query: 1245 SSKVIVYGKGLEKVA--AKEKAIFTIDSKDAPSAPIGVTVEGPG------EAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTV--DASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLL------------RPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKA-GKDKT-IQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDG-----VPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF-FVDTKGEGRVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANI-----------TGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEVGDATKVKVSGKGLE-KGLANQ-GNEFTIDTRD---AGYGSLNISIEGPSKA--EIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNV-EGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGF-IDINNEFAIYTREAGAGNISVAMEGPSK-AEMKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            ++KV   G GLE V   A +   F I +  A S  +GV +  P       E +++  D GD      Y   + G + + + +    IP+ P VV +    N N       A+G GL P+GV     A F V    +EV +N +  +K  V+   G +    I +  +G Y   Y P   G + + +T+ G  I  SPF V+  P    Q V A GPGL +  V +   FVV+  G   G+LG +IEGP+ A+I+C D  DG+C V Y P + G+Y + V  +DEDI DSPF              +KG  +  K               P  FTID   AG A L++            P+ IK ++     T+   YVP +     I + +    I  SP++ +                +I     +  S P  F    +D  +      G+  P    +   I    N  +T +Y     G + I V      +P SP+ VK  P+ +  K   +  G ++T ++V K +  T+ TK AGK        K++ Q  G ++   V D    ++ ++ D   +V Y   ++G   V V YGG  IP   F         ++ +   + + N++      +      F I+T        V V + +   RP  C  E  +TS+    H +K  Y P E GP+++ ++  G P+ GSPF    V      +V A+GPGL  G   + A F I TK AG GGL L VEGP + +I+C+DN DG+  VSY+P  PG Y+I I F +  I GSPF A+I           +G  ++K +   G  +   +    +  + LT E+ + S  K   +I+  ++G   +++ P   G + + +   G  +P  P +VNV  E   D + VKV G G+E +G+  +   EFT+D R     G   +   I GPS A  E    DN +G   V+Y   E G ++I V Y    VP SPF V V EG     C+  ++      ++   +  +    ++        L + +  PS     C  +D  +G+  ++++    G + V++    R I GSPF+  V  +       V  SGPGL  G    +   F +   +AG   + V ++GPS  AE         G+  V Y  +  G Y  S+++  + +  SPF I V
Sbjct:  355 ANKVTARGPGLEPVGNVANKPTYFDIYTAGAGSGDVGVIIVDPQNHQDTVEVILE--DKGDNIYRCTYRPNMEGPHKVFITFAGSQIPKCPYVVNISEACNPN----ACRATGRGLQPKGVRVKEVADFKVFTKGAEV-ENLKSLLKGQVK---GTEEPVKIRDAGDGVYECDYYPVLPGKYTVTITWGGYAIPRSPFEVQVSPEVGLQKVRAWGPGLETGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIKDSPF------IAHILPASNKGFPEKVKAYGQGLEPTGCIVEHPAEFTIDARAAGTAELKIYAQD----AEGSPIDIK-IKDNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSY--------------SLI----GLCFSSPLFF----RDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGKYTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNRTGVEVGKPTHFTVYTKGAGKA-------KLDVQFAGSIKGEAVQD---FEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNVAPPL-DLSKVKVQGLNNKV------DVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGVTSD---IHTVK--YMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDSSKVRAYGPGLKGGFVGKPAPFAIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIRPVFDPSKVTASGPGLEKGK--AGEVATFTVDCSKAGDAELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNV--EPAVDTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVTEG-----CDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSC--KDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKEIV--DPSKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKV 1489          

HSP 9 Score: 71.2478 bits (173), Expect = 5.182e-104
Identity = 77/306 (25.16%), Postives = 125/306 (40.85%), Query Frame = 2
Query: 4817 ISITVRAEDGEIPKLEASVQTPSGNMEPAIVQQIGDGQYGVKFSPREFGTHLVFVENNKKPINGSPFRI---PVGHYKADPGMVHASGEGLSHAIVDKKAKFFVNTSNAGSGSLNVAIDGP--SKVNMNCHETEDG-YEFTYVATAPGNYIINITYGGNFHIVGSPFTAVVEGNKSATNVNQEEQHSQVEIEASDKRCVSQYAEKSSSNVEK--IICQGLGLKQARLNSVNSFFVDASQAGYGILLVGIAGPVR-PCEEVVVKHVGNNQ---FTVDYVVKESGTHIIMVRWGDKDIPGSPFMVHVD 5698
