Angiotensin-converting enzyme

Overview
NameAngiotensin-converting enzyme
Smed IDSMED30034506
Length (bp)2047
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Angiotensin-converting enzyme (SMED30034506) t-SNE clustered cells

Violin plots show distribution of expression levels for Angiotensin-converting enzyme (SMED30034506) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Angiotensin-converting enzyme (SMED30034506) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Angiotensin-converting enzyme (SMED30034506) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034506

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30034506h1SMcG0014370 dd_Smed_v4_6160_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034506h1SMcG0014370 dd_Smed_v4_6160_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034506h1SMcG0014370 dd_Smed_v4_6160_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30034506h1SMcG0014370 dd_Smed_v6_6160_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034506h1SMcG0014370 dd_Smed_v4_6160_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Angiotensin-converting enzyme vs. Ensembl Human
Match: ACE (angiotensin I converting enzyme [Source:HGNC Symbol;Acc:HGNC:2707])

HSP 1 Score: 418.313 bits (1074), Expect = 4.084e-136
Identity = 204/481 (42.41%), Postives = 292/481 (60.71%), Query Frame = 2
Query:  584 DISYIYNNAKPCF--NKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGK-FDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            D+   Y+ A  C     CL++ E  +  +  T + YE L   W  WR+  G+ I + + + ++L N  +R NG+ DA     S  +E    +    +L+  + PLY  LH YVR  L++ Y  +  +  GPIPAH+ GN+WAQ W+NI+ ++       S +    EA       P  +MF  A++F+ S+G+  +  EFW +SML KP D + V CH SA DF NG DFRIK CT  N+ D    HHEMGHI+Y+M Y  LP   R  AN GFHEAIGD +AL+V TP+HLH + L+S    S   DI++LM  AL+K+AF+PF+  +D + W +++GS+     N+ WW LR +YQGL PPV RT+ DFDPG+K+HI   V YIRYFVSF+IQFQF+E++C  +G+ GPLH+C+ YQSKEAG +L   +  G S+ W E M+++TG   + + ++L +F PL  WL+  N+     +GW
Sbjct:  172 DMETTYSVATVCHPNGSCLQL-EPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSM-YETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDT--TEAMLKQGWTP-RRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGW 647          
BLAST of Angiotensin-converting enzyme vs. Ensembl Human
Match: AC113554.1 (novel protein)

HSP 1 Score: 417.927 bits (1073), Expect = 7.783e-136
Identity = 201/481 (41.79%), Postives = 292/481 (60.71%), Query Frame = 2
Query:  584 DISYIYNNAKPCF--NKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGK-FDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            D+   Y+ A  C     CL++ E  +  +  T + YE L   W  WR+  G+ I + + + ++L N  +R NG+ DA     S  +E    +    +L+  + PLY  LH YVR  L++ Y  +  +  GPIPAH+ GN+WAQ W+NI+ ++       S +  +    +  +     +MF  A++F+ S+G+  +  EFW +SML KP D + V CH SA DF NG DFRIK CT  N+ D    HHEMGHI+Y+M Y  LP   R  AN GFHEAIGD +AL+V TP+HLH + L+S    S   DI++LM  AL+K+AF+PF+  +D + W +++GS+     N+ WW LR +YQGL PPV RT+ DFDPG+K+HI   V YIRYFVSF+IQFQF+E++C  +G+ GPLH+C+ YQSKEAG +L   +  G S+ W E M+++TG   + + ++L +F PL  WL+  N+     +GW
Sbjct:  172 DMETTYSVATVCHPNGSCLQL-EPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSM-YETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAMLKQGWTP---RRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGW 647          
BLAST of Angiotensin-converting enzyme vs. Ensembl Human
Match: ACE (angiotensin I converting enzyme [Source:HGNC Symbol;Acc:HGNC:2707])

HSP 1 Score: 417.542 bits (1072), Expect = 7.880e-131
Identity = 204/481 (42.41%), Postives = 292/481 (60.71%), Query Frame = 2
Query:  584 DISYIYNNAKPCF--NKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGK-FDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            D+   Y+ A  C     CL++ E  +  +  T + YE L   W  WR+  G+ I + + + ++L N  +R NG+ DA     S  +E    +    +L+  + PLY  LH YVR  L++ Y  +  +  GPIPAH+ GN+WAQ W+NI+ ++       S +    EA       P  +MF  A++F+ S+G+  +  EFW +SML KP D + V CH SA DF NG DFRIK CT  N+ D    HHEMGHI+Y+M Y  LP   R  AN GFHEAIGD +AL+V TP+HLH + L+S    S   DI++LM  AL+K+AF+PF+  +D + W +++GS+     N+ WW LR +YQGL PPV RT+ DFDPG+K+HI   V YIRYFVSF+IQFQF+E++C  +G+ GPLH+C+ YQSKEAG +L   +  G S+ W E M+++TG   + + ++L +F PL  WL+  N+     +GW
Sbjct:  746 DMETTYSVATVCHPNGSCLQL-EPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSM-YETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDT--TEAMLKQGWTP-RRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGW 1221          

HSP 2 Score: 408.683 bits (1049), Expect = 1.771e-127
Identity = 211/514 (41.05%), Postives = 301/514 (58.56%), Query Frame = 2
Query:  494 PELRRKFRLI-TASIRNENESLVHELIHINNDISYIYNNAKPCF-NK---CLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            P+LRR    + T    N   +   +   + +++S IY+ AK C  NK   C  + +  +  +  + + Y  L   W  W N  G  +K L+     L N   +++G  D   Y  S+ +    F+     LY  + PLY  LH +VR  L++ Y  ++ +  GPIPAH+ G++WAQ W NI+ ++     K    N    +T          MF +AEEF+ S+ +  M  EFWE SML KP D + V CH SA DF N  DFRIK CT   M   +T+HHEMGHI+YY+ Y  LP   R  AN GFHEAIGD +AL+V TPEHLHKIGL+ RV +    DI+YL+  ALEK+AFLPF   +D + WG+++G  P S  N  WW LR +YQG+ PPV R E  FD G+K+H+     YIRYFVSF++QFQF+E++C  +GY+GPLH+C+ Y+S +AG KL ++L  G S+ W+E +K + G   + ++ LLK+F P+ +WL+  N++    +GW
Sbjct:  115 PQLRRIIGAVRTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSL-DPDLTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSW-YNSPTFEDDLEHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVPFPDK---PNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPADGREVVCHASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRRGANPGFHEAIGDVLALSVSTPEHLHKIGLLDRVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQFHEALCKEAGYEGPLHQCDIYRSTKAGAKLRKVLQAGSSRPWQEVLKDMVGLDALDAQPLLKYFQPVTQWLQEQNQQNGEVLGW 623          
BLAST of Angiotensin-converting enzyme vs. Ensembl Human
Match: ACE (angiotensin I converting enzyme [Source:HGNC Symbol;Acc:HGNC:2707])

HSP 1 Score: 417.927 bits (1073), Expect = 2.011e-130
Identity = 204/481 (42.41%), Postives = 292/481 (60.71%), Query Frame = 2
Query:  584 DISYIYNNAKPCF--NKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGK-FDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            D+   Y+ A  C     CL++ E  +  +  T + YE L   W  WR+  G+ I + + + ++L N  +R NG+ DA     S  +E    +    +L+  + PLY  LH YVR  L++ Y  +  +  GPIPAH+ GN+WAQ W+NI+ ++       S +    EA       P  +MF  A++F+ S+G+  +  EFW +SML KP D + V CH SA DF NG DFRIK CT  N+ D    HHEMGHI+Y+M Y  LP   R  AN GFHEAIGD +AL+V TP+HLH + L+S    S   DI++LM  AL+K+AF+PF+  +D + W +++GS+     N+ WW LR +YQGL PPV RT+ DFDPG+K+HI   V YIRYFVSF+IQFQF+E++C  +G+ GPLH+C+ YQSKEAG +L   +  G S+ W E M+++TG   + + ++L +F PL  WL+  N+     +GW
Sbjct:  746 DMETTYSVATVCHPNGSCLQL-EPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSM-YETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDT--TEAMLKQGWTP-RRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGW 1221          

HSP 2 Score: 409.068 bits (1050), Expect = 4.449e-127
Identity = 211/514 (41.05%), Postives = 301/514 (58.56%), Query Frame = 2
Query:  494 PELRRKFRLI-TASIRNENESLVHELIHINNDISYIYNNAKPCF-NK---CLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            P+LRR    + T    N   +   +   + +++S IY+ AK C  NK   C  + +  +  +  + + Y  L   W  W N  G  +K L+     L N   +++G  D   Y  S+ +    F+     LY  + PLY  LH +VR  L++ Y  ++ +  GPIPAH+ G++WAQ W NI+ ++     K    N    +T          MF +AEEF+ S+ +  M  EFWE SML KP D + V CH SA DF N  DFRIK CT   M   +T+HHEMGHI+YY+ Y  LP   R  AN GFHEAIGD +AL+V TPEHLHKIGL+ RV +    DI+YL+  ALEK+AFLPF   +D + WG+++G  P S  N  WW LR +YQG+ PPV R E  FD G+K+H+     YIRYFVSF++QFQF+E++C  +GY+GPLH+C+ Y+S +AG KL ++L  G S+ W+E +K + G   + ++ LLK+F P+ +WL+  N++    +GW
Sbjct:  115 PQLRRIIGAVRTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSL-DPDLTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSW-YNSPTFEDDLEHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVPFPDK---PNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPADGREVVCHASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRRGANPGFHEAIGDVLALSVSTPEHLHKIGLLDRVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQFHEALCKEAGYEGPLHQCDIYRSTKAGAKLRKVLQAGSSRPWQEVLKDMVGLDALDAQPLLKYFQPVTQWLQEQNQQNGEVLGW 623          
BLAST of Angiotensin-converting enzyme vs. Ensembl Human
Match: ACE (angiotensin I converting enzyme [Source:HGNC Symbol;Acc:HGNC:2707])

HSP 1 Score: 337.806 bits (865), Expect = 1.319e-105
Identity = 177/481 (36.80%), Postives = 259/481 (53.85%), Query Frame = 2
Query:  584 DISYIYNNAKPCF--NKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGK-FDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            D+   Y+ A  C     CL++ E  +  +  T + YE L   W  WR+  G+ I + + + ++L N  +R NG+ DA     S  +E    +    +L+  + PLY  LH YVR  L++ Y  +  +  GPIPAH+ GN+WAQ W+NI+ ++       S +  +    +  +     +MF  A++F+ S+G+  +  EFW +SML KP D + V CH SA DF NG DFRIK CT  N+ D    HHEMGHI+Y+M Y  LP   R  AN GFHEAIGD +AL+V TP+HLH + L+S    S   DI++LM  AL+K+AF+PF+  +D + W +++GS+     N+ WW LR +YQGL PPV RT+ DFDPG+K+HI   V YIR                                     +KL      G S+ W E M+++TG   + + ++L +F PL  WL+  N+     +GW
Sbjct:  172 DMETTYSVATVCHPNGSCLQL-EPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSM-YETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAMLKQGWTP---RRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIR-----------------------------------TAMKL------GFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGW 606          
BLAST of Angiotensin-converting enzyme vs. Ensembl Celegans
Match: acn-1 (Inactive angiotensin-converting enzyme-related protein [Source:UniProtKB/Swiss-Prot;Acc:Q18581])

HSP 1 Score: 179.874 bits (455), Expect = 3.314e-47
Identity = 124/473 (26.22%), Postives = 220/473 (46.51%), Query Frame = 2
Query:  662 LFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDA-ATYGLSFDFEDD------DFKSTALKLYGAILPLYKELHGYVRYCLNKFY--PGKFDKSGPIPAHIFGNV----WAQQWTNIFPIIRDCGQK---LSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCH-GSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISR----VPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHIS-FGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            +F+ EKD  +L   W ++      K K  +   + + N G++ NG  +  A +  +FD          D      K+Y  I P Y+ LH Y+R  L   Y  P    K GPIPAH+FG++    W+  +    P   +       LSA N Q+  T+        +MF  A  +++S G   +   +W  S+ ++   K + CH  +A D     DFR+K C +    DF   H  +    Y   Y     +FR  A+    +AI +  A     P +L+   L+      + DS    I+ L   +LE    LPF ++ D++ + L++G+VP +++N  WW++R +Y+G+  P      + D      +S       R  +S++++FQ  +++C     +G +       S++   KL E +  G S  W + +++++G  E+ ++ LL++++PL  WL+ TN+   + +GW
Sbjct:  307 IFRNEKDASRLQHLWVSYVTAIA-KSKPSYNNIITISNEGAKLNGFANGGAMWRSAFDMSSKVHKAEFDLNKQIDKIYSTIQPFYQLLHAYMRRQLAGIYSNPVGLSKDGPIPAHLFGSLDGGDWSAHYEQTKPFEEESETPEAMLSAFNTQNYTTK--------KMFVTAYRYFKSAGFPHLPKSYWTSSIFARVWSKDMICHPAAALDMRAPNDFRVKACAQLGEPDFEQAHSLLVQTYYQYLYKDQSLLFREQASPVITDAIANAFAHLSTNPHYLYSQKLVPSEHLDIKDS--VIINKLYKESLESFTKLPFTIAADNWRYELFDGTVPKNKLNDRWWEIRNKYEGVRSPQPYNTSNLDALIHNSVSQVHSPATRTLISYVLKFQILKALCP----EGTILSEGCILSEDTTEKLRETMKLGSSITWLKALEMISGKGELDAQPLLEYYEPLINWLRNTNEIDQVVVGW 764          
BLAST of Angiotensin-converting enzyme vs. Ensembl Celegans
Match: acn-1 (Inactive angiotensin-converting enzyme-related protein [Source:UniProtKB/Swiss-Prot;Acc:Q18581])

HSP 1 Score: 179.874 bits (455), Expect = 3.314e-47
Identity = 124/473 (26.22%), Postives = 220/473 (46.51%), Query Frame = 2
Query:  662 LFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDA-ATYGLSFDFEDD------DFKSTALKLYGAILPLYKELHGYVRYCLNKFY--PGKFDKSGPIPAHIFGNV----WAQQWTNIFPIIRDCGQK---LSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCH-GSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISR----VPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHIS-FGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            +F+ EKD  +L   W ++      K K  +   + + N G++ NG  +  A +  +FD          D      K+Y  I P Y+ LH Y+R  L   Y  P    K GPIPAH+FG++    W+  +    P   +       LSA N Q+  T+        +MF  A  +++S G   +   +W  S+ ++   K + CH  +A D     DFR+K C +    DF   H  +    Y   Y     +FR  A+    +AI +  A     P +L+   L+      + DS    I+ L   +LE    LPF ++ D++ + L++G+VP +++N  WW++R +Y+G+  P      + D      +S       R  +S++++FQ  +++C     +G +       S++   KL E +  G S  W + +++++G  E+ ++ LL++++PL  WL+ TN+   + +GW
Sbjct:  307 IFRNEKDASRLQHLWVSYVTAIA-KSKPSYNNIITISNEGAKLNGFANGGAMWRSAFDMSSKVHKAEFDLNKQIDKIYSTIQPFYQLLHAYMRRQLAGIYSNPVGLSKDGPIPAHLFGSLDGGDWSAHYEQTKPFEEESETPEAMLSAFNTQNYTTK--------KMFVTAYRYFKSAGFPHLPKSYWTSSIFARVWSKDMICHPAAALDMRAPNDFRVKACAQLGEPDFEQAHSLLVQTYYQYLYKDQSLLFREQASPVITDAIANAFAHLSTNPHYLYSQKLVPSEHLDIKDS--VIINKLYKESLESFTKLPFTIAADNWRYELFDGTVPKNKLNDRWWEIRNKYEGVRSPQPYNTSNLDALIHNSVSQVHSPATRTLISYVLKFQILKALCP----EGTILSEGCILSEDTTEKLRETMKLGSSITWLKALEMISGKGELDAQPLLEYYEPLINWLRNTNEIDQVVVGW 764          
BLAST of Angiotensin-converting enzyme vs. Ensembl Fly
Match: Acer (gene:FBgn0016122 transcript:FBtr0079685)

HSP 1 Score: 360.918 bits (925), Expect = 1.318e-115
Identity = 187/519 (36.03%), Postives = 288/519 (55.49%), Query Frame = 2
Query:  527 ASIRNENESL---------VHELIHINNDISYI---YNNAKPCF----NKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFY-PGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGP------LHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            A IR + E L           + + + N IS +   Y  A  C     + C    E  I +     +D  +LA YW  W + +G  +++ F   ++L    S+ NGH   A Y + F +ED DF+      +  +LP Y++LHGYVR+ L + Y P      G IP  + GN+W Q W  +  +     +K   +   +   +  +   V+++F + ++F++S+GM  +   FW  S+L++P D+ V CH SA DF    D RIKMCTE +   F  +HHE+GHI+YY+ Y   P ++RG+ N GFHEA+GD IAL+V + +HL  IGLI      +   I+ L   AL K+ FLPF  ++D Y + ++   +  S+ N  +W +R  + G+ PPV RTE DFDP +KYHI   V Y+RYF + + QFQF++++C  +G   P      L  C+ + SK AG  L + LSKG S++W+E ++  TG TE+   +LL++F+PLY+WLK  N +L +P+GW
Sbjct:  100 ADIRRQAEHLSKLGASALNADDYLALQNAISSMQTNYATATVCSYTNRSDCSLTLEPHIQERLSHSRDPAELAWYWREWHDKSGTPMRQNFAEYVRLTRKASQLNGHRSYADYWVQF-YEDPDFERQLDATFKQLLPFYRQLHGYVRFRLRQHYGPDVMPAEGNIPISLLGNMWGQSWNELLDLFTPYPEKPFVDVKAEMEKQGYT---VQKLFELGDQFFQSLGMRALPPSFWNLSVLTRPDDRHVVCHASAWDFYQDSDVRIKMCTEVDSHYFYVVHHELGHIQYYLQYEQQPAVYRGAPNPGFHEAVGDVIALSVMSAKHLKAIGLIENGRLDEKSRINQLFKQALSKIVFLPFGYAVDKYRYAVFRNELDESQWNCGFWQMRSEFGGVEPPVFRTEKDFDPPAKYHIDADVEYLRYFAAHIFQFQFHKALCRKAGQYAPNNSRLTLDNCDIFGSKAAGRSLSQFLSKGNSRHWKEVLEEFTGETEMDPAALLEYFEPLYQWLKQENSRLGVPLGW 614          
BLAST of Angiotensin-converting enzyme vs. Ensembl Fly
Match: Acer (gene:FBgn0016122 transcript:FBtr0333416)

HSP 1 Score: 360.918 bits (925), Expect = 1.318e-115
Identity = 187/519 (36.03%), Postives = 288/519 (55.49%), Query Frame = 2
Query:  527 ASIRNENESL---------VHELIHINNDISYI---YNNAKPCF----NKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFY-PGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGP------LHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            A IR + E L           + + + N IS +   Y  A  C     + C    E  I +     +D  +LA YW  W + +G  +++ F   ++L    S+ NGH   A Y + F +ED DF+      +  +LP Y++LHGYVR+ L + Y P      G IP  + GN+W Q W  +  +     +K   +   +   +  +   V+++F + ++F++S+GM  +   FW  S+L++P D+ V CH SA DF    D RIKMCTE +   F  +HHE+GHI+YY+ Y   P ++RG+ N GFHEA+GD IAL+V + +HL  IGLI      +   I+ L   AL K+ FLPF  ++D Y + ++   +  S+ N  +W +R  + G+ PPV RTE DFDP +KYHI   V Y+RYF + + QFQF++++C  +G   P      L  C+ + SK AG  L + LSKG S++W+E ++  TG TE+   +LL++F+PLY+WLK  N +L +P+GW
Sbjct:  100 ADIRRQAEHLSKLGASALNADDYLALQNAISSMQTNYATATVCSYTNRSDCSLTLEPHIQERLSHSRDPAELAWYWREWHDKSGTPMRQNFAEYVRLTRKASQLNGHRSYADYWVQF-YEDPDFERQLDATFKQLLPFYRQLHGYVRFRLRQHYGPDVMPAEGNIPISLLGNMWGQSWNELLDLFTPYPEKPFVDVKAEMEKQGYT---VQKLFELGDQFFQSLGMRALPPSFWNLSVLTRPDDRHVVCHASAWDFYQDSDVRIKMCTEVDSHYFYVVHHELGHIQYYLQYEQQPAVYRGAPNPGFHEAVGDVIALSVMSAKHLKAIGLIENGRLDEKSRINQLFKQALSKIVFLPFGYAVDKYRYAVFRNELDESQWNCGFWQMRSEFGGVEPPVFRTEKDFDPPAKYHIDADVEYLRYFAAHIFQFQFHKALCRKAGQYAPNNSRLTLDNCDIFGSKAAGRSLSQFLSKGNSRHWKEVLEEFTGETEMDPAALLEYFEPLYQWLKQENSRLGVPLGW 614          
BLAST of Angiotensin-converting enzyme vs. Ensembl Fly
Match: Ance (gene:FBgn0012037 transcript:FBtr0080553)

