SMED30034511
Overview
Neoblast Clusters
Zeng et. al., 2018
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny AppEmbryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30034511 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 5
Homology
BLAST of SMED30034511 vs. Planmine SMEST
Match: SMESG000039356.1 (SMESG000039356.1) HSP 1 Score: 72.4034 bits (176), Expect = 1.318e-17 Identity = 31/44 (70.45%), Postives = 34/44 (77.27%), Query Frame = 3 Query: 144 CVNFVYQFTRN*CNATHIGRTPRHFCTRILGHCWLKGLANISEH 275 C + VYQFT N CNAT+IG T RH CTR+L HC LKGL NISEH Sbjct: 882 CSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKGLTNISEH 925 HSP 2 Score: 33.4982 bits (75), Expect = 1.318e-17 Identity = 15/20 (75.00%), Postives = 16/20 (80.00%), Query Frame = 2 Query: 89 NLCKVRNMFINKSKPLIVLC 148 N CK RNMFINKSKP + LC Sbjct: 863 NSCKGRNMFINKSKPPVGLC 882
BLAST of SMED30034511 vs. Planmine SMEST
Match: SMESG000007021.1 (SMESG000007021.1) HSP 1 Score: 72.0182 bits (175), Expect = 2.969e-17 Identity = 31/44 (70.45%), Postives = 34/44 (77.27%), Query Frame = 3 Query: 144 CVNFVYQFTRN*CNATHIGRTPRHFCTRILGHCWLKGLANISEH 275 C + VYQFT N CNAT+IG T RH CTR+L HC LKGL NISEH Sbjct: 330 CSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKGLTNISEH 373 HSP 2 Score: 32.3426 bits (72), Expect = 2.969e-17 Identity = 15/20 (75.00%), Postives = 16/20 (80.00%), Query Frame = 2 Query: 89 NLCKVRNMFINKSKPLIVLC 148 N CKVRNMFINKSK + LC Sbjct: 311 NSCKVRNMFINKSKTPVGLC 330
BLAST of SMED30034511 vs. Planmine SMEST
Match: SMESG000029286.1 (SMESG000029286.1) HSP 1 Score: 70.8626 bits (172), Expect = 7.916e-17 Identity = 42/75 (56.00%), Postives = 46/75 (61.33%), Query Frame = 3 Query: 144 CVNFVYQFTRN*CNATHIGRTPRHFCTRILGHCWLKGLANISEHI**N----SHI---*FRQFYSRFNNY*ESVI 347 C + VYQFT N CNAT+IG T RH CTR+L HC LKGL NISEH N S I FR FN+Y E VI Sbjct: 284 CSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKGLTNISEH---NRGCKSDIGMSDFRILLRSFNSYWERVI 355 HSP 2 Score: 32.7278 bits (73), Expect = 7.916e-17 Identity = 15/20 (75.00%), Postives = 16/20 (80.00%), Query Frame = 2 Query: 89 NLCKVRNMFINKSKPLIVLC 148 N CKVRNMFINKSK + LC Sbjct: 265 NSCKVRNMFINKSKTPVGLC 284
BLAST of SMED30034511 vs. Planmine SMEST
Match: SMESG000050479.1 (SMESG000050479.1) HSP 1 Score: 74.7146 bits (182), Expect = 1.364e-16 Identity = 42/75 (56.00%), Postives = 45/75 (60.00%), Query Frame = 3 Query: 144 CVNFVYQFTRN*CNATHIGRTPRHFCTRILGHCWLKGLANISEHI**N----SHI---*FRQFYSRFNNY*ESVI 347 C + VY FT N CNAT+IG T RH CTR+L HC LKGL NISEH N S I FR FNNY E VI Sbjct: 2843 CSDLVYHFTCNGCNATYIGETSRHLCTRVLDHCQLKGLTNISEH---NRGCKSEIGMSDFRILLRSFNNYWERVI 2914 HSP 2 Score: 27.7202 bits (60), Expect = 1.364e-16 Identity = 12/22 (54.55%), Postives = 16/22 (72.73%), Query Frame = 1 Query: 7 EPKFPLIFP*SKGFKYIKRKVS 72 EPK+ L+ P S+GF KRK+S Sbjct: 2790 EPKYVLVLPYSEGFTNYKRKLS 2811
BLAST of SMED30034511 vs. Planmine SMEST
Match: SMESG000050479.1 (SMESG000050479.1) HSP 1 Score: 74.7146 bits (182), Expect = 1.375e-16 Identity = 42/75 (56.00%), Postives = 45/75 (60.00%), Query Frame = 3 Query: 144 CVNFVYQFTRN*CNATHIGRTPRHFCTRILGHCWLKGLANISEHI**N----SHI---*FRQFYSRFNNY*ESVI 347 C + VY FT N CNAT+IG T RH CTR+L HC LKGL NISEH N S I FR FNNY E VI Sbjct: 1886 CSDLVYHFTCNGCNATYIGETSRHLCTRVLDHCQLKGLTNISEH---NRGCKSEIGMSDFRILLRSFNNYWERVI 1957 HSP 2 Score: 27.7202 bits (60), Expect = 1.375e-16 Identity = 12/22 (54.55%), Postives = 16/22 (72.73%), Query Frame = 1 Query: 7 EPKFPLIFP*SKGFKYIKRKVS 72 EPK+ L+ P S+GF KRK+S Sbjct: 1833 EPKYVLVLPYSEGFTNYKRKLS 1854 The following BLAST results are available for this feature:
BLAST of SMED30034511 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30034511 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30034511 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30034511 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30034511 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30034511 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30034511 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30034511 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 0
BLAST of SMED30034511 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30034511 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30034511 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30034511 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30034511 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30034511 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 5
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30034511 ID=SMED30034511|Name=SMED30034511|organism=Schmidtea mediterranea sexual|type=transcript|length=414bpback to top |