            +  T+ A D     L   +  P G  + A ++  GDG Y V + P   G + + ++     I  SPFRI   P G    D      +GE      + ++    V+   AG G +   +  P  ++++++  E +DG ++  Y A  PG Y+I I +GG  HI  SPF  VV                        K+ V + A K+ +  E+  +  + L       N V  F V   +         I G VR P  +    ++ +N+    TV +   E G H + +++    IPGSP   +VD
Sbjct: 1516 VEFTIDARDAGEGLLTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVPTG----DASKCLVTGE----PAIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGE-HIPNSPFHVVVS-----------------------KQEVMKSASKAPAATEEPVVPVENLDTMLRPFNLVIPFTVQKGE---------ITGEVRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVD 1780          

HSP 10 Score: 357.451 bits (916), Expect = 8.459e-99
Identity = 410/1579 (25.97%), Postives = 652/1579 (41.29%), Query Frame = 3
Query:   45 VTYRPQECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKPNVKLQQPQTFKVKLNDGIKSEPCVTVSDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEGLAP---MIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSKKLPKGLLC--EFIPKKAGPYSLVASVDNNPIKGSPQTIVVQE----SPLITEEPILSEQIKT----------LKAGNP------HNPMQKANP----------------GKSNKPYT-ALEEAIKEMKESAVESSKWPQSKPDQPSSKVIVYGKGLEK--VAAKEKAIFTIDSKDAPSAPIGVTV---EG-PGEAVIDCVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDNLNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIV------------KAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPA--DAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGPIKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIKQVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVNTKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPT--GNPEKCAIKAGKDKTIQVNKE-SVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGVNFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQFFVDTKGEG---RVTAFGPGLSSGTTNEVAEFTIITKDAGPGGLSLIVEGPSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTANITGEPVKKSQVAVGNSSE--IPLKIPSSDLSTLT-------AELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNV-KNEEVGDATKVKVSGKGLEKGLANQGNEFTIDTRDAGYGSLNISIEGPSKAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAG-KNVPGSPFNVNVEGDKV---------------------------------VPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTV 4442
            V+Y P E P   +++  +      IPGSPF        + SK   +   L+   K  +  TF V  +    +E  + +   +G   E VL++  S  TY  TY P   G + IT    G  V K PV V+V   +  +  K+   G+ P   + EV    T    S  K      V  ++L P   +         DGT  V +   E+G H I     D P+ ++P  V      D      +   P       + G +NK   FT+  +          + +  P   +     S K  K   C  E+IP   G Y +  +    PI GSP  + V+E    S +    P L   ++            KAG          P   A P                  ++ PYT ++  A +E+  S  +     +  P   +SKV   G GL    + A     FTID++DA    + V +   EG P +A I    NGDGT  V Y   + G YTI + Y    IP SP  +   P  + +  L T     P +  E V        TVDA      G+G V   V +P G + +  +    +G + + YT  E G + I + + G  I +SPF V            KA       +V            N    F V       G +   +  P+   A     DNKDGT  V++ PV+ G +++ +K++   I  SP    V              +    + +P  FTI   +AG+  L + V  P    S   +T K  +    GT  V Y+P   G   I V+++   I GSPF + +     +   +++          +  S      +   D  +   +   +  P+G   P  ++  PN      +   +VG+H +SV  +G  +  SP+ +   P+  G+  K  + +GK     V  E +   ++T+ AG G +  +++   +              + +  ++  DG   V Y P E G Y++ +K+  + +P   F    T   + ++E++TR  Q      + S      +  +   +    ++ A+V  PSG   +  I   ++  ++++  + P E G H + V  +G+ + GSPFQF V   GEG   +V A GPGL  G     AEF+I T++AG GGLS+ VEGPSK EI  ED  DG+  VSY+ Q  G+Y + IKF D+ I  SPF   +        ++ V +  E  I +  P+S    L        A++ TPS +   C + ++++    + F P+E G H ++V   G  IPGSPFK+ V +  + GD   V   G GLE G+  + +EF + T +AG GSL+++I+GPSK ++DC+D+  G   V Y P  PGNY+I++ Y G +++ GSPF   V G ++                                    +  K+      +    VG      +   +     L V VH P    E   ++  GN    + +  ++ G + + V   D+++ GSPFQ  V