HSP 1 Score: 358.221 bits (918), Expect = 1.258e-114
Identity = 207/593 (34.91%), Postives = 327/593 (55.14%), Query Frame = 2
Query:  296 AKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLIT----ASIRNENESLVHELIHINNDISYIYNNAKPC----FNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFY-PGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQK----LSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISG------YKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            AK + + +N+   +  N      + Y ++I  +N + K       +K   ++   + KF W+S++S +L+R+F+ +T    A++  ++ +   EL+   + +   +   K C      KC    +  I ++    +D+E+LA YW  + +  G  ++  F R ++L    ++ N     A   L  ++EDD F+     ++  I PLY+++HGYVR+ L K Y      ++GPIP H+ GN+WAQQW+ I  I+    +K    +SAE       E     P+ +MF + ++F+ S+ + K+  +FW++S++ KP D + + CH SA DF    D RIK CT        T+HHE+GHI+Y++ Y H P ++R  AN GFHEA+GD ++L+V TP+HL KIGL+          I+ L  TAL+K+ FLPFA +MD Y W L+ G V  +  N  +W LR  Y G+ PPV R+E DFD  +KYHIS  V Y+RY VSF+IQFQFY+S C  +G       + PL  C+ Y S  AG     MLS G S+ W + ++   G   +  +++ ++F+PL  WL+  N K N+ IGW
Sbjct:   25 AKEYLENLNKELAKRTNVETEAAWAYGSNITDENEKKKNEISAELAKFMKEVASDTTKFQWRSYQSEDLKRQFKALTKLGYAALPEDDYA---ELLDTLSAMESNFAKVKVCDYKDSTKCDLALDPEIEEVISKSRDHEELAYYWREFYDKAGTAVRSQFERYVELNTKAAKLNNFTSGAEAWLD-EYEDDTFEQQLEDIFADIRPLYQQIHGYVRFRLRKHYGDAVVSETGPIPMHLLGNMWAQQWSEIADIVSPFPEKPLVDVSAE------MEKQGYTPL-KMFQMGDDFFTSMNLTKLPQDFWDKSIIEKPTDGRDLVCHASAWDFYLTDDVRIKQCTRVTQDQLFTVHHELGHIQYFLQYQHQPFVYRTGANPGFHEAVGDVLSLSVSTPKHLEKIGLLKDYVRDDEARINQLFLTALDKIVFLPFAFTMDKYRWSLFRGEVDKANWNCAFWKLRDEYSGIEPPVVRSEKDFDAPAKYHISADVEYLRYLVSFIIQFQFYKSACIKAGQYDPDNVELPLDNCDIYGSAAAGAAFHNMLSMGASKPWPDALEAFNGERIMSGKAIAEYFEPLRVWLEAENIKNNVHIGW 606          
BLAST of Angiotensin-converting enzyme vs. Ensembl Fly
Match: Ance (gene:FBgn0012037 transcript:FBtr0343667)

HSP 1 Score: 358.221 bits (918), Expect = 1.258e-114
Identity = 207/593 (34.91%), Postives = 327/593 (55.14%), Query Frame = 2
Query:  296 AKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLIT----ASIRNENESLVHELIHINNDISYIYNNAKPC----FNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFY-PGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQK----LSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISG------YKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            AK + + +N+   +  N      + Y ++I  +N + K       +K   ++   + KF W+S++S +L+R+F+ +T    A++  ++ +   EL+   + +   +   K C      KC    +  I ++    +D+E+LA YW  + +  G  ++  F R ++L    ++ N     A   L  ++EDD F+     ++  I PLY+++HGYVR+ L K Y      ++GPIP H+ GN+WAQQW+ I  I+    +K    +SAE       E     P+ +MF + ++F+ S+ + K+  +FW++S++ KP D + + CH SA DF    D RIK CT        T+HHE+GHI+Y++ Y H P ++R  AN GFHEA+GD ++L+V TP+HL KIGL+          I+ L  TAL+K+ FLPFA +MD Y W L+ G V  +  N  +W LR  Y G+ PPV R+E DFD  +KYHIS  V Y+RY VSF+IQFQFY+S C  +G       + PL  C+ Y S  AG     MLS G S+ W + ++   G   +  +++ ++F+PL  WL+  N K N+ IGW
Sbjct:   25 AKEYLENLNKELAKRTNVETEAAWAYGSNITDENEKKKNEISAELAKFMKEVASDTTKFQWRSYQSEDLKRQFKALTKLGYAALPEDDYA---ELLDTLSAMESNFAKVKVCDYKDSTKCDLALDPEIEEVISKSRDHEELAYYWREFYDKAGTAVRSQFERYVELNTKAAKLNNFTSGAEAWLD-EYEDDTFEQQLEDIFADIRPLYQQIHGYVRFRLRKHYGDAVVSETGPIPMHLLGNMWAQQWSEIADIVSPFPEKPLVDVSAE------MEKQGYTPL-KMFQMGDDFFTSMNLTKLPQDFWDKSIIEKPTDGRDLVCHASAWDFYLTDDVRIKQCTRVTQDQLFTVHHELGHIQYFLQYQHQPFVYRTGANPGFHEAVGDVLSLSVSTPKHLEKIGLLKDYVRDDEARINQLFLTALDKIVFLPFAFTMDKYRWSLFRGEVDKANWNCAFWKLRDEYSGIEPPVVRSEKDFDAPAKYHISADVEYLRYLVSFIIQFQFYKSACIKAGQYDPDNVELPLDNCDIYGSAAAGAAFHNMLSMGASKPWPDALEAFNGERIMSGKAIAEYFEPLRVWLEAENIKNNVHIGW 606          
BLAST of Angiotensin-converting enzyme vs. Ensembl Fly
Match: Ance (gene:FBgn0012037 transcript:FBtr0080552)

HSP 1 Score: 358.221 bits (918), Expect = 1.258e-114
Identity = 207/593 (34.91%), Postives = 327/593 (55.14%), Query Frame = 2
Query:  296 AKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLIT----ASIRNENESLVHELIHINNDISYIYNNAKPC----FNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFY-PGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQK----LSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISG------YKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            AK + + +N+   +  N      + Y ++I  +N + K       +K   ++   + KF W+S++S +L+R+F+ +T    A++  ++ +   EL+   + +   +   K C      KC    +  I ++    +D+E+LA YW  + +  G  ++  F R ++L    ++ N     A   L  ++EDD F+     ++  I PLY+++HGYVR+ L K Y      ++GPIP H+ GN+WAQQW+ I  I+    +K    +SAE       E     P+ +MF + ++F+ S+ + K+  +FW++S++ KP D + + CH SA DF    D RIK CT        T+HHE+GHI+Y++ Y H P ++R  AN GFHEA+GD ++L+V TP+HL KIGL+          I+ L  TAL+K+ FLPFA +MD Y W L+ G V  +  N  +W LR  Y G+ PPV R+E DFD  +KYHIS  V Y+RY VSF+IQFQFY+S C  +G       + PL  C+ Y S  AG     MLS G S+ W + ++   G   +  +++ ++F+PL  WL+  N K N+ IGW
Sbjct:   25 AKEYLENLNKELAKRTNVETEAAWAYGSNITDENEKKKNEISAELAKFMKEVASDTTKFQWRSYQSEDLKRQFKALTKLGYAALPEDDYA---ELLDTLSAMESNFAKVKVCDYKDSTKCDLALDPEIEEVISKSRDHEELAYYWREFYDKAGTAVRSQFERYVELNTKAAKLNNFTSGAEAWLD-EYEDDTFEQQLEDIFADIRPLYQQIHGYVRFRLRKHYGDAVVSETGPIPMHLLGNMWAQQWSEIADIVSPFPEKPLVDVSAE------MEKQGYTPL-KMFQMGDDFFTSMNLTKLPQDFWDKSIIEKPTDGRDLVCHASAWDFYLTDDVRIKQCTRVTQDQLFTVHHELGHIQYFLQYQHQPFVYRTGANPGFHEAVGDVLSLSVSTPKHLEKIGLLKDYVRDDEARINQLFLTALDKIVFLPFAFTMDKYRWSLFRGEVDKANWNCAFWKLRDEYSGIEPPVVRSEKDFDAPAKYHISADVEYLRYLVSFIIQFQFYKSACIKAGQYDPDNVELPLDNCDIYGSAAAGAAFHNMLSMGASKPWPDALEAFNGERIMSGKAIAEYFEPLRVWLEAENIKNNVHIGW 606          
BLAST of Angiotensin-converting enzyme vs. Ensembl Zebrafish
Match: ace (angiotensin I converting enzyme (peptidyl-dipeptidase A) 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1826])

HSP 1 Score: 432.18 bits (1110), Expect = 6.477e-136
Identity = 233/604 (38.58%), Postives = 343/604 (56.79%), Query Frame = 2
Query:  251 ESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDIN--------KKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLITASIRNENESLVHE-LIHINN---DISYIYNNAKPCFNK--CLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFY-PGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            E YP    +   E  AK + D+ N  +    N +    + Y+TDI         +KNLE+    +  G +         +    K           R+++     E  +L  E L+  NN    +  +Y+ A  C +K  CL + +  + K+    +DY++L   W  WRN +G++I+  + R ++L N  ++ NGH D   +  S  +E   F+     L+  + PLY  +H YVR  L K Y P + +  GPIPAH+ GN+WAQ W+ I  ++         +       +  +    ++MF  ++ F+ S+G+  M  EFW +SML KP D + V CH SA DF N  DFRIK CT   M D  T+HHEMGH++Y++ Y   P  FR  AN GFHEAIGD +AL+V TP+HL  IGL+ +V D+    I++LM+ AL+K+AFLPF   MD + W +++G +  SE NK WW+LR +YQGL PPV RTE DFDPG+K+HI   V YIRYFVSF+IQFQF++ +C+ +G+KGPLH C+ YQSKEAG  L +++  G S+ W E MKI+TG  ++  + L+++F PL +WL+  N+K    +GW
Sbjct:  662 EGYPEDIGKITDEMQAKQFLDEYNSTAEEVWNAYTESSWTYNTDITEAHKDNMLQKNLEMANHTKIYGLEARKYDTSDFQDESVK-----------RILSKLSDLERAALSAEDLVEYNNLLASMETLYSVATVCKDKSNCLPL-DPDLNKIMAESRDYDELLFAWQGWRNASGREIRDSYKRYVELANSAAKSNGHTDNGAFWRSL-YETPTFEQDLEALWKDLEPLYLSVHAYVRRALYKKYGPERINLKGPIPAHLLGNMWAQTWSGIMDLVNPYPDATQVDATPAMIAQGWTP---KRMFEESDRFFTSLGLLPMPPEFWNKSMLEKPTDGREVVCHASAWDFYNRKDFRIKQCTVVTMDDLITVHHEMGHVQYFLQYKDQPISFRDGANPGFHEAIGDVLALSVATPKHLQSIGLLDKVEDNAESTINFLMSIALDKIAFLPFGYLMDQWRWKVFDGRISSSEYNKEWWNLRMKYQGLCPPVPRTEKDFDPGAKFHIPANVPYIRYFVSFVIQFQFHKGLCDAAGHKGPLHNCDIYQSKEAGKLLSDVMKMGFSKPWPEAMKIITGQPKMSVQPLMEYFKPLIEWLEKENEKNGDVLGW 1249          

HSP 2 Score: 402.134 bits (1032), Expect = 1.113e-124
Identity = 198/492 (40.24%), Postives = 290/492 (58.94%), Query Frame = 2
Query:  575 INNDISYIYNNAKPCFN--KCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFY-PGKFDKSGPIPAHIFGNVWAQQWTNIFPII--------RDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            I + +  IY+ AK C +  +C  + E  + ++  T + Y++L   W  W N +G  +K L+   +++ N  S+ +G +D   Y  S+ +E   FK     L+  + PLY+ LH +VR  L  +Y P   +  GPIPAH+ GN+W+Q W NI+ ++         D    + A+ Y               MF +AEEF+ S+G+ +M  EFW++SML KP D + V CH SA DF N  DFRIK CT   M    T+HHEMGH+EYY+ Y   P  FR  AN GFHEAIGD ++L+V TP+HLH I L+ ++ D    DI+YL+  ALEK+AFLPF   +D + W +++G  P    N  WW LR +YQG+ PP +RTE+ FD G KYHI     YIRYFVSF++QFQF+E +C  +G+ GPLH+C+ Y+S+EAG  L ++L  G S+ W + ++   G  ++ +  L+ +F P+  WL+  N+K    +GW
Sbjct:  173 ILSQMDSIYSTAKVCPSPEECWSL-EPELQEIMATSRSYKRLLYAWEGWHNSSGVPLKSLYAEFVKISNKASQMDGFKDTGEYWRSW-YESPTFKQDLENLFKQLEPLYQNLHAFVRRKLYDYYGPKYINLKGPIPAHLLGNMWSQTWNNIYNMMIPFPNRPNVDVTNTMIAKGYN-----------ATHMFRVAEEFFTSLGLLEMPPEFWDKSMLEKPTDGREVVCHASAWDFYNRKDFRIKQCTTVTMEQLFTVHHEMGHVEYYLQYKDQPVSFRRGANPGFHEAIGDVLSLSVSTPKHLHSIDLLDQLTDDAESDINYLLKMALEKIAFLPFGYLIDQWRWSVFSGETPPDRYNADWWYLRTKYQGICPPTRRTEEHFDAGGKYHIPGNTPYIRYFVSFILQFQFHEKLCKEAGHTGPLHKCDIYKSREAGAVLEKVLKAGSSEPWTQVLQEALGTDKMDATPLMSYFLPVTTWLREQNEKTGETLGW 651          
BLAST of Angiotensin-converting enzyme vs. Ensembl Zebrafish
Match: ace2 (angiotensin I converting enzyme 2 [Source:ZFIN;Acc:ZDB-GENE-041114-6])

HSP 1 Score: 354.755 bits (909), Expect = 2.261e-111
Identity = 185/504 (36.71%), Postives = 276/504 (54.76%), Query Frame = 2
Query:  563 ELIHINNDISYIYNNAKPCF----NKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATY---------GLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQ------MFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLI-SRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            EL +I +++S IYN A  C       C +  E G+  +    +DY++    W  WR  TG K++ L+ + + L+N  ++ N +ED   Y            + +  D     A ++Y  ILPLYKELH YVR  L   YPG       +PAH+ G++W + WTN++P++           Y D    ++S   VEQ      +F  AE+F+ S+ M  M D FW  SM  KP+++ V CH +A D  N  DFRIKMCT+ NM DF T+HHEMGH +Y MAY + P + R  AN GFHEA+G+ ++L+  TP HL  +GL+ S        DI++L+  AL  V  LPF   ++ + W ++   +P  E  + WW ++    G+   V R E   DP + +H+S   S+IRYF   + QFQF E++C  +G+ GPL++C+   S +AG KL  ML  G+S +W   ++ + G T++ S+ LL +F  L +WLK  N+K N   GW
Sbjct:  114 ELRNIMSEMSTIYNTATVCKIDDPTDC-QTLEPGLESIMAESRDYDERLHVWEGWRVATGMKMRPLYEKYVDLKNEAAKLNNYEDHGDYWRGDYETIDDPKYSYSRDQVIEDARRIYKEILPLYKELHAYVRAKLQDVYPGHIGSDACLPAHLLGDMWGRFWTNLYPLMIP---------YPDRPDIDVSSAMVEQGWDEIRLFKEAEKFFMSVNMPAMFDNFWNNSMFIKPEERDVVCHPTAWDMGNRKDFRIKMCTKVNMDDFLTVHHEMGHNQYQMAYRNHPYLLRDGANEGFHEAVGEIMSLSAATPSHLQSLGLLPSDFKQDYETDINFLLKQALTIVGTLPFTYMLEEWRWQVFKAKIPKDEWMQQWWQMKRELVGVAEAVPRDETYCDPPALFHVSGDYSFIRYFTRTIYQFQFQEALCKAAGHTGPLYKCDITNSTKAGDKLRHMLELGRSMSWTRALEEVAGTTKMDSQPLLHYFSTLMEWLKEENQKNNRVPGW 607          
BLAST of Angiotensin-converting enzyme vs. Ensembl Zebrafish
Match: ace2 (angiotensin I converting enzyme 2 [Source:ZFIN;Acc:ZDB-GENE-041114-6])

HSP 1 Score: 354.369 bits (908), Expect = 6.899e-111
Identity = 185/504 (36.71%), Postives = 276/504 (54.76%), Query Frame = 2
Query:  563 ELIHINNDISYIYNNAKPC----FNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATY---------GLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQ------MFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLI-SRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            EL +I +++S IYN A  C       C +  E G+  +    +DY++    W  WR  TG K++ L+ + + L+N  ++ N +ED   Y            + +  D     A ++Y  ILPLYKELH YVR  L   YPG       +PAH+ G++W + WTN++P++           Y D    ++S   VEQ      +F  AE+F+ S+ M  M D FW  SM  KP+++ V CH +A D  N  DFRIKMCT+ NM DF T+HHEMGH +Y MAY + P + R  AN GFHEA+G+ ++L+  TP HL  +GL+ S        DI++L+  AL  V  LPF   ++ + W ++   +P  E  + WW ++    G+   V R E   DP + +H+S   S+IRYF   + QFQF E++C  +G+ GPL++C+   S +AG KL  ML  G+S +W   ++ + G T++ S+ LL +F  L +WLK  N+K N   GW
Sbjct:  114 ELRNIMSEMSTIYNTATVCKIDDPTDC-QTLEPGLESIMAESRDYDERLHVWEGWRVATGMKMRPLYEKYVDLKNEAAKLNNYEDHGDYWRGDYETIDDPKYSYSRDQVIEDARRIYKEILPLYKELHAYVRAKLQDVYPGHIGSDACLPAHLLGDMWGRFWTNLYPLMIP---------YPDRPDIDVSSAMVEQGWDEIRLFKEAEKFFMSVNMPAMFDNFWNNSMFIKPEERDVVCHPTAWDMGNRKDFRIKMCTKVNMDDFLTVHHEMGHNQYQMAYRNHPYLLRDGANEGFHEAVGEIMSLSAATPSHLQSLGLLPSDFKQDYETDINFLLKQALTIVGTLPFTYMLEEWRWQVFKAKIPKDEWMQQWWQMKRELVGVAEAVPRDETYCDPPALFHVSGDYSFIRYFTRTIYQFQFQEALCKAAGHTGPLYKCDITNSTKAGDKLRHMLELGRSMSWTRALEEVAGTTKMDSQPLLHYFSTLMEWLKEENQKNNRVPGW 607          
BLAST of Angiotensin-converting enzyme vs. Ensembl Xenopus
Match: ace (angiotensin I converting enzyme [Source:NCBI gene;Acc:100144634])

HSP 1 Score: 447.203 bits (1149), Expect = 7.242e-149
Identity = 220/514 (42.80%), Postives = 320/514 (62.26%), Query Frame = 2
Query:  494 PELRRKFRLIT----ASIRNENESLVHELIHINNDISYIYNNAKPC--FNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGK-FDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            PE +R  R ++    A++  E +    E   I +D+  IY+ AK C   N      +  + ++    +DY++L   W  WR+ +G++I++ + R +QL N  ++ NG+ D   Y  S+ +E    +S   KLY  + PLY  LH YVR  L K Y  K  +  GPIPAH+ GN+WAQ W+NI+ ++            Q +AT  +     ++MF  ++ F++S+G+  M  EFW++SM+ KP+D+ V CH SA DF N  DFRIK CT  NM D  T+HHEMGH++Y++ Y   P +FR  AN GFHEAIGD +AL+V TP+HL  IGL+ +V D+   DI+YLM+ AL+K+AFLPF   MD + W +++G  P SE N+ WW+LR +YQGL+PPV RTE+DFDPG+K+HI   V YIRYF+SF+IQFQF+E++C  +  +GPLH+C+ YQS +AG  L + +  G S+ W E M+ +TG   + + +LLK+F PL  WL   N K    +GW
Sbjct:   23 PETQRILRKLSEIDKAALSEEEQK---EYNQITSDMETIYSVAKVCKDGNTNCHPLDPDLTEILAKSRDYDELLFAWKGWRDASGKQIREKYKRYVQLANKAAQLNGYNDNGAYWRSW-YETPTLESDVEKLYDELQPLYLNLHAYVRRALYKKYGDKRINLKGPIPAHLLGNMWAQSWSNIYELLVPYPNAA-----QVDATPAMINWTPKRMFEESDNFFKSLGLLPMPQEFWDKSMIEKPKDREVVCHASAWDFYNRKDFRIKQCTVVNMDDLITVHHEMGHVQYFLQYKDQPILFREGANPGFHEAIGDVLALSVSTPKHLQSIGLLDKVEDNPESDINYLMSIALDKIAFLPFGFLMDQWRWKVFDGRTPDSEYNQQWWNLRLKYQGLVPPVLRTENDFDPGAKFHIPASVPYIRYFISFVIQFQFHEALCKAANQEGPLHKCDIYQSTQAGKLLGDAMKLGNSKPWPEAMQTITGQRNMSAHALLKYFQPLTDWLIKENTKNGETLGW 527          
BLAST of Angiotensin-converting enzyme vs. Ensembl Xenopus
Match: ace (angiotensin I converting enzyme [Source:NCBI gene;Acc:100144634])

HSP 1 Score: 451.055 bits (1159), Expect = 3.382e-143
Identity = 234/595 (39.33%), Postives = 355/595 (59.66%), Query Frame = 2
Query:  251 ESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLIT----ASIRNENESLVHELIHINNDISYIYNNAKPC--FNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGK-FDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            + YP   ++ A+EK A  +     + +    N +    + Y+T+I + N +L K      S   L+   +++ + +  F+ PE +R  R ++    A++  E +    E   I +D+  IY+ AK C   N      +  + ++    +DY++L   W  WR+ +G++I++ + R +QL N  ++ NG+ D   Y  S+ +E    +S   KLY  + PLY  LH YVR  L K Y  K  +  GPIPAH+ GN+WAQ W+NI+ ++         +       +N +    ++MF  ++ F++S+G+  M  EFW++SM+ KP+D+ V CH SA DF N  DFRIK CT  NM D  T+HHEMGH++Y++ Y   P +FR  AN GFHEAIGD +AL+V TP+HL  IGL+ +V D+   DI+YLM+ AL+K+AFLPF   MD + W +++G  P SE N+ WW+LR +YQGL+PPV RTE+DFDPG+K+HI   V YIRYF+SF+IQFQF+E++C  +  +GPLH+C+ YQS +AG  L + +  G S+ W E M+ +TG   + + +LLK+F PL  WL   N K    +GW
Sbjct:  605 DGYPGDIEKIANEKEADTFLSDYTKSAEVVWNDYTEASWAYNTNITEANKQLDKNL--AMSGHTLQYGLQARNYDYSDFQDPETQRILRKLSEIDKAALSEEEQK---EYNQITSDMETIYSVAKVCKDGNTNCHPLDPDLTEILAKSRDYDELLFAWKGWRDASGKQIREKYKRYVQLANKAAQLNGYNDNGAYWRSW-YETPTLESDVEKLYDELQPLYLNLHAYVRRALYKKYGDKRINLKGPIPAHLLGNMWAQSWSNIYELLVPYPNAAQVDATPAMIAKNWTP---KRMFEESDNFFKSLGLLPMPQEFWDKSMIEKPKDREVVCHASAWDFYNRKDFRIKQCTVVNMDDLITVHHEMGHVQYFLQYKDQPILFREGANPGFHEAIGDVLALSVSTPKHLQSIGLLDKVEDNPESDINYLMSIALDKIAFLPFGFLMDQWRWKVFDGRTPDSEYNQQWWNLRLKYQGLVPPVLRTENDFDPGAKFHIPASVPYIRYFISFVIQFQFHEALCKAANQEGPLHKCDIYQSTQAGKLLGDAMKLGNSKPWPEAMQTITGQRNMSAHALLKYFQPLTDWLIKENTKNGETLGW 1190          

HSP 2 Score: 414.075 bits (1063), Expect = 2.048e-129
Identity = 214/514 (41.63%), Postives = 308/514 (59.92%), Query Frame = 2
Query:  512 FRLITASIR-----NENESLVHELIHINNDISYIYNNAKPC----FNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQK--LSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
             + I +SIR     N N +   E   I +++  IY+ AK C      KC  + E  I ++  T + Y+KL   W  W N  G  +K+ +LR +QL N   R +G++D   Y  S+ +    F+     LY  + PLY  LH +VR  L + Y  K+ +  GPIPAH+FGN+W+QQW NI+ ++     K  +   N   E   N +      MF ++EEF+ S+G+ +M  EFWE+SML KP D + V CH SA DF N  DFRIK CT   M    T+HHEMGH+EYY+ Y   P  +R  AN GFHEAIGD ++L+V TP HL  IGL+  V + K  DI+YL+  ALEK+AFLPF   +D + W +++G  P +  N  WW+LR +YQG+ PP+ R ++ FD G+KYHI     YIRYFVSF++QFQF++++C  + + GPLH C+ Y+S+EAG  L ++L  G S++W+E +K +TG+ ++    LL++F P+ +WL   N K N  +GW
Sbjct:   88 LKKIISSIRTLGASNLNLTAREEYNTILSEMDSIYSTAKVCPPNATAKCWSL-EPEITEIMATSRSYKKLLYAWEGWHNSAGIPLKEKYLRFVQLSNEAYRMDGYKDTGAYWRSW-YASPTFEEDLDGLYQQLEPLYLNLHAFVRRKLYERYGAKYINLKGPIPAHLFGNMWSQQWNNIYDMMIPFPDKTNIDVTNTMREKGWNAT-----HMFRVSEEFFTSLGLLEMPPEFWEKSMLEKPADGREVVCHASAWDFYNRKDFRIKQCTTVTMEQLFTVHHEMGHVEYYLQYKDQPVTYRRGANPGFHEAIGDVLSLSVSTPGHLKTIGLLDTVTNDKESDINYLLKMALEKIAFLPFGFLIDQWRWNVFSGRTPPTRYNYDWWNLRTKYQGICPPISRDDNQFDAGAKYHIPGNTPYIRYFVSFVLQFQFHKALCTAAKHTGPLHTCDIYRSQEAGKILGDVLRSGSSKSWQEVLKDMTGSEKMDVGPLLEYFTPVTQWLIEQNTKNNEILGW 594          
BLAST of Angiotensin-converting enzyme vs. Ensembl Xenopus
Match: ace (angiotensin I converting enzyme [Source:NCBI gene;Acc:100144634])

HSP 1 Score: 451.055 bits (1159), Expect = 4.227e-143
Identity = 234/595 (39.33%), Postives = 355/595 (59.66%), Query Frame = 2
Query:  251 ESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLIT----ASIRNENESLVHELIHINNDISYIYNNAKPC--FNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGK-FDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            + YP   ++ A+EK A  +     + +    N +    + Y+T+I + N ++        S   L+   +++ + +  F+ PE +R  R ++    A++  E +    E   I +D+  IY+ AK C   N      +  + ++    +DY++L   W  WR+ +G++I++ + R +QL N  ++ NG+ D   Y  S+ +E    +S   KLY  + PLY  LH YVR  L K Y  K  +  GPIPAH+ GN+WAQ W+NI+ ++            Q +AT  +     ++MF  ++ F++S+G+  M  EFW++SM+ KP+D+ V CH SA DF N  DFRIK CT  NM D  T+HHEMGH++Y++ Y   P +FR  AN GFHEAIGD +AL+V TP+HL  IGL+ +V D+   DI+YLM+ AL+K+AFLPF   MD + W +++G  P SE N+ WW+LR +YQGL+PPV RTE+DFDPG+K+HI   V YIRYF+SF+IQFQF+E++C  +  +GPLH+C+ YQS +AG  L + +  G S+ W E M+ +TG   + + +LLK+F PL  WL   N K    +GW
Sbjct:  628 DGYPGDIEKIANEKEADTFLSDYTKSAEVVWNDYTEASWAYNTNITEANKQVMLDKNLAMSGHTLQYGLQARNYDYSDFQDPETQRILRKLSEIDKAALSEEEQK---EYNQITSDMETIYSVAKVCKDGNTNCHPLDPDLTEILAKSRDYDELLFAWKGWRDASGKQIREKYKRYVQLANKAAQLNGYNDNGAYWRSW-YETPTLESDVEKLYDELQPLYLNLHAYVRRALYKKYGDKRINLKGPIPAHLLGNMWAQSWSNIYELLVPYPNAA-----QVDATPAMINWTPKRMFEESDNFFKSLGLLPMPQEFWDKSMIEKPKDREVVCHASAWDFYNRKDFRIKQCTVVNMDDLITVHHEMGHVQYFLQYKDQPILFREGANPGFHEAIGDVLALSVSTPKHLQSIGLLDKVEDNPESDINYLMSIALDKIAFLPFGFLMDQWRWKVFDGRTPDSEYNQQWWNLRLKYQGLVPPVLRTENDFDPGAKFHIPASVPYIRYFISFVIQFQFHEALCKAANQEGPLHKCDIYQSTQAGKLLGDAMKLGNSKPWPEAMQTITGQRNMSAHALLKYFQPLTDWLIKENTKNGETLGW 1213          

HSP 2 Score: 414.075 bits (1063), Expect = 3.228e-129
Identity = 214/514 (41.63%), Postives = 308/514 (59.92%), Query Frame = 2
Query:  512 FRLITASIR-----NENESLVHELIHINNDISYIYNNAKPC----FNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQK--LSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
             + I +SIR     N N +   E   I +++  IY+ AK C      KC  + E  I ++  T + Y+KL   W  W N  G  +K+ +LR +QL N   R +G++D   Y  S+ +    F+     LY  + PLY  LH +VR  L + Y  K+ +  GPIPAH+FGN+W+QQW NI+ ++     K  +   N   E   N +      MF ++EEF+ S+G+ +M  EFWE+SML KP D + V CH SA DF N  DFRIK CT   M    T+HHEMGH+EYY+ Y   P  +R  AN GFHEAIGD ++L+V TP HL  IGL+  V + K  DI+YL+  ALEK+AFLPF   +D + W +++G  P +  N  WW+LR +YQG+ PP+ R ++ FD G+KYHI     YIRYFVSF++QFQF++++C  + + GPLH C+ Y+S+EAG  L ++L  G S++W+E +K +TG+ ++    LL++F P+ +WL   N K N  +GW
Sbjct:  111 LKKIISSIRTLGASNLNLTAREEYNTILSEMDSIYSTAKVCPPNATAKCWSL-EPEITEIMATSRSYKKLLYAWEGWHNSAGIPLKEKYLRFVQLSNEAYRMDGYKDTGAYWRSW-YASPTFEEDLDGLYQQLEPLYLNLHAFVRRKLYERYGAKYINLKGPIPAHLFGNMWSQQWNNIYDMMIPFPDKTNIDVTNTMREKGWNAT-----HMFRVSEEFFTSLGLLEMPPEFWEKSMLEKPADGREVVCHASAWDFYNRKDFRIKQCTTVTMEQLFTVHHEMGHVEYYLQYKDQPVTYRRGANPGFHEAIGDVLSLSVSTPGHLKTIGLLDTVTNDKESDINYLLKMALEKIAFLPFGFLIDQWRWNVFSGRTPPTRYNYDWWNLRTKYQGICPPISRDDNQFDAGAKYHIPGNTPYIRYFVSFVLQFQFHKALCTAAKHTGPLHTCDIYRSQEAGKILGDVLRSGSSKSWQEVLKDMTGSEKMDVGPLLEYFTPVTQWLIEQNTKNNEILGW 617          
BLAST of Angiotensin-converting enzyme vs. Ensembl Xenopus
Match: ace (angiotensin I converting enzyme [Source:NCBI gene;Acc:100144634])

HSP 1 Score: 451.055 bits (1159), Expect = 4.698e-143
Identity = 234/595 (39.33%), Postives = 355/595 (59.66%), Query Frame = 2
Query:  251 ESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLIT----ASIRNENESLVHELIHINNDISYIYNNAKPC--FNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGK-FDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            + YP   ++ A+EK A  +     + +    N +    + Y+T+I + N +L K      S   L+   +++ + +  F+ PE +R  R ++    A++  E +    E   I +D+  IY+ AK C   N      +  + ++    +DY++L   W  WR+ +G++I++ + R +QL N  ++ NG+ D   Y  S+ +E    +S   KLY  + PLY  LH YVR  L K Y  K  +  GPIPAH+ GN+WAQ W+NI+ ++         +       +N +    ++MF  ++ F++S+G+  M  EFW++SM+ KP+D+ V CH SA DF N  DFRIK CT  NM D  T+HHEMGH++Y++ Y   P +FR  AN GFHEAIGD +AL+V TP+HL  IGL+ +V D+   DI+YLM+ AL+K+AFLPF   MD + W +++G  P SE N+ WW+LR +YQGL+PPV RTE+DFDPG+K+HI   V YIRYF+SF+IQFQF+E++C  +  +GPLH+C+ YQS +AG  L + +  G S+ W E M+ +TG   + + +LLK+F PL  WL   N K    +GW
Sbjct:  623 DGYPGDIEKIANEKEADTFLSDYTKSAEVVWNDYTEASWAYNTNITEANKQLDKNL--AMSGHTLQYGLQARNYDYSDFQDPETQRILRKLSEIDKAALSEEEQK---EYNQITSDMETIYSVAKVCKDGNTNCHPLDPDLTEILAKSRDYDELLFAWKGWRDASGKQIREKYKRYVQLANKAAQLNGYNDNGAYWRSW-YETPTLESDVEKLYDELQPLYLNLHAYVRRALYKKYGDKRINLKGPIPAHLLGNMWAQSWSNIYELLVPYPNAAQVDATPAMIAKNWTP---KRMFEESDNFFKSLGLLPMPQEFWDKSMIEKPKDREVVCHASAWDFYNRKDFRIKQCTVVNMDDLITVHHEMGHVQYFLQYKDQPILFREGANPGFHEAIGDVLALSVSTPKHLQSIGLLDKVEDNPESDINYLMSIALDKIAFLPFGFLMDQWRWKVFDGRTPDSEYNQQWWNLRLKYQGLVPPVLRTENDFDPGAKFHIPASVPYIRYFISFVIQFQFHEALCKAANQEGPLHKCDIYQSTQAGKLLGDAMKLGNSKPWPEAMQTITGQRNMSAHALLKYFQPLTDWLIKENTKNGETLGW 1208          

HSP 2 Score: 414.461 bits (1064), Expect = 2.681e-129
Identity = 214/514 (41.63%), Postives = 308/514 (59.92%), Query Frame = 2
Query:  512 FRLITASIR-----NENESLVHELIHINNDISYIYNNAKPC----FNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQK--LSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
             + I +SIR     N N +   E   I +++  IY+ AK C      KC  + E  I ++  T + Y+KL   W  W N  G  +K+ +LR +QL N   R +G++D   Y  S+ +    F+     LY  + PLY  LH +VR  L + Y  K+ +  GPIPAH+FGN+W+QQW NI+ ++     K  +   N   E   N +      MF ++EEF+ S+G+ +M  EFWE+SML KP D + V CH SA DF N  DFRIK CT   M    T+HHEMGH+EYY+ Y   P  +R  AN GFHEAIGD ++L+V TP HL  IGL+  V + K  DI+YL+  ALEK+AFLPF   +D + W +++G  P +  N  WW+LR +YQG+ PP+ R ++ FD G+KYHI     YIRYFVSF++QFQF++++C  + + GPLH C+ Y+S+EAG  L ++L  G S++W+E +K +TG+ ++    LL++F P+ +WL   N K N  +GW
Sbjct:  106 LKKIISSIRTLGASNLNLTAREEYNTILSEMDSIYSTAKVCPPNATAKCWSL-EPEITEIMATSRSYKKLLYAWEGWHNSAGIPLKEKYLRFVQLSNEAYRMDGYKDTGAYWRSW-YASPTFEEDLDGLYQQLEPLYLNLHAFVRRKLYERYGAKYINLKGPIPAHLFGNMWSQQWNNIYDMMIPFPDKTNIDVTNTMREKGWNAT-----HMFRVSEEFFTSLGLLEMPPEFWEKSMLEKPADGREVVCHASAWDFYNRKDFRIKQCTTVTMEQLFTVHHEMGHVEYYLQYKDQPVTYRRGANPGFHEAIGDVLSLSVSTPGHLKTIGLLDTVTNDKESDINYLLKMALEKIAFLPFGFLIDQWRWNVFSGRTPPTRYNYDWWNLRTKYQGICPPISRDDNQFDAGAKYHIPGNTPYIRYFVSFVLQFQFHKALCTAAKHTGPLHTCDIYRSQEAGKILGDVLRSGSSKSWQEVLKDMTGSEKMDVGPLLEYFTPVTQWLIEQNTKNNEILGW 612          
BLAST of Angiotensin-converting enzyme vs. Ensembl Xenopus
Match: ace (angiotensin I converting enzyme [Source:NCBI gene;Acc:100144634])

HSP 1 Score: 450.284 bits (1157), Expect = 7.414e-143
Identity = 234/595 (39.33%), Postives = 355/595 (59.66%), Query Frame = 2
Query:  251 ESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLIT----ASIRNENESLVHELIHINNDISYIYNNAKPC--FNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGK-FDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            + YP   ++ A+EK A  +     + +    N +    + Y+T+I + N +L K      S   L+   +++ + +  F+ PE +R  R ++    A++  E +    E   I +D+  IY+ AK C   N      +  + ++    +DY++L   W  WR+ +G++I++ + R +QL N  ++ NG+ D   Y  S+ +E    +S   KLY  + PLY  LH YVR  L K Y  K  +  GPIPAH+ GN+WAQ W+NI+ ++         +       +N +    ++MF  ++ F++S+G+  M  EFW++SM+ KP+D+ V CH SA DF N  DFRIK CT  NM D  T+HHEMGH++Y++ Y   P +FR  AN GFHEAIGD +AL+V TP+HL  IGL+ +V D+   DI+YLM+ AL+K+AFLPF   MD + W +++G  P SE N+ WW+LR +YQGL+PPV RTE+DFDPG+K+HI   V YIRYF+SF+IQFQF+E++C  +  +GPLH+C+ YQS +AG  L + +  G S+ W E M+ +TG   + + +LLK+F PL  WL   N K    +GW
Sbjct:  630 DGYPGDIEKIANEKEADTFLSDYTKSAEVVWNDYTEASWAYNTNITEANKQLDKNL--AMSGHTLQYGLQARNYDYSDFQDPETQRILRKLSEIDKAALSEEEQK---EYNQITSDMETIYSVAKVCKDGNTNCHPLDPDLTEILAKSRDYDELLFAWKGWRDASGKQIREKYKRYVQLANKAAQLNGYNDNGAYWRSW-YETPTLESDVEKLYDELQPLYLNLHAYVRRALYKKYGDKRINLKGPIPAHLLGNMWAQSWSNIYELLVPYPNAAQVDATPAMIAKNWTP---KRMFEESDNFFKSLGLLPMPQEFWDKSMIEKPKDREVVCHASAWDFYNRKDFRIKQCTVVNMDDLITVHHEMGHVQYFLQYKDQPILFREGANPGFHEAIGDVLALSVSTPKHLQSIGLLDKVEDNPESDINYLMSIALDKIAFLPFGFLMDQWRWKVFDGRTPDSEYNQQWWNLRLKYQGLVPPVLRTENDFDPGAKFHIPASVPYIRYFISFVIQFQFHEALCKAANQEGPLHKCDIYQSTQAGKLLGDAMKLGNSKPWPEAMQTITGQRNMSAHALLKYFQPLTDWLIKENTKNGETLGW 1215          

HSP 2 Score: 413.69 bits (1062), Expect = 4.025e-129
Identity = 214/514 (41.63%), Postives = 308/514 (59.92%), Query Frame = 2
Query:  512 FRLITASIR-----NENESLVHELIHINNDISYIYNNAKPC----FNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQK--LSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
             + I +SIR     N N +   E   I +++  IY+ AK C      KC  + E  I ++  T + Y+KL   W  W N  G  +K+ +LR +QL N   R +G++D   Y  S+ +    F+     LY  + PLY  LH +VR  L + Y  K+ +  GPIPAH+FGN+W+QQW NI+ ++     K  +   N   E   N +      MF ++EEF+ S+G+ +M  EFWE+SML KP D + V CH SA DF N  DFRIK CT   M    T+HHEMGH+EYY+ Y   P  +R  AN GFHEAIGD ++L+V TP HL  IGL+  V + K  DI+YL+  ALEK+AFLPF   +D + W +++G  P +  N  WW+LR +YQG+ PP+ R ++ FD G+KYHI     YIRYFVSF++QFQF++++C  + + GPLH C+ Y+S+EAG  L ++L  G S++W+E +K +TG+ ++    LL++F P+ +WL   N K N  +GW
Sbjct:  113 LKKIISSIRTLGASNLNLTAREEYNTILSEMDSIYSTAKVCPPNATAKCWSL-EPEITEIMATSRSYKKLLYAWEGWHNSAGIPLKEKYLRFVQLSNEAYRMDGYKDTGAYWRSW-YASPTFEEDLDGLYQQLEPLYLNLHAFVRRKLYERYGAKYINLKGPIPAHLFGNMWSQQWNNIYDMMIPFPDKTNIDVTNTMREKGWNAT-----HMFRVSEEFFTSLGLLEMPPEFWEKSMLEKPADGREVVCHASAWDFYNRKDFRIKQCTTVTMEQLFTVHHEMGHVEYYLQYKDQPVTYRRGANPGFHEAIGDVLSLSVSTPGHLKTIGLLDTVTNDKESDINYLLKMALEKIAFLPFGFLIDQWRWNVFSGRTPPTRYNYDWWNLRTKYQGICPPISRDDNQFDAGAKYHIPGNTPYIRYFVSFVLQFQFHKALCTAAKHTGPLHTCDIYRSQEAGKILGDVLRSGSSKSWQEVLKDMTGSEKMDVGPLLEYFTPVTQWLIEQNTKNNEILGW 619          
BLAST of Angiotensin-converting enzyme vs. Ensembl Mouse
Match: Ace (angiotensin I converting enzyme (peptidyl-dipeptidase A) 1 [Source:MGI Symbol;Acc:MGI:87874])