Sbjct: 1075 VSYLPTE-PGEYSIN--ILFAESHIPGSPFKADIRPVFDPSKVTASGPGLEKG-KAGEVATFTVDCSKAGDAELTIEILSDSGSKAE-VLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNVEPAVDTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKT-GGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVTEGCDPSRV--RAYGPGL-----EGGLLNKSNRFTV--ETRGAGTGGLGLAIEGPSEAK----MSCKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKEIVDPSKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKI----KVLPTHDASKVRASGPGLNTAGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIR--GNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVPTGDASKCLVT---GEPAIGEETVI-------TVDAKAA---GKGKVTCKVSTPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVVSKQEVMKSASKAPAATEEPVVPVENLDTMLRPFNLVIPFTVQ-----KGEITGEVRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGP----SKAEITCKDNKD---GTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKITGDDSMRTSQLN----------VGTSTDVSLKITESDLSL---LTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDASKVKV-SGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSK--------------VDINCEDMEDGTCKVSYCPTEPGTYIINIKFAEKHVPGSPFMVKVTGEGR-MKESITRRRQAPSIASIGSTC----DLNLKIPEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVR--FVPQEMGAHTVSVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFEDRKDGSCGVSYIVQEAGDYEVSIKFNDEHIPDSPFVVPVASRSDDARRLTVTSLQETGIIVNQPASFAVQLNGARGVIDAKVHTPSGMVEECYVSEVDSDKYSIRFIPRENGVHSIDVKFNGRHIPGSPFKIRVGEQSQAGDPGLVTAYGLGLEGGVTGRPSEFIVSTLNAGAGSLSVTIDGPSKVKLDCQDSPEGY-KVSYTPMAPGNYLISIKYGGPQHIVGSPFKARVTGVRLSGGHSLHETSTVLVETVTKSSASVGGYAMTAPKFSSDASKVVSRGPGLSKAFVGQKNTFTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHMGNRLYNVTYTVKDKGDYILIVKWGDQNVPGSPFQVAV 2567          

HSP 11 Score: 349.747 bits (896), Expect = 2.691e-96
Identity = 427/1646 (25.94%), Postives = 706/1646 (42.89%), Query Frame = 3
Query:   24 KTPDLYEVTYRPQECPNSKALHPKVTVGGEDIPGSPFTIPFTKKDEDSKYIGTLEDLKP-NVKLQQPQTFKVKLNDGIKSEPCVTV--SDKNGVPVEPVLVKKVSPNTYQATYTPTKLGQHIITASADGKPVAKTPXXXXXXDEIPENVEKIKVEG---LAPMIEVCAPQTFKVLSPEKVINPDLVDVQVLNPENKIIPIHKEAAPDGT-KVTFVPKENGPHSIGCWVQDQPINETPCIVKSLPKADIHEAINKKSSPATLAVEEKEGQVNKPCSFTIVKDNTNDDIHDFDVVVLSPDNHQPIPVKSK-KLPKGLLCEFIPKKAGPYSLVASVDNNPIKGSPQTIVVQESPLITEEPILSEQIKT--------------------LKAGNPHNPMQKANPGKSNKPYTALEEAIKEMKESAVESSKWPQSKPDQPSSKVIVYGKGLEK--VAAKEKAIFTIDSKDAPSAPIGVTVEGP--GEAVID--CVDNGDGTCGVVYEVPVPGLYTINVLYDNVHIPQSPIVVPVYPKDNKNLDLSTVTASGPGLSPEGVFKDCFAKFTVDASEVSQNGQGTVKALVQSPSGKQTNGLIDN-LNNGKYVVRYTPTEEGPHKINVTYEGLPIQDSPFIVKAKPGFNAQLVTASGPGLHSCKVNEKTQFVVDLDGAGHGSLGLAIEGPADAEIQCHDNKDGTCLVEYTPVKAGDYDISVKFNDEDISDSPFHXXXXXXXXXXXXXSKGP-IKDAKLLRPNHFTIDCSEAGKAPLEVKVSKPGSGISDRPVTIK-QVEGAAPGTFDVCYVPEELGPCLIDVKYNKSPISGSPFKTNVVQPAQVEKVKVDGDGIIPQNGAILASMPAVFHVN----TKDAGVNPDVIVGLFNPNGEPMPLHIEARPNGLYTCEYQTHDVGDHKISVDVDGAPLPKSPYTVKSMPTGNPEKCAIKAGKDKTIQVNKESVITIETKEAGKGQITCTVKKIERQKVGQVEQIKVLDSIKVKVQEHPDGIASVHYMPKEEGEYLVEVKYGGQSIPNGKFFQTATYSFQEVRETMTRSVQNQISNELASNAFHGV--NFEINTKDGVPVDLNAKVVRPSGCMEEVPITSNDNYKHNIKIDYQPSERGPHQLQVNSQGRPIKGSPFQF-FVDTKGEGRVTAFGPGLSSGT--TNEVAEFTIITKDAGPGGLSLIV---EG-PSKTEIKCEDNHDGTFKVSYVPQAPGNYNIIIKFKDQPIAGSPFTAN-----------ITGEPVKKSQVAVGNSSEIPLKIPSSDLSTLTAELTTPSKIKVPCVIKKMNNGALGVSFTPKETGEHLVNVYEKGTDIPGSPFKVNVKNEEV-GDATKVKVSG-------KGLEKGLA--NQGNEFTIDTRDAGYGSLNISIEGPS--KAEIDCKDNENGVCTVKYLPTEPGNYVINVTYAGKNVPGSPFNVNVEGDKVVPCETQKMERVQEAVKATQVGGNCEINLKIDEMALKDLKVNVHTPSGFTEPCDIEDTGNGNLRIKFVARESGIHHVSVLHKDRHIRGSPFQFTVGSVTPGGSKDVTASGPGLEKGFIDINNEFAIYTREAGAGNISVAMEGPSKAE----MKFQESQDKGSCAVTYRVSQPGDYECSIKFNGEHIVNSPFHIIV 4730
            K  ++Y  TYRP      K     +T  G  IP  P+ +  ++    +    T   L+P  V++++   FKV    G + E   ++      G   EPV ++      Y+  Y P   G++ +T +  G  + ++P  V V  E+   ++K++  G      M+   A    + +  E       +   +  P    I    +   DG+  V + P E G +++     D+ I ++P I   LP ++  +   +K       +E     V  P  FTI  D       +  +     +   PI +K K       +C ++P K   ++++ +     I  SP  +      L    P+    +                      +K  N    ++   PG        L  A +E+  S        +  P   +SKV