HSP 1 Score: 418.313 bits (1074), Expect = 2.602e-136
Identity = 204/483 (42.24%), Postives = 300/483 (62.11%), Query Frame = 2
Query:  584 DISYIYNNAKPCFNK--CLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKM--PVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            D+   Y+ +  C+    C+ + E  +  +  T + YE+L   W +WR+  G+ I   F + ++  N  ++ NG+ DA     S  +E D+ +    KLY  + PLY  LH YVR  L++ Y  ++ +  GPIPAH+ GN+WAQ W+NI+ ++       SA N   +ATE + K      ++F  A+ F+ S+G+  +  EFW +SML KP D + V CH SA DF NG DFRIK CT  NM D    HHEMGHI+Y+M Y  LP  FR  AN GFHEAIGD +AL+V TP+HL+ + L+S       +DI++LM  AL+K+AF+PF+  +D + W +++GS+     N+ WW LR +YQGL PPV R++ DFDPGSK+H+   V Y+RYFVSF+IQFQF+E++C  +G+ GPLH+C+ YQSKEAG  L + +  G S+ W E MK++TG   + + +++ +F PL +WL   N++    +GW
Sbjct:  171 DMETTYSLSNICYTNGTCMPL-EPDLTNMMATSRKYEELLWAWKSWRDKVGRAILPFFPKYVEFSNKIAKLNGYTDAGDSWRSL-YESDNLEQDLEKLYQELQPLYLNLHAYVRRSLHRHYGSEYINLDGPIPAHLLGNMWAQTWSNIYDLVAPFP---SAPNI--DATEAMIKQGWTPRRIFKEADNFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHPSAWDFYNGKDFRIKQCTSVNMEDLVIAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGDIMALSVSTPKHLYSLNLLSTEGSGYEYDINFLMKMALDKIAFIPFSYLIDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRSQGDFDPGSKFHVPANVPYVRYFVSFIIQFQFHEALCRAAGHTGPLHKCDIYQSKEAGKLLADAMKLGYSKPWPEAMKLITGQPNMSASAMMNYFKPLTEWLVTENRRHGETLGW 646          
BLAST of Angiotensin-converting enzyme vs. Ensembl Mouse
Match: Ace (angiotensin I converting enzyme (peptidyl-dipeptidase A) 1 [Source:MGI Symbol;Acc:MGI:87874])

HSP 1 Score: 417.927 bits (1073), Expect = 4.967e-133
Identity = 227/608 (37.34%), Postives = 354/608 (58.22%), Query Frame = 2
Query:  212 PSVFDSYYHMTDLESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRR---KFRLITASIRNENESLVHELIHINNDISYIYNNAKPCFNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKM--PVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            P + D+Y    DLE+     D +  E      +D+  ++ +   N +A  +++Y+T+I  +  ++        S   LK   ++K F   +F++  ++R   K + +  ++    E   +  I ++ + +Y  +N       C+ + E  +  +  T + YE+L   W +WR+  G+ I   F + ++  N  ++ NG+ DA     S  +E D+ +    KLY  + PLY  LH YVR  L++ Y  ++ +  GPIPAH+ GN+WAQ W+NI+ ++       SA N   +ATE + K      ++F  A+ F+ S+G+  +  EFW +SML KP D + V CH SA DF NG DFRIK CT  NM D    HHEMGHI+Y+M Y  LP  FR  AN GFHEAIGD +AL+V TP+HL+ + L+S       +DI++LM  AL+K+AF+PF+  +D + W +++GS+     N+ WW LR +YQGL PPV R++ DFDPGSK+H+   V Y+RYFVSF+IQFQF+E++C  +G+ GPLH+C+ YQSKEAG  L + +  G S+ W E MK++TG   + + +++ +F PL +WL   N++    +GW
Sbjct:  402 PPLPDNYPEGIDLETDEAKADRFVEE------YDRTAQVLL---NEYAEANWQYNTNITIEGSKILLEKSTEVSNHTLKYGTRAKTFDVSNFQNSSIKRIIKKLQNLDRAVLPPKELEEYNQILLDMETTYSLSNICYTNGTCMPL-EPDLTNMMATSRKYEELLWAWKSWRDKVGRAILPFFPKYVEFSNKIAKLNGYTDAGDSWRSL-YESDNLEQDLEKLYQELQPLYLNLHAYVRRSLHRHYGSEYINLDGPIPAHLLGNMWAQTWSNIYDLVAPFP---SAPNI--DATEAMIKQGWTPRRIFKEADNFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHPSAWDFYNGKDFRIKQCTSVNMEDLVIAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGDIMALSVSTPKHLYSLNLLSTEGSGYEYDINFLMKMALDKIAFIPFSYLIDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRSQGDFDPGSKFHVPANVPYVRYFVSFIIQFQFHEALCRAAGHTGPLHKCDIYQSKEAGKLLADAMKLGYSKPWPEAMKLITGQPNMSASAMMNYFKPLTEWLVTENRRHGETLGW 993          

HSP 2 Score: 374.785 bits (961), Expect = 9.844e-117
Identity = 179/396 (45.20%), Postives = 251/396 (63.38%), Query Frame = 2
Query:  833 FEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            +E   F+ +   +Y  + PLY  LH YVR  L++ Y  K+ +  GPIPAH+ G++WAQ W NI+ ++     K    N    +T          MF ++EEF+ S+G+  M  EFW  SML KP D + V CH SA DF N  DFRIK CT   M    T+HHEMGH++YY+ Y  L    R  AN GFHEAIGD +AL+V TP HLHKIGL+  V +    DI+YL+  ALEK+AFLPF   +D + WG+++G  P S  N  WW LR +YQG+ PPV R E  FD G+K+HI     YIRYFVSF++QFQF++++C  +G++GPLH+C+ YQS +AG KL ++L  G S+ W+E +K L G+  + +++LL++F P+ +WL+  N++    +GW
Sbjct:    3 YESPSFEESLEHIYHQLEPLYLNLHAYVRRALHRRYGDKYVNLRGPIPAHLLGDMWAQSWENIYDMVVPFPDK---PNLDVTSTMVQKGWNATHMFRVSEEFFTSLGLSPMPPEFWAESMLEKPTDGREVVCHASAWDFYNRKDFRIKQCTRVTMEQLATVHHEMGHVQYYLQYKDLHVSLRRGANPGFHEAIGDVLALSVSTPAHLHKIGLLDHVTNDIESDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRYNFDWWYLRTKYQGICPPVARNETHFDAGAKFHIPNVTPYIRYFVSFVLQFQFHQALCKEAGHQGPLHQCDIYQSAQAGAKLKQVLQAGCSRPWQEVLKDLVGSDALDAKALLEYFQPVSQWLEEQNQRNGEVLGW 395          
BLAST of Angiotensin-converting enzyme vs. Ensembl Mouse
Match: Ace (angiotensin I converting enzyme (peptidyl-dipeptidase A) 1 [Source:MGI Symbol;Acc:MGI:87874])

HSP 1 Score: 418.698 bits (1075), Expect = 8.348e-131
Identity = 227/608 (37.34%), Postives = 354/608 (58.22%), Query Frame = 2
Query:  212 PSVFDSYYHMTDLESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRR---KFRLITASIRNENESLVHELIHINNDISYIYNNAKPCFNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKM--PVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            P + D+Y    DLE+     D +  E      +D+  ++ +   N +A  +++Y+T+I  +  ++        S   LK   ++K F   +F++  ++R   K + +  ++    E   +  I ++ + +Y  +N       C+ + E  +  +  T + YE+L   W +WR+  G+ I   F + ++  N  ++ NG+ DA     S  +E D+ +    KLY  + PLY  LH YVR  L++ Y  ++ +  GPIPAH+ GN+WAQ W+NI+ ++       SA N   +ATE + K      ++F  A+ F+ S+G+  +  EFW +SML KP D + V CH SA DF NG DFRIK CT  NM D    HHEMGHI+Y+M Y  LP  FR  AN GFHEAIGD +AL+V TP+HL+ + L+S       +DI++LM  AL+K+AF+PF+  +D + W +++GS+     N+ WW LR +YQGL PPV R++ DFDPGSK+H+   V Y+RYFVSF+IQFQF+E++C  +G+ GPLH+C+ YQSKEAG  L + +  G S+ W E MK++TG   + + +++ +F PL +WL   N++    +GW
Sbjct:  635 PPLPDNYPEGIDLETDEAKADRFVEE------YDRTAQVLL---NEYAEANWQYNTNITIEGSKILLEKSTEVSNHTLKYGTRAKTFDVSNFQNSSIKRIIKKLQNLDRAVLPPKELEEYNQILLDMETTYSLSNICYTNGTCMPL-EPDLTNMMATSRKYEELLWAWKSWRDKVGRAILPFFPKYVEFSNKIAKLNGYTDAGDSWRSL-YESDNLEQDLEKLYQELQPLYLNLHAYVRRSLHRHYGSEYINLDGPIPAHLLGNMWAQTWSNIYDLVAPFP---SAPNI--DATEAMIKQGWTPRRIFKEADNFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHPSAWDFYNGKDFRIKQCTSVNMEDLVIAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGDIMALSVSTPKHLYSLNLLSTEGSGYEYDINFLMKMALDKIAFIPFSYLIDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRSQGDFDPGSKFHVPANVPYVRYFVSFIIQFQFHEALCRAAGHTGPLHKCDIYQSKEAGKLLADAMKLGYSKPWPEAMKLITGQPNMSASAMMNYFKPLTEWLVTENRRHGETLGW 1226          

HSP 2 Score: 401.749 bits (1031), Expect = 1.424e-124
Identity = 208/513 (40.55%), Postives = 300/513 (58.48%), Query Frame = 2
Query:  509 KFRLITASIRN---ENESLVHELIH--INNDISYIYNNAKPCF-NK---CLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            K R I  SIR     N  L     +  + +++S IY+  K CF NK   C  + +  +  +  + + Y KL   W  W +  G  +K L+     + N   R++   D   +  S+ +E   F+ +   +Y  + PLY  LH YVR  L++ Y  K+ +  GPIPAH+ G++WAQ W NI+ ++     K    N    +T          MF ++EEF+ S+G+  M  EFW  SML KP D + V CH SA DF N  DFRIK CT   M    T+HHEMGH++YY+ Y  L    R  AN GFHEAIGD +AL+V TP HLHKIGL+  V +    DI+YL+  ALEK+AFLPF   +D + WG+++G  P S  N  WW LR +YQG+ PPV R E  FD G+K+HI     YIRYFVSF++QFQF++++C  +G++GPLH+C+ YQS +AG KL ++L  G S+ W+E +K L G+  + +++LL++F P+ +WL+  N++    +GW
Sbjct:  121 KLRRIIGSIRTLGPANLPLAQRQQYNSLLSNMSRIYSTGKVCFPNKTATCWSL-DPELTNILASSRSYAKLLFAWEGWHDAVGIPLKPLYQDFTAISNEAYRQDDFSDTGAFWRSW-YESPSFEESLEHIYHQLEPLYLNLHAYVRRALHRRYGDKYVNLRGPIPAHLLGDMWAQSWENIYDMVVPFPDK---PNLDVTSTMVQKGWNATHMFRVSEEFFTSLGLSPMPPEFWAESMLEKPTDGREVVCHASAWDFYNRKDFRIKQCTRVTMEQLATVHHEMGHVQYYLQYKDLHVSLRRGANPGFHEAIGDVLALSVSTPAHLHKIGLLDHVTNDIESDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRYNFDWWYLRTKYQGICPPVARNETHFDAGAKFHIPNVTPYIRYFVSFVLQFQFHQALCKEAGHQGPLHQCDIYQSAQAGAKLKQVLQAGCSRPWQEVLKDLVGSDALDAKALLEYFQPVSQWLEEQNQRNGEVLGW 628          
BLAST of Angiotensin-converting enzyme vs. Ensembl Mouse
Match: Ace3 (angiotensin I converting enzyme (peptidyl-dipeptidase A) 3 [Source:MGI Symbol;Acc:MGI:3644400])

HSP 1 Score: 372.474 bits (955), Expect = 1.641e-118
Identity = 203/596 (34.06%), Postives = 340/596 (57.05%), Query Frame = 2
Query:  272 DEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLITASIRNENESLV--HELIHINNDISYI---YNNAKPCFNK--CLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFY-PGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKM------PVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            +++ SE  AKL+     + +    N F    + Y T+I K+N +   + +   S+  L    +++ F    F + +++R  R     ++N ++S +   +L+  N  ++Y+   YN A+ C ++  CL + E  + ++  T +D ++L   W  WR+  G++++ +F   ++L N  ++ NG++D      S  +E D  +    +LY  + PLY  LH YVR  L ++Y P   D  GPIPAH+ GN+WAQ W NI  ++           Y  +A E+++ +        E+MF  A  F+ S+GM      FW +SM+ KP D + V CH S+ +F    DFR+K CTE  + D  ++ H+MGHI+Y++ Y +L  I++  A+  F EA+G  IAL+V + ++L   GL+S+       ++++L+  ALEK+AF+PF+  +D + W +++G++     N+ WW+ R +YQGL PPV R++DDFDPG+K+HI   V YIRYF+  ++QFQ +E++C  SG+ GPLH+C+ Y SK AG  L ++L  G S+ WRE ++ +TG + I +++ L +F PL  WL   N K    +GW
Sbjct:   30 NDFYSEAQAKLFLQFYEQTAQVVLNEFMEATWNYVTNITKQNQKNMLQKEADRSQFMLYFSTRARMFRTDHFLNQDVKRMLR----KLQNIDKSALPTEDLLEYNRLLTYMETAYNRAEVCLDEGPCLTL-EPDLQEIMATSRDQKELLWAWQGWRDAVGRQLRPVFEDYVRLSNKAAQYNGYKDMGALWRS-KYESDTLEEDLEQLYKELQPLYLNLHAYVRRSLYRYYGPELIDLRGPIPAHLLGNMWAQSWNNILDLVLP---------YPTKAPEDITAIMKIQHWRPEKMFEEANLFFTSMGMLPAPPAFWIKSMMEKPADGREVECHTSSWNFYKFNDFRVKKCTEVTLEDLLSVFHQMGHIQYFLQYQNLSVIYQEGASPAFEEAVGSVIALSVSSHKYLLARGLLSQPHQDSEEEVNFLLGIALEKIAFIPFSYLVDKFRWKIFDGTISKITYNQEWWNFRLKYQGLCPPVPRSDDDFDPGAKFHIPANVPYIRYFLGLILQFQLHEALCEASGHVGPLHQCDNYNSKVAGKILGDLLKLGSSRPWREVLQEVTGESNISTKAFLTYFKPLMDWLVTENVKQGDTLGW 610          
BLAST of Angiotensin-converting enzyme vs. Ensembl Mouse
Match: Ace2 (angiotensin I converting enzyme (peptidyl-dipeptidase A) 2 [Source:MGI Symbol;Acc:MGI:1917258])

HSP 1 Score: 335.495 bits (859), Expect = 1.049e-103
Identity = 177/499 (35.47%), Postives = 276/499 (55.31%), Query Frame = 2
Query:  563 ELIHINNDISYIYNNAKPCFNK----CLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATY---------GLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLI-SRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            +L  I N +S IY+  K C  K    CL + E G+ ++  T  DY      W  WR   G++++ L+   + L+N  +R N + D   Y            +++  +       + +  I PLY+ LH YVR  L   YP     +G +PAH+ G++W + WTN++P+     QK + +       +       E++F  AE+F+ S+G+  MT  FW  SML++P D + V CH +A D  +G DFRIKMCT+  M +F T HHEMGHI+Y MAY+  P + R  AN GFHEA+G+ ++L+  TP+HL  IGL+ S   +    +I++L+  AL  V  LPF   ++ + W ++ G +P  +  K WW+++    G++ P+   E   DP S +H+S   S+IRY+   + QFQF E++C  + Y G LH+C+   S EAG KL++MLS G S+ W + ++ + GA  +  + LL +F PL+ WLK  N+  N  +GW
Sbjct:  115 QLNTILNTMSTIYSTGKVCNPKNPQECLLL-EPGLDEIMATSTDYNSRLWAWEGWRAEVGKQLRPLYEEYVVLKNEMARANNYNDYGDYWRGDYEAEGADGYNYNRNQLIEDVERTFAEIKPLYEHLHAYVRRKLMDTYPSYISPTGCLPAHLLGDMWGRFWTNLYPLTVPFAQKPNIDVTDAMMNQGWD---AERIFQEAEKFFVSVGLPHMTQGFWANSMLTEPADGRKVVCHPTAWDLGHG-DFRIKMCTKVTMDNFLTAHHEMGHIQYDMAYARQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLPSDFQEDSETEINFLLKQALTIVGTLPFTYMLEKWRWMVFRGEIPKEQWMKKWWEMKREIVGVVEPLPHDETYCDPASLFHVSNDYSFIRYYTRTIYQFQFQEALCQAAKYNGSLHKCDISNSTEAGQKLLKMLSLGNSEPWTKALENVVGARNMDVKPLLNYFQPLFDWLKEQNR--NSFVGW 606          
BLAST of Angiotensin-converting enzyme vs. UniProt/SwissProt
Match: sp|Q50JE5|ACE_MESAU (Angiotensin-converting enzyme OS=Mesocricetus auratus OX=10036 GN=Ace PE=2 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 9.196e-132
Identity = 210/492 (42.68%), Postives = 303/492 (61.59%), Query Frame = 2
Query:  557 VHELIHINNDISYIYNNAKPCF--NKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGK-FDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKM--PVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            + E   I  D+   Y+ A  C+    CL + E  +  +  T + YE+L   W +WR+  G+ I  LF + ++L N  +  NG+ D      S  +E    +    +LY  + PLY  LH YVR  L++ Y  +  +  GPIPAH+ GN+WAQ W+NI+ ++       SA N   +ATE + K      ++F  A++F+ S+G+  +++EFW +SML KP D + V CH SA DF NG DFRIK CT  NM D    HHEMGHI+Y+M Y  LP  FR  AN GFHEAIGD +AL+V TP+HLH + L+S        DI++LM  AL+K+AF+PF+  +D + W +++GS+     N+ WW LR +YQGL PPV R++DDFDPGSK+H+   V YIRYFVSF+IQFQF+E++C  +G+ GPLH+C+ YQSKEAG  L + +  G S+ W E MK++TG   + + +++ +F PL +WL   N++    +GW
Sbjct:  743 LEEYNQILMDMETTYSIANVCYLNGTCLHL-EPDLTNVMATSRKYEELLWVWKSWRDKVGRAILPLFPKYVELSNKIAHLNGYADGGDSWRS-SYESKSLEQDLEQLYQELQPLYLNLHAYVRRSLHRHYGSQHINLDGPIPAHLLGNMWAQTWSNIYDLVAPFP---SAPNL--DATEAMIKQGWTPRRIFKEADDFFTSLGLLPVSEEFWNKSMLEKPGDGREVVCHASAWDFYNGKDFRIKQCTSVNMEDLVIAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGGYEHDINFLMKMALDKIAFIPFSYLIDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRSQDDFDPGSKFHVPANVPYIRYFVSFIIQFQFHEALCRAAGHTGPLHKCDIYQSKEAGKLLADTMKMGYSKPWPEAMKLITGQPNMSASAMMNYFKPLTEWLVTENRRHGETLGW 1227          

HSP 2 Score: 414.075 bits (1063), Expect = 2.628e-128
Identity = 207/488 (42.42%), Postives = 296/488 (60.66%), Query Frame = 2
Query:  575 INNDISYIYNNAKPCF-NK---CLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQK--LSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            + N+++ IY+ +K C  NK   C  + E  +  +  + + Y KL   W +W +V G  +K L+     L N   +++G  D   Y  S  ++   F+ T   LY  + PLY  LH YVR  L++ Y  K+ +  GPIPAH+ G++WAQ W NI+ ++     K  L   N   +   N     V  MF +AEEF+ S+G+  M  EFW  SML KP D + V CH SA DF N  DFRIK CT   M   +T+HHEMGH++YY+ Y  L    R  AN GFHEAIGD +AL+V TP HLHKIGL+ RV +    DI+YL+  ALEK+AFLPF   +D + WG+++G  P S  N  WW  R +YQG+ PPV R E  FD G+K+HI  G  YIRYFVSF++QFQF++++C  +G++GPLH+C+ YQS +AG KL  +L  G S+ W+E +K + G+  + +++LL++F P+ +WL+  N++    +GW
Sbjct:  149 LQNNMNRIYSTSKVCLPNKTATCWSL-EPELTNILASSRSYAKLLFAWESWHDVVGIPLKPLYQDFTALSNEAYKQDGFSDTGAYWRS-AYDSPSFEETLEHLYHQLEPLYLNLHAYVRRALHRRYGDKYINLRGPIPAHLLGDMWAQSWDNIYDMVVPFPNKPNLDVTNTMVQKGWN-----VTHMFRVAEEFFTSMGLSPMPPEFWAESMLEKPTDGREVVCHASAWDFFNRKDFRIKQCTRITMEQLSTVHHEMGHVQYYLQYKDLTVPLRRGANPGFHEAIGDVLALSVSTPAHLHKIGLLDRVANDLESDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGHTPPSRYNFDWWYFRTKYQGICPPVVRNETHFDAGAKFHIPSGTPYIRYFVSFILQFQFHQALCKEAGHQGPLHQCDIYQSTQAGAKLQRVLQAGYSRPWQEVLKEMVGSDTLDAQALLEYFQPVIRWLQEQNQRNGEVLGW 629          
BLAST of Angiotensin-converting enzyme vs. UniProt/SwissProt
Match: sp|P47820|ACE_RAT (Angiotensin-converting enzyme OS=Rattus norvegicus OX=10116 GN=Ace PE=1 SV=1)

HSP 1 Score: 421.009 bits (1081), Expect = 6.409e-131
Identity = 210/509 (41.26%), Postives = 307/509 (60.31%), Query Frame = 2
Query:  506 RKFRLITASIRNENESLVHELIHINNDISYIYNNAKPCFNK--CLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKM--PVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            +K + +  ++   NE  + E   I  D+   Y+ A  C+    CL + E  +  +  T + YE+L   W +WR+  G+ I   F + +   N  ++ NG+ DA     S  +E DD +    KLY  + PLY  LH YVR  L++ Y  ++ +  GPIPAH+ GN+WAQ W+NI+ ++       S +     ATE + K      ++F  A+ F+ S+G+  +  EFW +SML KP D + V CH SA DF NG DFRIK CT  NM +    HHEMGHI+Y+M Y  LP  FR  AN GFHEAIGD +AL+V TP+HLH + L+S        DI++LM  AL+K+AF+PF+  +D + W +++GS+     N+ WW LR +YQGL PPV R++ DFDPGSK+H+   V YIRYF+SF+IQFQF+E++C  +G+ GPL++C+ YQSKEAG  L + +  G S+ W E MKI+TG   + + +++ +F PL +WL   N++    +GW
Sbjct:  728 KKVQNVDRAVLPPNE--LEEYNQILLDMETTYSVANVCYTNGTCLSL-EPDLTNIMATSRKYEELLWVWKSWRDKVGRAILPFFPKYVDFSNKIAKLNGYSDAGDSWRS-SYESDDLEQDLEKLYQELQPLYLNLHAYVRRSLHRHYGSEYINLDGPIPAHLLGNMWAQTWSNIYDLVAPFPSAPSID-----ATEAMIKQGWTPRRIFKEADNFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTSVNMEELVIAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGSGYEHDINFLMKMALDKIAFIPFSYLIDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRSQGDFDPGSKFHVPANVPYIRYFISFIIQFQFHEALCRAAGHTGPLYKCDIYQSKEAGKLLADAMKLGYSKQWPEAMKIITGQPNMSASAIMNYFKPLTEWLVTENRRHGETLGW 1227          

HSP 2 Score: 410.223 bits (1053), Expect = 8.668e-127
Identity = 209/514 (40.66%), Postives = 305/514 (59.34%), Query Frame = 2
Query:  506 RKFRLITASIRN---ENESLVHELIH--INNDISYIYNNAKPCF-NK---CLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            +K R I  S++     N  L   L +  + +++S IY+  K CF NK   C  + +  +  +  + ++Y K+   W  W +  G  ++ L+     L N   R++G  D   Y  S+ +E   F+ +   LY  + PLY  LH +VR  L++ Y  K+ +  GPIPAH+ G++WAQ W NI+ ++     K    N    +T          MF +AEEF+ S+G+  M  EFW  SML KP D + V CH SA DF N  DFRIK CT   M   +T+HHEMGH++YY+ Y  L    R  AN GFHEAIGD +AL+V TP HLHKIGL+ RV +    DI+YL+  ALEK+AFLPF   +D + WG+++G  P S  N  WW LR +YQG+ PPV R E  FD G+K+HI     YIRYFVSF++QFQF++++C  +G++GPLH+C+ YQS +AG KL ++L  G S+ W+E +K L G+  + + +L+++F P+ +WL+  N++    +GW
Sbjct:  121 QKLRRIIGSVQTLGPANLPLTQRLQYNSLLSNMSRIYSTGKVCFPNKTATCWSL-DPELTNILASSRNYAKVLFAWEGWHDAVGIPLRPLYQDFTALSNEAYRQDGFSDTGAYWRSW-YESPSFEESLEHLYHQVEPLYLNLHAFVRRALHRRYGDKYINLRGPIPAHLLGDMWAQSWENIYDMVVPFPDK---PNLDVTSTMVQKGWNATHMFRVAEEFFTSLGLSPMPPEFWAESMLEKPADGREVVCHASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKDLHVSLRRGANPGFHEAIGDVLALSVSTPAHLHKIGLLDRVANDIESDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRYNYDWWYLRTKYQGICPPVARNETHFDAGAKFHIPSVTPYIRYFVSFVLQFQFHQALCKEAGHQGPLHQCDIYQSTKAGAKLQQVLQAGCSRPWQEVLKDLVGSDALDASALMEYFQPVSQWLQEQNQRNGEVLGW 629          
BLAST of Angiotensin-converting enzyme vs. UniProt/SwissProt
Match: sp|Q10751|ACE_CHICK (Angiotensin-converting enzyme (Fragment) OS=Gallus gallus OX=9031 GN=ACE PE=2 SV=1)

HSP 1 Score: 417.927 bits (1073), Expect = 1.107e-130
Identity = 208/490 (42.45%), Postives = 297/490 (60.61%), Query Frame = 2
Query:  575 INNDISYIYNNAKPCFNK--CLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCL-NKFYPGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQ------MFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            I +D+  IY+ AK C +   C ++ E  I  +  T + Y+KL   W  W N  G  ++  +   + L N   + +G ED  +Y  S+ ++   F+     LY  + PLY  LH +VR  L +++ P   +  GPIPAH+ GN+WAQQW NI+ ++           Y D+   +++   V Q      MF ++EEF+ S+G+ +M  EFWE+SML KP D + V CH SA DF N  DFRIK CT   M    T+HHEMGH++YY+ Y   P  FRG AN GFHEAIGD ++L+V TP HL KIGL+S   + +  +I+YL+  ALEK+AFLPF   +D + W +++G  P S  N  WW LR +YQG+  PV R E +FDPG+KYHI     YIRYFVSF++QFQF++++C  + + GPLH C+ Y SKEAG KL E+L  G S++W+E +  LTG  ++ + +LL++F P+  WL+  N K N  +GW
Sbjct:   43 ILSDMDKIYSTAKVCLDNGTCWDL-EPDISDIMATSRSYKKLLYAWEGWHNAAGNPLRAKYQEFVTLSNEAYQMDGFEDTGSYWRSW-YDSTTFEDDLEHLYNQLEPLYLNLHAFVRRKLYDRYGPKYINLKGPIPAHLLGNMWAQQWNNIYDLMVP---------YPDKPNLDVTNTMVNQGWNATHMFRVSEEFFTSLGLLEMPPEFWEKSMLEKPADGREVVCHASAWDFYNRKDFRIKQCTTVTMEQLFTVHHEMGHVQYYLQYKDQPVSFRGGANPGFHEAIGDVLSLSVSTPSHLQKIGLLSSAVEDEESNINYLLKMALEKIAFLPFGYLIDQWRWNVFSGRTPPSRYNYDWWYLRTKYQGICAPVSRNESNFDPGAKYHIPGNTPYIRYFVSFILQFQFHKALCQAANHTGPLHTCDIYMSKEAGAKLREVLKAGSSKSWQEILFNLTGTDKMDAGALLEYFSPVTTWLQEQNNKTNEVLGW 521          

HSP 2 Score: 414.846 bits (1065), Expect = 1.685e-129
Identity = 228/594 (38.38%), Postives = 336/594 (56.57%), Query Frame = 2
Query:  251 ESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLEL---KKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLITASIRNENESLVHELIHINNDISYIYNNAKPCF-NKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCL-NKFYPGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            E YP   D+   E  AK +  + N  +    N +    ++Y+T+I   N E+   K       +       R+     ++      +  K  ++  +   E+E  + E   + +D+   Y+ AK C  N      +  +  +  T +DY +L   W  W + +G KIK  + R ++L N  +  NG+ D   Y  S  +E   F+    +LY  + PLY  LH YVR  L NK+        GPIPAH+ GN+WAQ W+NIF ++         +     A +     P + MF  ++ F+ S+G+  M  EFW++SM+ KP D + V CH SA DF N  DFRIK CT  NM D  T+HHEMGH++Y++ Y   P  FR  AN GFHEAIGD +AL+V TP+HLH I L+ +V +++  DI+YLM+ AL+K+AFLPF   MD + W +++G +   E N+ WW+LR +YQGL PPV R+EDDFDPG+K+HI   V YIRYFVSF+IQFQF++++C  +G+ GPLH C+ YQSKEAG  L + +  G S+ W E M+++TG   + +E+L+ +F+PL  WL   N +    +GW
Sbjct:  532 EGYPEGIDKIVDEAQAKEFLSEYNSTAEVVWNAYTEASWEYNTNITDHNKEVMLEKNLAMSKHTIEYGMRARQFDPSDFQDETVTRILNKLSVLERAALPEDE--LKEYNTLLSDMETTYSVAKVCRENNTFHPLDPDLTDILATSRDYNELLFAWKGWWDASGAKIKDKYKRYVELSNKAAVLNGYTDNGAYWRSL-YETPTFEEDLERLYLQLQPLYLNLHAYVRRALYNKYGAEHISLKGPIPAHLLGNMWAQSWSNIFDLVMPFPDATKVD--ATPAMKQQGWTP-KMMFEESDRFFTSLGLIPMPQEFWDKSMIEKPADGREVVCHASAWDFYNRKDFRIKQCTVVNMDDLITVHHEMGHVQYFLQYMDQPISFRDGANPGFHEAIGDVMALSVSTPKHLHSINLLDQVTENEESDINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRIKEDEYNQQWWNLRLKYQGLCPPVPRSEDDFDPGAKFHIPANVPYIRYFVSFVIQFQFHQALCKAAGHTGPLHTCDIYQSKEAGKLLGDAMKLGFSKPWPEAMQLITGQPNMSAEALMSYFEPLMTWLVKKNTENGEVLGW 1119          
BLAST of Angiotensin-converting enzyme vs. UniProt/SwissProt
Match: sp|P09470|ACE_MOUSE (Angiotensin-converting enzyme OS=Mus musculus OX=10090 GN=Ace PE=1 SV=3)

HSP 1 Score: 418.698 bits (1075), Expect = 5.840e-130
Identity = 227/608 (37.34%), Postives = 354/608 (58.22%), Query Frame = 2
Query:  212 PSVFDSYYHMTDLESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRR---KFRLITASIRNENESLVHELIHINNDISYIYNNAKPCFNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKM--PVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            P + D+Y    DLE+     D +  E      +D+  ++ +   N +A  +++Y+T+I  +  ++        S   LK   ++K F   +F++  ++R   K + +  ++    E   +  I ++ + +Y  +N       C+ + E  +  +  T + YE+L   W +WR+  G+ I   F + ++  N  ++ NG+ DA     S  +E D+ +    KLY  + PLY  LH YVR  L++ Y  ++ +  GPIPAH+ GN+WAQ W+NI+ ++       SA N   +ATE + K      ++F  A+ F+ S+G+  +  EFW +SML KP D + V CH SA DF NG DFRIK CT  NM D    HHEMGHI+Y+M Y  LP  FR  AN GFHEAIGD +AL+V TP+HL+ + L+S       +DI++LM  AL+K+AF+PF+  +D + W +++GS+     N+ WW LR +YQGL PPV R++ DFDPGSK+H+   V Y+RYFVSF+IQFQF+E++C  +G+ GPLH+C+ YQSKEAG  L + +  G S+ W E MK++TG   + + +++ +F PL +WL   N++    +GW
Sbjct:  635 PPLPDNYPEGIDLETDEAKADRFVEE------YDRTAQVLL---NEYAEANWQYNTNITIEGSKILLEKSTEVSNHTLKYGTRAKTFDVSNFQNSSIKRIIKKLQNLDRAVLPPKELEEYNQILLDMETTYSLSNICYTNGTCMPL-EPDLTNMMATSRKYEELLWAWKSWRDKVGRAILPFFPKYVEFSNKIAKLNGYTDAGDSWRSL-YESDNLEQDLEKLYQELQPLYLNLHAYVRRSLHRHYGSEYINLDGPIPAHLLGNMWAQTWSNIYDLVAPFP---SAPNI--DATEAMIKQGWTPRRIFKEADNFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHPSAWDFYNGKDFRIKQCTSVNMEDLVIAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGDIMALSVSTPKHLYSLNLLSTEGSGYEYDINFLMKMALDKIAFIPFSYLIDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRSQGDFDPGSKFHVPANVPYVRYFVSFIIQFQFHEALCRAAGHTGPLHKCDIYQSKEAGKLLADAMKLGYSKPWPEAMKLITGQPNMSASAMMNYFKPLTEWLVTENRRHGETLGW 1226          

HSP 2 Score: 401.749 bits (1031), Expect = 9.960e-124
Identity = 208/513 (40.55%), Postives = 300/513 (58.48%), Query Frame = 2
Query:  509 KFRLITASIRN---ENESLVHELIH--INNDISYIYNNAKPCF-NK---CLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            K R I  SIR     N  L     +  + +++S IY+  K CF NK   C  + +  +  +  + + Y KL   W  W +  G  +K L+     + N   R++   D   +  S+ +E   F+ +   +Y  + PLY  LH YVR  L++ Y  K+ +  GPIPAH+ G++WAQ W NI+ ++     K    N    +T          MF ++EEF+ S+G+  M  EFW  SML KP D + V CH SA DF N  DFRIK CT   M    T+HHEMGH++YY+ Y  L    R  AN GFHEAIGD +AL+V TP HLHKIGL+  V +    DI+YL+  ALEK+AFLPF   +D + WG+++G  P S  N  WW LR +YQG+ PPV R E  FD G+K+HI     YIRYFVSF++QFQF++++C  +G++GPLH+C+ YQS +AG KL ++L  G S+ W+E +K L G+  + +++LL++F P+ +WL+  N++    +GW
Sbjct:  121 KLRRIIGSIRTLGPANLPLAQRQQYNSLLSNMSRIYSTGKVCFPNKTATCWSL-DPELTNILASSRSYAKLLFAWEGWHDAVGIPLKPLYQDFTAISNEAYRQDDFSDTGAFWRSW-YESPSFEESLEHIYHQLEPLYLNLHAYVRRALHRRYGDKYVNLRGPIPAHLLGDMWAQSWENIYDMVVPFPDK---PNLDVTSTMVQKGWNATHMFRVSEEFFTSLGLSPMPPEFWAESMLEKPTDGREVVCHASAWDFYNRKDFRIKQCTRVTMEQLATVHHEMGHVQYYLQYKDLHVSLRRGANPGFHEAIGDVLALSVSTPAHLHKIGLLDHVTNDIESDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRYNFDWWYLRTKYQGICPPVARNETHFDAGAKFHIPNVTPYIRYFVSFVLQFQFHQALCKEAGHQGPLHQCDIYQSAQAGAKLKQVLQAGCSRPWQEVLKDLVGSDALDAKALLEYFQPVSQWLEEQNQRNGEVLGW 628          
BLAST of Angiotensin-converting enzyme vs. UniProt/SwissProt
Match: sp|Q9GLN7|ACE_PANTR (Angiotensin-converting enzyme OS=Pan troglodytes OX=9598 GN=ACE PE=3 SV=1)

HSP 1 Score: 417.927 bits (1073), Expect = 7.599e-130
Identity = 204/481 (42.41%), Postives = 292/481 (60.71%), Query Frame = 2
Query:  584 DISYIYNNAKPCFN--KCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGK-FDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            D+   Y+ A  C     CL++ E  +  +  T + YE L   W  WR+  G+ I + + + ++L N  +R NG+ DA     S  +E    +    +L+  + PLY  LH YVR  L++ Y  +  +  GPIPAH+ GN+WAQ W+NI+ ++       S +    EA       P  +MF  A++F+ S+G+  +  EFW +SML KP D + V CH SA DF NG DFRIK CT  N+ D    HHEMGHI+Y+M Y  LP   R  AN GFHEAIGD +AL+V TP+HLH + L+S    S   DI++LM  AL+K+AF+PF+  +D + W +++GS+     N+ WW LR +YQGL PPV RT+ DFDPG+K+HI   V YIRYFVSF+IQFQF+E++C  +G+ GPLH+C+ YQSKEAG +L   +  G S+ W E M+++TG   + + ++L +F PL  WL+  N+     +GW
Sbjct:  744 DMETTYSVATVCHTNGSCLQL-EPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSM-YETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDT--TEAMLKQGWTP-RRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGW 1219          

HSP 2 Score: 409.068 bits (1050), Expect = 1.737e-126
Identity = 211/514 (41.05%), Postives = 300/514 (58.37%), Query Frame = 2
Query:  494 PELRRKFRLI-TASIRNENESLVHELIHINNDISYIYNNAKPCF-NK---CLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            P+LRR    + T    N   +   +   + +++S IY+ AK C  NK   C  + +  +  +  + + Y  L   W  W N  G  +K L+     L N   +++G  D   Y  S+ +    F+     LY  + PLY  LH +VR  L++ Y  ++ +  GPIPAH+ G++WAQ W NI+ ++     K    N    +T          MF +AEEF+ S+ +  M  EFWE SML KP D + V CH SA DF N  DFRIK CT   M   +T+HHEMGHI+YY+ Y  LP   RG AN GFHEAIGD +AL+V TP HLHKIGL+  V +    DI+YL+  ALEK+AFLPF   +D + WG+++G  P S  N  WW LR +YQG+ PPV R E  FD G+K+H+     YIRYFVSF++QFQF+E++C  +GY+GPLH+C+ YQS +AG KL ++L  G S+ W+E +K + G   + ++ LLK+F P+ +WL+  N++    +GW
Sbjct:  113 PQLRRIIGAVRTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSL-DPDLTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSW-YNSPTFEDDLEHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVPFPDK---PNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPADGREVVCHASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRGGANPGFHEAIGDVLALSVSTPAHLHKIGLLDNVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPNSRYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQFHEALCKEAGYEGPLHQCDIYQSTKAGAKLRKVLQAGSSRPWQEVLKDMVGLDALDAQPLLKYFQPVTQWLQEQNQQNGEVLGW 621          
BLAST of Angiotensin-converting enzyme vs. TrEMBL
Match: I1ZIB1 (Angiotensin-converting enzyme (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 287/590 (48.64%), Postives = 411/590 (69.66%), Query Frame = 2
Query:  248 LESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLITASIRNENESLVHELIHINNDISYIYNNAKPCFNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLIS-RVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            LE YPNVC+ ++ E CA+ W  ++NEI IRN NR AN++FKY+T+IN  NL    + ++  + +  K+  K+KKF  K FKSP ++R   ++  S R  + S    LI I   I  IYN A PCF  C   GE GII++F   KDY+ LAGYW AWRN TG +I+ LF+ RM LEN  + ++G  D+A + L+ DF++ +F       +  I  LYKELHGYVR+CL+K+YP +F+KSGPIPAHI G+ W++ W N+F I++ C + +   + + E  EN+ K+ V +MF ++E FY S+GM  MTDEFW+RS+  K + K+++CH  +  F NGVDFRIKMCT K++ D T+I HEMGHI+Y+MAY +L   FR SANSGF E  GD + LA +TP +L KIGL+S  + + +  +I+YL+ +AL+ + F+PFA+S++ Y+  +YNGSV  +E+NK +WD+  + QG++PPV+RTE+ FD G+KYH++ G +Y R+  S+L Q+  +E+MCN+SGYKGPLH+C+F+ SKE G K +EM+  G ++NWR+TMKILTG T + S+SLL F+ PLY+WLK  NK+LN+  GW
Sbjct:    2 LEPYPNVCNGHSDENCARKWLQRVNEIMIRNNNRLANVNFKYATNINGNNLRELIKMKKKSAILSWKMHLKAKKFRLKFFKSPWVKRSLEMLKKSSRIFDSSTTLRLIDIRFQIENIYNTATPCFKGCQPPGEPGIIEIFNRVKDYDDLAGYWVAWRNATGSRIRNLFIERMNLENQKATDSGFHDSAEFKLATDFQETNFSQKLRNHFDNIFSLYKELHGYVRHCLHKYYPNRFNKSGPIPAHIVGSPWSESWHNVFSILKKCHKNIHEYDLRKEIDENIGKLTVHEMFKLSESFYSSLGMHNMTDEFWKRSITKKLKHKIMDCHPYSDSFENGVDFRIKMCTVKDLKDLTSIFHEMGHIQYFMAYRNLSVWFRESANSGFAELFGDVMGLAFRTPAYLRKIGLLSTNINNLRNSEINYLLTSALDNIVFIPFAISIEEYVNSVYNGSVGNNEMNKIYWDIVRKNQGIVPPVERTENYFDAGAKYHVAIGFAYTRHLFSYLFQYNIFEAMCNLSGYKGPLHQCHFFNSKEVGAKTLEMMKLGNTRNWRKTMKILTGTTSLNSDSLLTFYHPLYEWLKKKNKELNVKTGW 591          
BLAST of Angiotensin-converting enzyme vs. TrEMBL
Match: A0A1S5QMZ5 (Angiotensin-converting enzyme OS=Tityus serrulatus OX=6887 PE=2 SV=1)

HSP 1 Score: 454.907 bits (1169), Expect = 1.301e-148
Identity = 226/521 (43.38%), Postives = 329/521 (63.15%), Query Frame = 2
Query:  494 PELRRKFRLIT----ASIRNENESLVHELIHINNDISYIYNNAKPC-FNK------CLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPG-KFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSES--LLKFFDPLYKWLKFTNKKLNIPIGW 2014
            P +RR F+ ++    A++ N+    + ELI    D+  IY+ +K C FN       C    E  + ++    ++Y++LA  W AWR+V+G+++K  ++R ++L N  +  NG  D         +E D F+    +L+  I PLY++LH YVR  L   Y   K    GPIPAHI GN+WAQ W+ I   I    +K S +       +N+S +   ++F I+EEF+ S+G+  MTDEFWERS++ KP+D+ + CH SA DF +G DFRIK CT  NM DF   HHEMGHI+YY  Y+H P +FR  AN GFHEA+GD +AL+  TP+HL  IGL+  + + K  D+++L +TAL K+AFLPF   +D + WG+++G +  +E+N  WW+LR +YQG+ PPV+RTE+DFDPGSKYH+     Y+RYFVS +IQFQF++S+C  +G+ GPLH+C+ Y+SK+AG  L +ML  G S+ W E M I+TG    K ++  + ++F+PLY+WLK  NK     IGW
Sbjct:  100 PLIRRWFKKLSILGKAALPNDQLKELDELI---ADMKNIYSTSKVCPFNSKETDENCNLSLEPELTEILTKSRNYDELAYIWKAWRDVSGKRVKDKYIRFIELSNKAAELNGFRDTGELWRE-RYESDTFQQEIEQLWQQIRPLYEQLHAYVRRKLINIYGSDKIRHDGPIPAHILGNMWAQDWSGILQDITPYPEKPSVDITPKMIAKNMSAL---EIFKISEEFFTSVGLKAMTDEFWERSIIEKPKDREIVCHASAWDFCDGKDFRIKQCTSINMEDFIVTHHEMGHIQYYQQYAHQPCVFREGANPGFHEAVGDCLALSTSTPKHLQTIGLLDHIAEDKKGDVNFLFSTALSKLAFLPFGYLIDLWRWGIFSGDIKSTELNTKWWELRLKYQGICPPVERTENDFDPGSKYHVPGNTPYVRYFVSHVIQFQFHKSLCEAAGHVGPLHKCDIYKSKDAGKVLSQMLELGSSEIWNEAMNIMTGGVTNKMDAGPMFEYFEPLYQWLKEENK--GEVIGW 611          
BLAST of Angiotensin-converting enzyme vs. TrEMBL
Match: A0A1S3GZX9 (Angiotensin-converting enzyme OS=Lingula unguis OX=7574 GN=LOC106150791 PE=3 SV=1)

HSP 1 Score: 456.062 bits (1172), Expect = 1.460e-148
Identity = 229/521 (43.95%), Postives = 320/521 (61.42%), Query Frame = 2
Query:  506 RKFRLITASIRNENESLVHELIHINNDISYIYNNAKPCF----NKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIR--------DCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGF----DIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            R+F+LIT      +++ V  + ++ + +  IY+  K C       CL + E  ++ L  T +DY++L   W +WR+VTG  I+ L+   +  +N  ++ENG  D   +    +FED +       L+  + PLY++LH YVR  L   Y  K+   +GPIPAH+ GN+WAQQW  I  +++        D    L  +NY            V++MF  AE F+ S+GM  MT EFWE+SM+ KP D + V CH SA DF N  D+RIKMCTE +  +   IHHEMGH++YYM YSH P I+R  AN+GFHEA+GDTIAL+V TPEHLHK+ L+  + D K      D+++LM  AL+K+AFLPF L +D + W ++ G    S  N+ WWDLR RYQG+ PPV R+E DFDPG+K+H+   V YIRYFVSFLIQFQF  ++C+ +G+ GP+H C+ YQS  AG KL +MLS G S+ W + M++LTG  EI   ++L++F PL  +L   NK  N  IGW
Sbjct:  124 RQFKLITMDASLRDDADVRRMSYLLSQMESIYDKGKVCRPHSEASCLPL-EPDLVNLMMTSRDYDELLWAWKSWRDVTGPPIRDLYREFVVFQNKAAKENGFADMGEFWRISNFEDKNLDKIVDGLFDQVKPLYQQLHAYVRRKLINQYGEKYVSPTGPIPAHLLGNMWAQQWDLILDLLQPYPNVPSVDVTSALKKQNYT-----------VQKMFKTAEAFFCSLGMDNMTKEFWEKSMVVKPTDGREVQCHASAEDFHNASDYRIKMCTEIDYDNLYVIHHEMGHVQYYMQYSHQPDIYRNGANAGFHEAVGDTIALSVATPEHLHKLKLLDDIGDDKELREKQDLNFLMKMALQKLAFLPFGLLIDKWRWDVFRGHTNASNYNQKWWDLRLRYQGIAPPVPRSELDFDPGAKFHVPANVPYIRYFVSFLIQFQFQRALCDAAGHTGPIHHCDIYQSTAAGEKLKKMLSLGSSRPWPDAMEVLTGQREIDPSAILEYFKPLQDFLVKENK--NEIIGW 630          
BLAST of Angiotensin-converting enzyme vs. TrEMBL
Match: A0A1W7RA02 (Angiotensin-converting enzyme OS=Hadrurus spadix OX=141984 PE=3 SV=1)

HSP 1 Score: 449.514 bits (1155), Expect = 2.156e-146
Identity = 222/517 (42.94%), Postives = 324/517 (62.67%), Query Frame = 2
Query:  494 PELRRKFRLITASIRNE-NESLVHELIHINNDISYIYNNAKPCFN--------KCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFY-PGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            P+LRR+F+L+    R+  +   + EL     D++ IY ++K C +        KC    E  +I +     +Y++L   W  WR+  G  IKK +LR ++L N  +R NG  D         +E   F+     L+  + PLY+ LH YVR  L + +   K   +GPIPAH+ GN+WAQ W+N+   ++    K S +  Q    + ++ + + ++   +E+F+ S+G+  MT EFW +S+  KP+D+ + CH SA DF NG DFRIKMCTE NM      HHEMGH++YYM Y++ P  FR  AN GFHEAIGD +AL++ TP+HL  IGL+    + +  D+++LM+TAL+KVAFLPF   +D + W +++G +  S+ N  WW LR +YQG+ PPVKRTE DFDP +KYHI    +YIRYFVSF+IQFQF++++C+I+G+KGPLHRC+ Y SKEAG +L +ML  G S+ W   MK+LTG T++ +  +LK+F+PL KWLK  N+  +  IGW
Sbjct:  109 PQLRRQFKLLLILGRSALDPKKLRELNLCKADMANIYGSSKICLHVKGSKYDHKCNLALEPDLIDIMANSTNYKELLQVWKQWRDTVGPPIKKKYLRYVELSNEAARLNGFRDEGA-NWRKSYESVTFQRDIENLWRQVKPLYQHLHAYVRRRLIQLFGESKIRCNGPIPAHLLGNMWAQDWSNLIEYLKPFPTKPSFDVTQKMVAKKMTPLDIVKL---SEKFFTSLGLKAMTQEFWNKSIFEKPKDREMVCHPSAWDFCNGKDFRIKMCTEVNMDFLVITHHEMGHVQYYMQYANQPPTFRKGANEGFHEAIGDVMALSISTPKHLKTIGLLDNYTEDEENDLNFLMSTALKKVAFLPFGYIVDQWRWKVFSGKISPSQWNTEWWKLRLKYQGVCPPVKRTERDFDPAAKYHIPGDTAYIRYFVSFIIQFQFHQALCDIAGHKGPLHRCDIYNSKEAGKRLAQMLQMGSSRPWPVAMKVLTGKTKMDAGPILKYFEPLLKWLKEKNE--DEIIGW 619          
BLAST of Angiotensin-converting enzyme vs. TrEMBL
Match: A0A087UCM7 (Angiotensin-converting enzyme (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_17580 PE=3 SV=1)

HSP 1 Score: 448.358 bits (1152), Expect = 6.583e-146
Identity = 222/493 (45.03%), Postives = 308/493 (62.47%), Query Frame = 2
Query:  563 ELIHINNDISYIYNNAKPCFNKCLEVG------ESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKFDK-SGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSES--LLKFFDPLYKWLKFTNKKLNIPIGW 2014
            EL  I  D+  IY+ AK C  K L         E  + ++  T  DY++L   W  WRN TG+K+K  +++ ++L N  S+ NG  D         +E DDF+     L+  I P YK +H YVR  L + YP    K  GPIPAH+ GN+WAQ W NI P +    +K   +     +     KM +  MFT+++EF+ S+G+ KMT EFW  S++ KP+D+ + CH SA DF +G D RIKMCT  NM DF T+HHEMGHIEY++ Y+H PT+FR  AN GFHEAIGD +AL+V TP+H  K+GL+  V + K  DI+YLM  AL KV FLPFA  MD++ W L++G +   E+N  WW++R +YQGL PPVKRT +D D   KYH    V YIRYFV+ +IQFQF++++C+ +G++GPLH+C+ Y+S+ AG  L +M+  G S +W + M+I+T     K ++  LL++FDPL KWL   NK  N  +GW
Sbjct:  136 ELSEIVADMQDIYSRAKICSYKSLSKKDCNLSLEPELTEILATSTDYDELKHVWAGWRNATGKKMKDKYVKYVKLSNKASQLNGFSDTGMLWREV-YESDDFEEDIEALFQKIKPFYKHMHAYVRRKLIQRYPKHGIKPDGPIPAHLLGNMWAQTWGNILPEVMPYPKK---KELDITSVMKEKKMKIIDMFTMSDEFFASVGLKKMTSEFWNNSIIEKPRDREMVCHASAWDFYDGKDVRIKMCTRLNMNDFKTVHHEMGHIEYFLQYAHQPTVFRRGANPGFHEAIGDVMALSVSTPQHWVKVGLVDDVEEDKEADINYLMGVALNKVVFLPFAYVMDNWRWKLFSGEIKEDEMNSEWWNMRLKYQGLCPPVKRTNEDLDAACKYHTISDVKYIRYFVAHIIQFQFHKALCDAAGHEGPLHKCDIYRSENAGKLLRDMMRLGSSVHWEKAMQIITNGKTYKMDAKPLLEYFDPLIKWLHEKNK--NETVGW 622          
BLAST of Angiotensin-converting enzyme vs. Ensembl Cavefish
Match: ace (angiotensin I converting enzyme [Source:NCBI gene;Acc:103040258])

HSP 1 Score: 439.113 bits (1128), Expect = 9.935e-139
Identity = 229/604 (37.91%), Postives = 353/604 (58.44%), Query Frame = 2
Query:  251 ESYP-NVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLE--LKKRFQRXXXXXXXXXXXXXXXXXX-XXXXXPELRRKFRLITASIRNENESLVHELIHINNDISYIYNNAKPCFN--KCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGK-FDKSGPIPAHIFGNVWAQQWTNIFPIIR--------DCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            E YP +V D+   E  AK +  + N  +    N +    + Y+T+IN+ N +  L+K  +         L+ +       +      + +K   +  ++ ++++  + E  ++   +   Y+ AK C +   CL + +  + K+    +DY++L   W  WRN +G+++++ ++R ++L N+ +R NGH D   +  S  +E   F+     L+  + PLY  LH YVR  L K Y  K  +  GPIPAH+ GN+WAQ W+ I  ++R        D  Q + A+ +              +MF  +E F+ S+G+  M DEFW++SML KP D + V CH SA DF N  DFRIK CT  NM D  T+HHEMGH++Y++ Y   P  FR  AN GFHEAIGD +AL+V TP+HLH IGL+ ++ ++    I++LM+ AL+K+AFLPF   MD + W +++G +  SE NK WW+LR +YQGL PPV RTE DFDPG+K+HI   V Y+RYFVSF++QFQF++++C+ +G+ GPLH C+ YQSKEAG  L +++  G S+ W E M ++TG  ++  + L+++F PL  WL+  N K    +GW
Sbjct:  621 EGYPEDVADKITDEAQAKQFLAEYNSTAETVWNAYTEASWSYNTNINEANKQNMLEKNLEMANHTKTYGLEARKYDTSDFQDSSVKRILKKLSDLERAVLSDDD--LKEYNNLLASMETTYSVAKVCKDDGTCLPL-DPDLNKIMAESRDYDELLFAWQGWRNASGRELRQSYVRYVELANLAARSNGHADNGAFWRSL-YETPTFEEDLEALWKDLQPLYLNLHSYVRRALFKKYGAKRINLKGPIPAHLLGNMWAQTWSGIMDLVRPYPNAAQVDVTQAMIAKGWD-----------ANRMFRESENFFTSVGLLPMPDEFWQKSMLEKPTDGREVVCHASAWDFYNRKDFRIKQCTVINMDDLITVHHEMGHVQYFLQYKDQPISFRDGANPGFHEAIGDVLALSVSTPKHLHTIGLLDKLEENAESTINFLMSIALDKIAFLPFGYLMDQWRWKVFDGRISSSEYNKEWWNLRLKYQGLCPPVTRTEVDFDPGAKFHIPANVPYVRYFVSFVVQFQFHKALCDTAGHTGPLHNCDIYQSKEAGKLLGDVMKLGFSKPWPEAMAMITGQPQMSVQPLMEYFQPLITWLEQENAKNGDVLGW 1209          

HSP 2 Score: 409.068 bits (1050), Expect = 1.378e-127
Identity = 200/484 (41.32%), Postives = 293/484 (60.54%), Query Frame = 2
Query:  575 INNDISYIYNNAKPCFN--KCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFY-PGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            I + +  IY+ AK C    +C  + E  + ++    + Y+KL   W  W NV+G  +K L+   +QL N  S  +G +D   Y  S+ +E   F+     L+  + PLY+ LH +VR  L  FY P   +  GPIPAH+ GN+W+Q W NI+ ++     K + +       +N +      MF +AEEF+ S+G+ +M  +FW++SML KP D + V CH SA DF N  DFRIK CT   M    T+HHEMGH+EYY+ Y   P  FR  AN GFHEA+GD ++L+V TP+HLH IGL+  +P+    DI+YL+  ALEK+AFLPF   +D + WG+++G  P    N  WW LR +YQG+ PPV+RTE+ FDPG+KYHI     YIRYFVSF++QFQF++ +C  +G+ GPLH C+ Y+S +AG  L ++L  G S+ W E ++   G  ++ + +L+++F P+  WL+  N+     +GW
Sbjct:  132 ILSQMDNIYSTAKVCPKPEECWAL-EPELKEILANSQSYKKLLYAWEGWHNVSGIPLKDLYPEFVQLSNNASVMDGFDDTGAYWRSW-YESPTFEQDLENLFKQLQPLYQNLHAFVRRKLYDFYGPKYINLKGPIPAHLLGNMWSQTWNNIYNMMIPFPDKPNVDVTNAMVEKNYN---ATHMFRVAEEFFTSLGLKEMPQKFWDKSMLEKPDDGREVVCHASAWDFYNREDFRIKQCTIVTMEQLFTVHHEMGHVEYYLQYKDQPVSFRRGANPGFHEAVGDVLSLSVSTPKHLHTIGLLDTLPNDNETDINYLLKMALEKIAFLPFGYLIDQWRWGVFSGRTPPERYNAEWWYLRTKYQGICPPVRRTEEHFDPGAKYHIPGNTPYIRYFVSFILQFQFHQKLCQEAGHTGPLHTCDIYRSTQAGAVLEKVLQAGSSKPWTEVLQEALGTNKMDAAALMEYFLPVTTWLEEQNRLTGETLGW 610          
BLAST of Angiotensin-converting enzyme vs. Ensembl Cavefish
Match: ace2 (angiotensin I converting enzyme 2 [Source:NCBI gene;Acc:103030208])

HSP 1 Score: 349.747 bits (896), Expect = 2.366e-109
Identity = 182/505 (36.04%), Postives = 281/505 (55.64%), Query Frame = 2
Query:  566 LIHINNDISYIYNNAKPC-----FNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLS---------FDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPV------EQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKV-VNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLI-SRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            L  + N++S IY+    C     F+ C +  E G+ ++    +DY +    W  WR   G+K++KL+     L+N  ++ N ++D   Y  +         + +  D+       +Y  I+PLYKELH YVR  L   YPG    +G +PAH+ G++W + WTN++P+         A  Y D+   ++S   V      E++F  AE+F+ S+ M  M   FW  SML+KP D   V CH +A D  N  DFRIKMCT+ NM DF T HHEMGH +Y MAY HLP + R  AN GFHEA+G+ ++L+  TP HL  +GL+ +   +    DI++L+  AL  VA LPF   ++ + W ++ G++P  +    WW+++    G+  P+ R E   DP + +H+S   S+IRYF   + QFQ  +++C  +G+ GPL++C+   S +AG KL +ML  G+S++W   ++ + G T + +  LL +F  LY+WLK  N+K N   GW
Sbjct:  115 LSKVLNEMSTIYSTGTVCKIDNPFD-C-QTLEPGLEEIMANSRDYYERLHVWEGWRVQVGKKMRKLYEEYADLKNEAAKLNNYKDYGDYWRANYETEDEPKYSYSRDELMRDVRSIYSEIMPLYKELHAYVRAKLQNTYPGHIASNGGLPAHLLGDMWGRFWTNLYPL---------AVPYPDKPDIDVSPAMVAQGWDEERLFKEAEKFFVSVNMSAMFPNFWTNSMLTKPTDGTKVVCHPTAWDMGNREDFRIKMCTKVNMDDFLTAHHEMGHNQYQMAYRHLPYLLRDGANEGFHEAVGEIMSLSAATPSHLQSLGLLPADFTEDMETDINFLLKQALTIVATLPFTYMLEEWRWQVFQGTIPKDQWMLRWWEMKRELVGVTEPLPRDESYCDPPALFHVSGDYSFIRYFTRTVYQFQLQDALCKEAGHTGPLYKCDITNSTDAGNKLRDMLELGRSKSWTRALEQVCGDTRMDARPLLSYFSTLYEWLKEENQKNNRASGW 608          
BLAST of Angiotensin-converting enzyme vs. Ensembl Sea Lamprey
Match: ace (angiotensin I converting enzyme (peptidyl-dipeptidase A) 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1826])

HSP 1 Score: 429.098 bits (1102), Expect = 1.012e-135
Identity = 228/595 (38.32%), Postives = 352/595 (59.16%), Query Frame = 2
Query:  251 ESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLI----TASIRNENESLVHELIHINNDISYIYNNAKPCFNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHED-AATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGK-FDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            + YP   D+   E  A    ++ N  + +  + +    + Y+TDI +++ +L +      +   L   R +  + W +F+   +RR+ + I    TA++    E+ + E   I + +   Y+ AK C  +     +  I  +    ++Y++L  YW  WR+ +G+K+++ ++R ++L N  +  NG  D  A +  ++D E   F++   ++Y  + PLY  LH YVR  L++ Y  +  +  GPIPAH+ GN+WAQ W N+  ++       +A +          K   + MF +++ F+ S+GM  M  EFW++SML KP D + V CH SA DF N  DFRIK CT   M D  T+HHEMGH++Y++ Y   P  FR  AN GFHEAIGD +AL+V TP+HL +IGL+  V D+   DI++L++ AL+K+AFLPF   MD + W +++G +P  + NK WW+LR +YQGL PPV RTEDDFDPGSK+HI   V Y RYFVSF+IQFQF E++C  +G KG LH+C+ Y+SK+AG KL +++  G S+ W+E M+++TG   + + +LLK+F PL  WL   N+K    +GW
Sbjct:  639 DDYPGNLDKITDETQAIALLEEYNTTAEKYWSEYNEASWTYNTDITEEHDKLVQEANLRMANHSLYFGRDALLYDWSNFQDEGVRRQLKKISQIGTAALP---ETELKEYNEIVSRMETAYSVAKVCRGETCIPLDPDITAIMAESRNYDELLYYWQGWRDASGRKMREDYVRYVELSNKAAIANGFPDNGAQWRSAYDTET--FEADLERIYEELKPLYLNLHAYVRRKLHQHYGDEHVNLKGPIPAHLLGNMWAQSWNNLNSLVAPFP---NAPSVDATPAMQAQKWTPKMMFNVSDVFFTSLGMIPMPREFWDKSMLEKPTDGREVVCHASAWDFYNRKDFRIKQCTVVTMDDLVTVHHEMGHVQYFLQYKEQPVPFRDGANPGFHEAIGDVMALSVATPKHLKEIGLLETVEDNSESDINFLLSMALDKIAFLPFGFLMDQWRWKVFDGRIPTEDYNKEWWNLRMKYQGLCPPVARTEDDFDPGSKFHIPASVPYDRYFVSFVIQFQFQEALCAAAGQKGDLHKCDIYKSKDAGDKLAKVMQLGSSRRWQEAMEMITGQQNMSAAALLKYFKPLTDWLVKENQKNGEVLGW 1225          

HSP 2 Score: 378.637 bits (971), Expect = 6.958e-117
Identity = 201/495 (40.61%), Postives = 286/495 (57.78%), Query Frame = 2
Query:  581 NDISYIYNNAKPC------FNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQ------MFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKG---FDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            +D+  IY+  K C         C  + +  I  +  T + Y+KL  YW  W NV G+ +   + R ++L N  S+ +   D   Y  S+ +E   F+    ++Y  + PLY  LH YVR  L++ Y  KF +  GPIPAH+ GN+W+QQW NIF ++           Y  + + +++   VEQ      MF  +E+F++ +G+ +M  EFW  SML KP D + V CH SA DF N  DFRIK CT   M    T+HHEMGHIEYY+ Y      FRG AN GFHEAIGD ++L+V TP HL  IGL+   PD  G    DI+YLM  ALEK+AFLPF   +D + W +++G  P    N+ WW LR +YQG+ P V R   DFD G+K+HI     YIRYFVSF+IQFQF +++C  +  KGPL++C+  +++ AG  L + +  G S+ W E MK +TG  ++ +  L+++F P+  WL+  N  +N  +GW
Sbjct:  149 SDMDAIYSTGKVCKPGQTSGTDCAPL-DPTITDILATSRSYKKLLYYWEGWHNVVGRPLHSKYARFVELSNAASQLDDFADTGEYWRSW-YESATFRDDLERIYEELKPLYLNLHAYVRRKLHQHYGEKFVNLKGPIPAHLLGNMWSQQWNNIFDMVVP---------YPGKTSVDVTDTMVEQGWNATHMFRTSEDFFKDLGLLEMPPEFWSGSMLEKPADGREVVCHASAWDFYNRKDFRIKQCTIPTMEQLFTVHHEMGHIEYYLQYKDQHVSFRGGANPGFHEAIGDVLSLSVSTPTHLKTIGLLG--PDYVGDKESDINYLMKMALEKIAFLPFGYLIDLWRWDVFSGKTPPERYNQDWWYLRTKYQGICPGVPRKSTDFDAGAKFHIPGNTPYIRYFVSFIIQFQFQKALCTAAQDKGPLYKCDIDKNQAAGNLLRKAMQMGSSRPWTEVMKEMTGTDKMSALPLIEYFKPVIDWLEKEN--VNETLGW 628          
BLAST of Angiotensin-converting enzyme vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004373.1 (pep scaffold:Pmarinus_7.0:GL477858:25443:42821:1 gene:ENSPMAG00000003990.1 transcript:ENSPMAT00000004373.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 262.307 bits (669), Expect = 3.601e-81
Identity = 145/394 (36.80%), Postives = 211/394 (53.55%), Query Frame = 2
Query:  500 LRRKFRLITASIRNENESLVHELIHINNDISYIYNNAKPC------FNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQ------MFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLI--SRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLR 1633
            L R+ R++ ++  N + +   EL  +   +   Y+    C         C  + E  +  +  T + Y +L  YW  WR   G+ ++  +   +QL N  SR +G  D   +  S  +E + F++   +LY  + PLY  +H YVR  L++ Y  +  +  GPIPAH+ G++WAQQW  I+ ++           Y  +   +++   VEQ      MF ++EEF+ S+G+ +M  EFW  SML KP D + V CH SA DF N  DFRIK CT   M D    HHEMGH++Y++ Y   P  FR  AN GFHEAIGD +AL+V TP HL KIGL+  S V D    DI++L+  AL K+AFLPF   +D + W +++G  P    N  WW LR
Sbjct:   25 LLREMRIMGSA--NLHPAAREELNRVILQMQTTYSTGAVCKPGHSSGPDCFPL-EPELDHIMATSRSYTQLLYYWEGWRTDVGRPLRAPYAHFVQLSNEASRADGFADTGEFWRSV-YETETFRADLERLYDELRPLYLHMHAYVRRRLHRRYGERLVNLRGPIPAHLLGDMWAQQWQGIYDLV---------VPYPGKTRVDVTSAMVEQGWNTTHMFRVSEEFFTSLGLMEMPPEFWNGSMLEKPADGREVVCHASAWDFYNRKDFRIKQCTSVTMTDLVRAHHEMGHVQYFLQYKEQPVPFRRGANPGFHEAIGDVMALSVATPRHLKKIGLLEPSYVEDPAESDINFLLWMALGKIAFLPFGFLVDQWRWDVFSGHTPPGRYNHDWWHLR 405          
BLAST of Angiotensin-converting enzyme vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004370.1 (pep scaffold:Pmarinus_7.0:GL477858:22090:39821:1 gene:ENSPMAG00000003990.1 transcript:ENSPMAT00000004370.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 220.32 bits (560), Expect = 1.869e-65
Identity = 113/282 (40.07%), Postives = 159/282 (56.38%), Query Frame = 2
Query:  644 ESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQ------MFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLI 1465
            E  +  +  T + Y +L  YW  WR   G+ ++  +   +QL N  SR +G  D   +  S  +E + F++   +LY  + PLY  +H YVR  L++ Y  +  +  GPIPAH+ G++WAQQW  I+ ++           Y  +   +++   VEQ      MF ++EEF+ S+G+ +M  EFW  SML KP D + V CH SA DF N  DFRIK CT   M D    HHEMGH++Y++ Y   P  FR  AN GFHEAIGD +AL+V TP HL KIGL+
Sbjct:  132 EPELDHIMATSRSYTQLLYYWEGWRTDVGRPLRAPYAHFVQLSNEASRADGFADTGEFWRSV-YETETFRADLERLYDELRPLYLHMHAYVRRRLHRRYGERLVNLRGPIPAHLLGDMWAQQWQGIYDLVVP---------YPGKTRVDVTSAMVEQGWNTTHMFRVSEEFFTSLGLMEMPPEFWNGSMLEKPADGREVVCHASAWDFYNRKDFRIKQCTSVTMTDLVRAHHEMGHVQYFLQYKEQPVPFRRGANPGFHEAIGDVMALSVATPRHLKKIGLL 403          
BLAST of Angiotensin-converting enzyme vs. Ensembl Nematostella
Match: EDO37947 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEG1])

HSP 1 Score: 425.246 bits (1092), Expect = 8.417e-141
Identity = 206/507 (40.63%), Postives = 306/507 (60.36%), Query Frame = 2
Query:  497 ELRRKFRLITASIRNENESLVHELIHINNDISYIYNNAK-PCFNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            + +R+ +LI AS   +N + +     +N+ +  IY++ K    N  +      + K+    +DYE+L   W  WR+  G  I+ L+ + + + N G++ENG +D   Y  S  +E ++ +  A  LY  + PLY+ELH YVRY L++ Y  +      IPAH+FGN+WAQ W NI+ ++   G + S +  ++   +  +++   +M  +AE F+ SIG+  +   F+ RSM+ KP+D+ V CH SA DF    D RIK CT        T HHE+GHI+Y++ Y+H P  +R  AN GFHEA+GDT++L+V TP HLH+IGL+  V ++   DI+ LM  AL KVAFLPF   +D + W ++ G +     N+ WW+LR +YQG+ PPV RTE+DFDPG+KYHI     YIRYFVS++IQFQF+++ C  +G+ GPLH+C+ Y S  AG KL  ML  GKS+ W + +K +TG  E+    L ++F PL  W+K    K   PIGW
Sbjct:   95 DTKRQIKLIAASASPKNPADIKRKSELNSQMDKIYSSGKVKDANGEMLSLNPDLYKILAESRDYERLLFVWKGWRDAVGPAIRPLYQQFVDISNKGAKENGWKDNGEYWRS-SYEVENLERIAEGLYSDLKPLYQELHAYVRYKLSQQY-SQVKSGDAIPAHLFGNMWAQSWANIYDLVEPYGNQSSLDVTRNMVKQGYTEL---RMVQLAESFFTSIGLDPLPQSFYNRSMIVKPKDRGVVCHASAWDFLISRDVRIKQCTTITHDSLVTTHHELGHIQYFLQYAHQPYEYRTGANPGFHEAVGDTLSLSVDTPAHLHRIGLLDAVSNNTESDINALMKMALSKVAFLPFGFLIDQWRWRVFRGEITPQNYNRKWWELRTKYQGIKPPVCRTENDFDPGAKYHIPANTPYIRYFVSYVIQFQFHKAACEAAGHTGPLHKCSIYNSTAAGGKLGAMLKLGKSKPWPQALKAMTGTEEMDVGPLTEYFKPLITWMKAQRAKHGYPIGW 596          
BLAST of Angiotensin-converting enzyme vs. Ensembl Nematostella
Match: EDO35659 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKY7])

HSP 1 Score: 422.165 bits (1084), Expect = 2.236e-134
Identity = 209/513 (40.74%), Postives = 313/513 (61.01%), Query Frame = 2
Query:  497 ELRRKFRLITASIRNENESLVHELIHINNDISYIYNNAKPCFNKCLEVG-ESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFT------IAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            + RR+ +++T +  + ++ +   L  +   +  IY + K       ++  +  + K+    +DYE+L   W  WR+ TG +++ L+ + ++L N G++ENG  D   +  S+ +E D+ +S+   LY  + PLY+ELH YVRY L+K Y  +   +GPIPAH+FGN+WAQ W NI+ II         E Y+++ + +++K  V Q +T      +AE F+ SIG+  +   F+E+SM+ KP+ + V CH SA DF    D RIK CT        T HHE+GHI+YY+ Y   P  +R  AN GFHEA+GDT++L+V TP HL  IGL+  V +    DI+ LM  AL KVAFLPF   +D + W +++G +     N+ WW LR +YQG+ PPV RTE+DFDPG+KYHI     YIRYFVSF++QFQF+++ C  +G++GPLH+C+ Y S EAG KL +MLS GKS+ W   ++ +TG  ++   SL ++F PL  WLK   ++    IGW
Sbjct:  562 DTRRQIKMVTETASSSDKDVQKTLNDVEGKMDQIYGSGKVIDTDGSKLSLDPHLYKILSNSRDYERLKFVWKGWRDATGPELRPLYKQFVELANKGAKENGWADNGEWWRSW-YEIDNLESSVEALYEDLRPLYEELHAYVRYKLSKKY-SQVKPTGPIPAHVFGNMWAQSWVNIYDII---------EPYENQPSLDVTKTMVAQNYTQLRMVQLAESFFTSIGLKALPMSFYEKSMIVKPEGREVQCHASAWDFKINRDVRIKQCTTITHNYLVTTHHELGHIQYYLQYWDQPFEYRTGANPGFHEAVGDTLSLSVDTPTHLKLIGLLDAVSNDSKSDINALMKMALRKVAFLPFGFLIDQWRWKVFSGDITSDNYNREWWKLRTKYQGIKPPVCRTENDFDPGAKYHIPGNTPYIRYFVSFVLQFQFHKAACEAAGHQGPLHKCSIYNSTEAGKKLGDMLSLGKSKPWPLALEQMTGTRKMDVSSLKEYFKPLSDWLKSQRQEYKYTIGW 1063          

HSP 2 Score: 368.237 bits (944), Expect = 3.605e-114
Identity = 190/486 (39.09%), Postives = 286/486 (58.85%), Query Frame = 2
Query:  581 NDISYIYNNAK---PCFNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDF----SNG-VDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            ++++ IY++AK   P     L +    + +L    ++  +L   W  WR VTG K++ LF   + L N G+++NG ++   Y     +E  + +     ++  +  LY ELH YVR  L++ YP     S  IPAH+ GN+WAQ W NI+P++     K S +  ++   +N + +   +M  +AE F+ SIG  K+   F+ +SM  KP+D+ V CH +A DF    S G  D RIK CTE    D    HHEMGHI Y++ Y   P I+R  AN  FHEA+GDTIAL+V TP HL K+ L+    + K  +I+ LM  AL K+AFLPF   ++ + W +Y G +  SE NK WW+LR ++QG+ PP+ R E  FDPGSK+HI+    YI+YF+S ++QFQ ++++C+I+G   PLH+C+ Y S +AG KL  ML  G+S+ WR+T++  TG+ ++    L ++F PLY+WL     +    IGW
Sbjct:    8 SEMTEIYSSAKVTNPAIGTNLSLNPQ-LTELMANSRNSPELLAAWRDWRQVTGPKMRPLFKDCVTLANQGAKDNGFQNMYEYQTHL-YELPNLEEYIDGIWQELKVLYLELHAYVRQRLSEQYPHVLS-SQAIPAHLLGNMWAQNWVNIYPLVEPYSGKPSLDVTKNLRQQNYTAV---KMVQLAEAFFRSIGFEKLPGSFYSKSMFEKPEDREVLCHAAALDFFEKNSKGEKDVRIKQCTEITHQDLIITHHEMGHIYYFLKYWDQPYIYRDGANPAFHEALGDTIALSVDTPRHLVKVKLLDEYMEDKEAEINALMKMALSKIAFLPFGYLLEKWRWQVYTGEIDSSEYNKKWWELRVKHQGVRPPISRDETTFDPGSKFHIAANARYIQYFLSRILQFQLHKTVCDIAGINEPLHKCSIYNSTKAGQKLSAMLEMGRSKPWRDTLEAFTGSRDMSVNPLKEYFHPLYQWLVEQRCQNKYKIGW 487          
BLAST of Angiotensin-converting enzyme vs. Ensembl Nematostella
Match: EDO34063 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQE7])

HSP 1 Score: 395.586 bits (1015), Expect = 2.353e-131
Identity = 205/489 (41.92%), Postives = 285/489 (58.28%), Query Frame = 2
Query:  581 NDISYIYNNAKPCFN-----KCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQD----EATENLSKM--PVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
             +++ IY+  K C N      C+ + +  +  L    ++ ++L   W  WR+     ++ +F + + L N G+R++G  D   +        +DF +   KL+  + PLYKELH YVR+ L K Y G    SGPIPAH+ GN+WAQ W  I+ ++         + Y D    + T +L K     E+MF +A+ F+ SIG+  M   FW +SML KP +K V CH SA DF    D RIKMCT     D  TIHHEMGH EY++AY   P  +R  AN GFHEAIGDTIAL+V TP+HL+ +GL+  +P      I++LM  AL  VA LPF   +D + W +  G +  S  N  WW +R  YQG+ PPV R E DFDPG+K+HI     YI YFVS ++QFQF+ ++CN+  + GPLH C+ YQSKEAG K  EML+ G+S+ W +T+  LTG  E+ ++ LL++F PL KWL     K N  +GW
Sbjct:    3 TNMTEIYSTGKVCLNITRNNTCMSL-DPDLGNLMSRSRNQDELVWAWRGWRDAVAPPVRGMFQQMVDLLNKGARQHGLGDYGHFERGEYEMGNDFTAVIKKLWTDVKPLYKELHAYVRFQLKKKYAG-MSGSGPIPAHLLGNMWAQNWDGIYDMV---------QPYPDATPLDVTPSLIKQHYTPEKMFKLAQSFFVSIGLDPMPKSFWNKSMLRKPGNKSVVCHASAFDFLKD-DVRIKMCTRLKQEDLITIHHEMGHCEYFLAYKDQPYAYRNGANPGFHEAIGDTIALSVVTPKHLNSVGLLYTLPKGDEASINFLMTQALSHVAPLPFTYLVDQWRWKVLAGEISPSNYNSAWWRMRTLYQGVKPPVARNESDFDPGAKFHIVSNSPYIGYFVSLILQFQFHRALCNLVKHTGPLHECSIYQSKEAGKKFKEMLAAGRSRPWPQTLFKLTGEREMSADPLLEYFAPLRKWLFNYRIKNNYTLGW 479          
BLAST of Angiotensin-converting enzyme vs. Ensembl Nematostella
Match: EDO29688 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2Y1])

HSP 1 Score: 394.815 bits (1013), Expect = 6.545e-131
Identity = 203/489 (41.51%), Postives = 284/489 (58.08%), Query Frame = 2
Query:  581 NDISYIYNNAKPCFN-----KCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQD----EATENLSKM--PVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
             +++ IY+  K C N      C+ + +  +  L    ++ ++L   W  WR+     ++ +F + + L N G+R++G  D   +        +DF +   KL+  + PLYKELH YVR+ L K Y G    SGPIPAH+ GN+WAQ W  I+ ++         + Y D    + T +L K     E+MF +A+ F+ SIG+  M   FW +SML KP +K V CH SA DFS      IKMCT     D  TIHHEMGH EY++AY   P  +R  AN GFHEAIGDTIAL+V TP+HL+ +GL+  +P      I++LM  AL  VA LPF   +D + W +  G +  S  N  WW +R  YQG+ PPV R E DFDPG+K+HI     YI YFVS ++QFQF+ ++CN++ + GPLH C+ YQSKEAG K  EML+ G+S+ W +T+  LTG  E+ ++ LL++F PL KWL     K    +GW
Sbjct:    3 TNMTEIYSTGKVCLNITRNNTCMSL-DPDLGNLMSRSRNQDELVWAWRGWRDAVAPPVRGMFQQMVDLLNKGARQHGLGDYGHFERGEYEMGNDFTAVIKKLWTDVKPLYKELHAYVRFQLKKKYAG-MSGSGPIPAHLLGNMWAQNWDGIYDMV---------QPYPDATPLDVTPSLIKQHYTPEKMFKLAQSFFVSIGLDPMPKSFWNKSMLRKPGNKSVVCHASAFDFSKMTSGAIKMCTRLKQEDLITIHHEMGHCEYFLAYKDQPYAYRNGANPGFHEAIGDTIALSVVTPKHLNSVGLLYTLPKGDEASINFLMTQALSHVAPLPFTYLVDQWRWKVLAGEISPSNYNSAWWRMRTLYQGVKPPVARNESDFDPGAKFHIVSNSPYIGYFVSLILQFQFHRALCNLAKHTGPLHECSIYQSKEAGKKFKEMLAAGRSRVWPQTLFKLTGEREMSADPLLEYFAPLRKWLFNYRIKNKYTLGW 480          
BLAST of Angiotensin-converting enzyme vs. Ensembl Nematostella
Match: EDO28297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6V7])

HSP 1 Score: 265.388 bits (677), Expect = 3.176e-83
Identity = 148/354 (41.81%), Postives = 197/354 (55.65%), Query Frame = 2
Query:  959 SGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKM--PVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            SGPIPAH+ GN+WAQ W  I+ +++        +      T +L K     E+MF +A+ F+ SIG+  M   FW +SML KP +K V CH SA DF    D RIKMCT     D  TIHHEMGH EY++AY   P  +R  AN GFHEAIGDTIAL+V TP+HL+ +GL+  +P      I++LM  AL  VA LPF                             YR+  +   +    D  D      I   + Y RYFVS ++QFQF+ ++CN+  + GPLH C+ YQSKEAG K  EML+ G+S+ W +T+  LTG  E+ ++ LL++F PL KWL     K N  +GW
Sbjct:    4 SGPIPAHLLGNMWAQNWDGIYDMVQPYPDATPLD-----VTPSLIKQHYTPEKMFKLAQSFFVSIGLDPMPKSFWNKSMLRKPGNKSVVCHASAFDFLKD-DVRIKMCTRLKQEDLITIHHEMGHCEYFLAYKDQPYAYRNGANPGFHEAIGDTIALSVVTPKHLNSVGLLYTLPKGDEASINFLMTQALSHVAPLPFTFDF-------------------------YRHDFIDITLFHRYDFID---MTFIDMTLLY-RYFVSLILQFQFHRALCNLVKHTGPLHECSIYQSKEAGKKFKEMLAAGRSRPWPQTLFKLTGEREMSADPLLEYFAPLRKWLFNYRIKNNYTLGW 322          
BLAST of Angiotensin-converting enzyme vs. Ensembl Medaka
Match: ENSORLT00000005403.2 (angiotensin-converting enzyme-like [Source:NCBI gene;Acc:111946416])

HSP 1 Score: 407.527 bits (1046), Expect = 3.105e-133
Identity = 195/447 (43.62%), Postives = 279/447 (62.42%), Query Frame = 2
Query:  677 KDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            + Y  L   W AW N  G  +KKL+ R ++L N  SR +G  D   +  S+D + + F+     LY  I PLY  LH +VR  L   Y  K+ +  GPIPAH+ GN+WAQ W NI+ ++     K++ +   +   +  +      MF +AEEF+ S+G+ +M  EFWE SM+ KP D+ V CH SA DF N  DFRIK CT+  M +F T+HHEMGHI+YY+ Y + P  FR  AN GFHEAIGD +AL+V TP+HLHKI L+      +  ++++L+  AL+K+AFLPF   +D + WG+++   P    N  WW LR +YQG+ PP++RTE+ FDPG+K+HI     YIRYFVSF++QFQ +E +C  + + GPLH C+ Y+SKEAG  L ++L  G S+ W E ++   G  +I + SL+K+FDP+ +WL+  N  +N  +GW
Sbjct:   94 RSYNLLLFTWEAWHNTAGVPLKKLYSRFVELSNKASRADGFADTGAWWRSWDDDSETFEQDMDNLYKTIQPLYLHLHAFVRRKLYNQYGSKYINLKGPIPAHLLGNMWAQTWNNIYDLMIPFPGKVNVDVTDEMVRQGYN---ATHMFRVAEEFFTSLGLMEMPKEFWEGSMIVKPNDRDVVCHASAWDFYNRKDFRIKQCTKVTMDEFFTVHHEMGHIQYYLQYKNQPVGFRDGANPGFHEAIGDLMALSVSTPKHLHKINLMKSAESDEETNLNFLLNMALQKIAFLPFGYLVDLWRWGVFSEKTPPERYNADWWYLRTKYQGICPPIRRTEEQFDPGAKFHIPNNTPYIRYFVSFILQFQLHEKLCEAANHTGPLHTCDIYRSKEAGTILKKILEPGSSRPWPELLQETIGTNKIDASSLMKYFDPVIRWLEKQN--VNETLGW 535          
BLAST of Angiotensin-converting enzyme vs. Ensembl Medaka
Match: ace (angiotensin I converting enzyme [Source:NCBI gene;Acc:101172772])

HSP 1 Score: 418.698 bits (1075), Expect = 7.803e-132
Identity = 228/598 (38.13%), Postives = 341/598 (57.02%), Query Frame = 2
Query:  251 ESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLITASIRN-ENESLVHELIHINNDISYIYNNAKPCFNKCLEVG-----ESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFY-PGKFDKSGPIPAHIFGNVWAQQWTNI--FPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            E YP   ++   E  AK   D+ N  +    N +    +KY+TDI   N +         S   LK   K++++    F+ P ++R    + A + + E  +L  E +   N +             C E G     +  + K+    +DY +L   W  WR+  G+ +++ + R ++L N  +  +G+ D      S  +E   F+     L+  + PLY+ +H YVR  L K Y P   +  GPIPAH+ GN+WAQ W+ I  F I      ++ A         N ++M     F  ++ F+ S+G+  M +EFWE+SML KP D + V CH SA DF N  DFRIK CT   M D  T+HHEMGH++Y++ Y   P  FR  AN GFHEAIGD +AL+V TP+HL  IGL+ +V ++   DI++LM+ AL+K+AFLPF   MD + W +++G +P +E NK WW+LR +YQGL PPV RTE+DFDPG+K+HI   V Y+RYFVSF+IQFQF++++C  + + GPLH C+ YQSKEAG  L +++  G S+ W E M I+TG +++ ++ L+++F+PL +WL+  N+     IGW
Sbjct:  545 EGYPEDIEKNTDELDAKRLLDEYNTTAEEVWNAYTEASWKYNTDITDANKQAMLNRSLEMSAHTLKYGLKAREYDTTDFQDPLVKR----VIAKLSDIERAALPPEELEEYNTLLSNMETKYSVAEVCREDGRCHPLDPDLQKIMAESRDYNELLFAWKGWRDAAGKVLRQDYERYVELANKAAVLDGYSDNGAMWRSL-YETPTFEEDLESLWMELQPLYQNVHAYVRRALYKKYGPQHINLKGPIPAHLLGNMWAQTWSGIMDFAIPYPGATQVDATPAMLAQGWNATRM-----FQESDRFFTSLGLLPMPEEFWEKSMLEKPSDGRQVVCHASAWDFYNRKDFRIKQCTVVTMDDLITVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAIGDVLALSVSTPKHLKSIGLLDKVEENYESDINFLMSMALDKIAFLPFGYLMDQWRWKVFDGRIPPNEYNKEWWNLRLKYQGLCPPVARTEEDFDPGAKFHIPANVPYVRYFVSFIIQFQFHKALCEAANHNGPLHTCDIYQSKEAGKLLSDVMKLGSSKPWPEAMAIITGQSKMSAQPLMQYFEPLIQWLQRENQMNGDVIGW 1132          

HSP 2 Score: 405.216 bits (1040), Expect = 8.515e-127
Identity = 205/483 (42.44%), Postives = 288/483 (59.63%), Query Frame = 2
Query:  575 INNDISYIYNNAK--PCFNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            I + +  IY+ AK  P  N    + E  +  +  T + Y+KL   W  W N +G  +KKL+   ++L N  S+ +G  D      S+ +E + F+     LY  I PLY  LH +VR  L   Y  K+ +  GPIPAH+ GN+WAQ W NI+ ++     K + +   +   +  +      MF ++EEF+ S+G+ +M  EFWE SM+ KP D+ V CH SA DF N  DFRIK CT   M    T+HHEMGHI+YY+ Y   P  FR  AN GFHEAIGD ++L+V TP+HLH I L+         DI+YL+  ALEK+AFLPF   +D + WG++NG  P  + N  WW LR ++QG+ PP KR+E+ FDPG+KYHI     YIRYFVSF++QFQF+E +C  + + GPLH C+ Y+S EAG  L ++L  G S+ W E ++   G  E+ + SLLK+F+P+ KWL+  N  +N  +GW
Sbjct:   59 ILSTMDSIYSTAKVYPQPNVSWSL-EPELTDIMATSRSYKKLLFAWDGWHNASGVPLKKLYPEFVELSNKASQADGFADTGADWRSW-YESETFEQDIDNLYKTIEPLYLHLHAFVRRKLYNQYGSKYINLKGPIPAHLLGNMWAQTWNNIYDLMIPFPNKPNLDVTDEMVRQGYN---ATHMFRVSEEFFTSLGLLEMPTEFWEGSMIVKPDDREVVCHASAWDFYNRKDFRIKQCTTVTMEQLFTVHHEMGHIQYYLQYKDQPVGFRRGANPGFHEAIGDVLSLSVSTPKHLHTINLLESAASDTETDINYLLKMALEKIAFLPFGYLIDLWRWGVFNGRTPPEKYNSEWWYLRTKFQGICPPTKRSEEHFDPGAKYHIPGNTPYIRYFVSFILQFQFHEKLCEAAKHTGPLHTCDIYRSAEAGEILRKVLQAGSSKPWPEVLQEAIGTREMNANSLLKYFEPVIKWLEEQN--VNETLGW 534          
BLAST of Angiotensin-converting enzyme vs. Ensembl Medaka
Match: ace (angiotensin I converting enzyme [Source:NCBI gene;Acc:101172772])

HSP 1 Score: 418.698 bits (1075), Expect = 7.803e-132
Identity = 228/598 (38.13%), Postives = 341/598 (57.02%), Query Frame = 2
Query:  251 ESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLITASIRN-ENESLVHELIHINNDISYIYNNAKPCFNKCLEVG-----ESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFY-PGKFDKSGPIPAHIFGNVWAQQWTNI--FPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            E YP   ++   E  AK   D+ N  +    N +    +KY+TDI   N +         S   LK   K++++    F+ P ++R    + A + + E  +L  E +   N +             C E G     +  + K+    +DY +L   W  WR+  G+ +++ + R ++L N  +  +G+ D      S  +E   F+     L+  + PLY+ +H YVR  L K Y P   +  GPIPAH+ GN+WAQ W+ I  F I      ++ A         N ++M     F  ++ F+ S+G+  M +EFWE+SML KP D + V CH SA DF N  DFRIK CT   M D  T+HHEMGH++Y++ Y   P  FR  AN GFHEAIGD +AL+V TP+HL  IGL+ +V ++   DI++LM+ AL+K+AFLPF   MD + W +++G +P +E NK WW+LR +YQGL PPV RTE+DFDPG+K+HI   V Y+RYFVSF+IQFQF++++C  + + GPLH C+ YQSKEAG  L +++  G S+ W E M I+TG +++ ++ L+++F+PL +WL+  N+     IGW
Sbjct:  545 EGYPEDIEKNTDELDAKRLLDEYNTTAEEVWNAYTEASWKYNTDITDANKQAMLNRSLEMSAHTLKYGLKAREYDTTDFQDPLVKR----VIAKLSDIERAALPPEELEEYNTLLSNMETKYSVAEVCREDGRCHPLDPDLQKIMAESRDYNELLFAWKGWRDAAGKVLRQDYERYVELANKAAVLDGYSDNGAMWRSL-YETPTFEEDLESLWMELQPLYQNVHAYVRRALYKKYGPQHINLKGPIPAHLLGNMWAQTWSGIMDFAIPYPGATQVDATPAMLAQGWNATRM-----FQESDRFFTSLGLLPMPEEFWEKSMLEKPSDGRQVVCHASAWDFYNRKDFRIKQCTVVTMDDLITVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAIGDVLALSVSTPKHLKSIGLLDKVEENYESDINFLMSMALDKIAFLPFGYLMDQWRWKVFDGRIPPNEYNKEWWNLRLKYQGLCPPVARTEEDFDPGAKFHIPANVPYVRYFVSFIIQFQFHKALCEAANHNGPLHTCDIYQSKEAGKLLSDVMKLGSSKPWPEAMAIITGQSKMSAQPLMQYFEPLIQWLQRENQMNGDVIGW 1132          

HSP 2 Score: 405.216 bits (1040), Expect = 8.515e-127
Identity = 205/483 (42.44%), Postives = 288/483 (59.63%), Query Frame = 2
Query:  575 INNDISYIYNNAK--PCFNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            I + +  IY+ AK  P  N    + E  +  +  T + Y+KL   W  W N +G  +KKL+   ++L N  S+ +G  D      S+ +E + F+     LY  I PLY  LH +VR  L   Y  K+ +  GPIPAH+ GN+WAQ W NI+ ++     K + +   +   +  +      MF ++EEF+ S+G+ +M  EFWE SM+ KP D+ V CH SA DF N  DFRIK CT   M    T+HHEMGHI+YY+ Y   P  FR  AN GFHEAIGD ++L+V TP+HLH I L+         DI+YL+  ALEK+AFLPF   +D + WG++NG  P  + N  WW LR ++QG+ PP KR+E+ FDPG+KYHI     YIRYFVSF++QFQF+E +C  + + GPLH C+ Y+S EAG  L ++L  G S+ W E ++   G  E+ + SLLK+F+P+ KWL+  N  +N  +GW
Sbjct:   59 ILSTMDSIYSTAKVYPQPNVSWSL-EPELTDIMATSRSYKKLLFAWDGWHNASGVPLKKLYPEFVELSNKASQADGFADTGADWRSW-YESETFEQDIDNLYKTIEPLYLHLHAFVRRKLYNQYGSKYINLKGPIPAHLLGNMWAQTWNNIYDLMIPFPNKPNLDVTDEMVRQGYN---ATHMFRVSEEFFTSLGLLEMPTEFWEGSMIVKPDDREVVCHASAWDFYNRKDFRIKQCTTVTMEQLFTVHHEMGHIQYYLQYKDQPVGFRRGANPGFHEAIGDVLSLSVSTPKHLHTINLLESAASDTETDINYLLKMALEKIAFLPFGYLIDLWRWGVFNGRTPPEKYNSEWWYLRTKFQGICPPTKRSEEHFDPGAKYHIPGNTPYIRYFVSFILQFQFHEKLCEAAKHTGPLHTCDIYRSAEAGEILRKVLQAGSSKPWPEVLQEAIGTREMNANSLLKYFEPVIKWLEEQN--VNETLGW 534          
BLAST of Angiotensin-converting enzyme vs. Ensembl Medaka
Match: ace (angiotensin I converting enzyme [Source:NCBI gene;Acc:101172772])

HSP 1 Score: 420.239 bits (1079), Expect = 9.894e-132
Identity = 228/598 (38.13%), Postives = 341/598 (57.02%), Query Frame = 2
Query:  251 ESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLITASIRN-ENESLVHELIHINNDISYIYNNAKPCFNKCLEVG-----ESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFY-PGKFDKSGPIPAHIFGNVWAQQWTNI--FPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            E YP   ++   E  AK   D+ N  +    N +    +KY+TDI   N +         S   LK   K++++    F+ P ++R    + A + + E  +L  E +   N +             C E G     +  + K+    +DY +L   W  WR+  G+ +++ + R ++L N  +  +G+ D      S  +E   F+     L+  + PLY+ +H YVR  L K Y P   +  GPIPAH+ GN+WAQ W+ I  F I      ++ A         N ++M     F  ++ F+ S+G+  M +EFWE+SML KP D + V CH SA DF N  DFRIK CT   M D  T+HHEMGH++Y++ Y   P  FR  AN GFHEAIGD +AL+V TP+HL  IGL+ +V ++   DI++LM+ AL+K+AFLPF   MD + W +++G +P +E NK WW+LR +YQGL PPV RTE+DFDPG+K+HI   V Y+RYFVSF+IQFQF++++C  + + GPLH C+ YQSKEAG  L +++  G S+ W E M I+TG +++ ++ L+++F+PL +WL+  N+     IGW
Sbjct:  625 EGYPEDIEKNTDELDAKRLLDEYNTTAEEVWNAYTEASWKYNTDITDANKQAMLNRSLEMSAHTLKYGLKAREYDTTDFQDPLVKR----VIAKLSDIERAALPPEELEEYNTLLSNMETKYSVAEVCREDGRCHPLDPDLQKIMAESRDYNELLFAWKGWRDAAGKVLRQDYERYVELANKAAVLDGYSDNGAMWRSL-YETPTFEEDLESLWMELQPLYQNVHAYVRRALYKKYGPQHINLKGPIPAHLLGNMWAQTWSGIMDFAIPYPGATQVDATPAMLAQGWNATRM-----FQESDRFFTSLGLLPMPEEFWEKSMLEKPSDGRQVVCHASAWDFYNRKDFRIKQCTVVTMDDLITVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAIGDVLALSVSTPKHLKSIGLLDKVEENYESDINFLMSMALDKIAFLPFGYLMDQWRWKVFDGRIPPNEYNKEWWNLRLKYQGLCPPVARTEEDFDPGAKFHIPANVPYVRYFVSFIIQFQFHKALCEAANHNGPLHTCDIYQSKEAGKLLSDVMKLGSSKPWPEAMAIITGQSKMSAQPLMQYFEPLIQWLQRENQMNGDVIGW 1212          

HSP 2 Score: 406.371 bits (1043), Expect = 1.383e-126
Identity = 205/483 (42.44%), Postives = 288/483 (59.63%), Query Frame = 2
Query:  575 INNDISYIYNNAK--PCFNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            I + +  IY+ AK  P  N    + E  +  +  T + Y+KL   W  W N +G  +KKL+   ++L N  S+ +G  D      S+ +E + F+     LY  I PLY  LH +VR  L   Y  K+ +  GPIPAH+ GN+WAQ W NI+ ++     K + +   +   +  +      MF ++EEF+ S+G+ +M  EFWE SM+ KP D+ V CH SA DF N  DFRIK CT   M    T+HHEMGHI+YY+ Y   P  FR  AN GFHEAIGD ++L+V TP+HLH I L+         DI+YL+  ALEK+AFLPF   +D + WG++NG  P  + N  WW LR ++QG+ PP KR+E+ FDPG+KYHI     YIRYFVSF++QFQF+E +C  + + GPLH C+ Y+S EAG  L ++L  G S+ W E ++   G  E+ + SLLK+F+P+ KWL+  N  +N  +GW
Sbjct:  139 ILSTMDSIYSTAKVYPQPNVSWSL-EPELTDIMATSRSYKKLLFAWDGWHNASGVPLKKLYPEFVELSNKASQADGFADTGADWRSW-YESETFEQDIDNLYKTIEPLYLHLHAFVRRKLYNQYGSKYINLKGPIPAHLLGNMWAQTWNNIYDLMIPFPNKPNLDVTDEMVRQGYN---ATHMFRVSEEFFTSLGLLEMPTEFWEGSMIVKPDDREVVCHASAWDFYNRKDFRIKQCTTVTMEQLFTVHHEMGHIQYYLQYKDQPVGFRRGANPGFHEAIGDVLSLSVSTPKHLHTINLLESAASDTETDINYLLKMALEKIAFLPFGYLIDLWRWGVFNGRTPPEKYNSEWWYLRTKFQGICPPTKRSEEHFDPGAKYHIPGNTPYIRYFVSFILQFQFHEKLCEAAKHTGPLHTCDIYRSAEAGEILRKVLQAGSSKPWPEVLQEAIGTREMNANSLLKYFEPVIKWLEEQN--VNETLGW 614          
BLAST of Angiotensin-converting enzyme vs. Ensembl Medaka
Match: ace (angiotensin I converting enzyme [Source:NCBI gene;Acc:101172772])

HSP 1 Score: 419.853 bits (1078), Expect = 1.129e-131
Identity = 228/598 (38.13%), Postives = 341/598 (57.02%), Query Frame = 2
Query:  251 ESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLITASIRN-ENESLVHELIHINNDISYIYNNAKPCFNKCLEVG-----ESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFY-PGKFDKSGPIPAHIFGNVWAQQWTNI--FPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQD-KVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            E YP   ++   E  AK   D+ N  +    N +    +KY+TDI   N +         S   LK   K++++    F+ P ++R    + A + + E  +L  E +   N +             C E G     +  + K+    +DY +L   W  WR+  G+ +++ + R ++L N  +  +G+ D      S  +E   F+     L+  + PLY+ +H YVR  L K Y P   +  GPIPAH+ GN+WAQ W+ I  F I      ++ A         N ++M     F  ++ F+ S+G+  M +EFWE+SML KP D + V CH SA DF N  DFRIK CT   M D  T+HHEMGH++Y++ Y   P  FR  AN GFHEAIGD +AL+V TP+HL  IGL+ +V ++   DI++LM+ AL+K+AFLPF   MD + W +++G +P +E NK WW+LR +YQGL PPV RTE+DFDPG+K+HI   V Y+RYFVSF+IQFQF++++C  + + GPLH C+ YQSKEAG  L +++  G S+ W E M I+TG +++ ++ L+++F+PL +WL+  N+     IGW
Sbjct:  623 EGYPEDIEKNTDELDAKRLLDEYNTTAEEVWNAYTEASWKYNTDITDANKQAMLNRSLEMSAHTLKYGLKAREYDTTDFQDPLVKR----VIAKLSDIERAALPPEELEEYNTLLSNMETKYSVAEVCREDGRCHPLDPDLQKIMAESRDYNELLFAWKGWRDAAGKVLRQDYERYVELANKAAVLDGYSDNGAMWRSL-YETPTFEEDLESLWMELQPLYQNVHAYVRRALYKKYGPQHINLKGPIPAHLLGNMWAQTWSGIMDFAIPYPGATQVDATPAMLAQGWNATRM-----FQESDRFFTSLGLLPMPEEFWEKSMLEKPSDGRQVVCHASAWDFYNRKDFRIKQCTVVTMDDLITVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAIGDVLALSVSTPKHLKSIGLLDKVEENYESDINFLMSMALDKIAFLPFGYLMDQWRWKVFDGRIPPNEYNKEWWNLRLKYQGLCPPVARTEEDFDPGAKFHIPANVPYVRYFVSFIIQFQFHKALCEAANHNGPLHTCDIYQSKEAGKLLSDVMKLGSSKPWPEAMAIITGQSKMSAQPLMQYFEPLIQWLQRENQMNGDVIGW 1210          

HSP 2 Score: 406.371 bits (1043), Expect = 1.353e-126
Identity = 205/483 (42.44%), Postives = 288/483 (59.63%), Query Frame = 2
Query:  575 INNDISYIYNNAK--PCFNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKF-DKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            I + +  IY+ AK  P  N    + E  +  +  T + Y+KL   W  W N +G  +KKL+   ++L N  S+ +G  D      S+ +E + F+     LY  I PLY  LH +VR  L   Y  K+ +  GPIPAH+ GN+WAQ W NI+ ++     K + +   +   +  +      MF ++EEF+ S+G+ +M  EFWE SM+ KP D+ V CH SA DF N  DFRIK CT   M    T+HHEMGHI+YY+ Y   P  FR  AN GFHEAIGD ++L+V TP+HLH I L+         DI+YL+  ALEK+AFLPF   +D + WG++NG  P  + N  WW LR ++QG+ PP KR+E+ FDPG+KYHI     YIRYFVSF++QFQF+E +C  + + GPLH C+ Y+S EAG  L ++L  G S+ W E ++   G  E+ + SLLK+F+P+ KWL+  N  +N  +GW
Sbjct:  137 ILSTMDSIYSTAKVYPQPNVSWSL-EPELTDIMATSRSYKKLLFAWDGWHNASGVPLKKLYPEFVELSNKASQADGFADTGADWRSW-YESETFEQDIDNLYKTIEPLYLHLHAFVRRKLYNQYGSKYINLKGPIPAHLLGNMWAQTWNNIYDLMIPFPNKPNLDVTDEMVRQGYN---ATHMFRVSEEFFTSLGLLEMPTEFWEGSMIVKPDDREVVCHASAWDFYNRKDFRIKQCTTVTMEQLFTVHHEMGHIQYYLQYKDQPVGFRRGANPGFHEAIGDVLSLSVSTPKHLHTINLLESAASDTETDINYLLKMALEKIAFLPFGYLIDLWRWGVFNGRTPPEKYNSEWWYLRTKFQGICPPTKRSEEHFDPGAKYHIPGNTPYIRYFVSFILQFQFHEKLCEAAKHTGPLHTCDIYRSAEAGEILRKVLQAGSSKPWPEVLQEAIGTREMNANSLLKYFEPVIKWLEEQN--VNETLGW 612          
BLAST of Angiotensin-converting enzyme vs. Planmine SMEST
Match: SMESG000005710.1 (SMESG000005710.1)

HSP 1 Score: 1250.34 bits (3234), Expect = 0.000e+0
Identity = 639/641 (99.69%), Postives = 640/641 (99.84%), Query Frame = 2
Query:   92 MVFKXXXXXXXXXXXXXXRDRFFSKTKNEIDFDDEFQALEPSVFDSYYHMTDLESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLITASIRNENESLVHELIHINNDISYIYNNAKPCFNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            MVFKLTLLIVILIQSLQSRDRFFSKTKNEIDFDDEFQALEPSVFDSYYHMTDLE YPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRIGSKIGLKLKRKSKKFHWKSFKSPELRRKFRLITASIRNENESLVHELIHINNDISYIYNNAKPCFNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKN+VDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW
Sbjct:    1 MVFKLTLLIVILIQSLQSRDRFFSKTKNEIDFDDEFQALEPSVFDSYYHMTDLEGYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRIGSKIGLKLKRKSKKFHWKSFKSPELRRKFRLITASIRNENESLVHELIHINNDISYIYNNAKPCFNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNIVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 641          
BLAST of Angiotensin-converting enzyme vs. Planmine SMEST
Match: SMESG000005698.1 (SMESG000005698.1)

HSP 1 Score: 807.364 bits (2084), Expect = 0.000e+0
Identity = 373/599 (62.27%), Postives = 488/599 (81.47%), Query Frame = 2
Query:  218 VFDSYYHMTDLESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLITASIRNENESLVHELIHINNDISYIYNNAKPCFNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            +FDSY+++T+LE YP VC+EY++E CAK W  K+NEI+IRN NR+AN++++Y ++INK NLEL K+FQ I  K+G  ++ K+KKF WK F SP +R+    ++ ++R+++E++   L+ + + I YIYNN KPCF  CL  GE  II LFK EKDY+KL GYW AWRNVTG +I+ LF+++++LEN+G+RENG  D A++ L  DFE+++FK T ++LY  ILPLYKELH +VRYCL K+YPGKFDK+GPIPAHIFGNVW+QQWTNIF I++ C +     ++ ++A+  L K+ V +MF +AEEFY SIG+FKMT+EFWERS++ +   ++++CHGSAHDF+NGVD+RI MCT+K++ DFTTIHHEMGHIEY+MAYS LPT +R SANSGFHEAIGDTIALAVKTPEHLHKIGL+  +P SK FDI+YLM +ALEKVAFLPFAL MDSYIW +YNG++P S++N++WWDL  +YQG+ PPV+R+E DFD G+KYHI+F V YIRYF+SF+IQFQFYESMC++SGYKGPLHRC+FYQS +AG KL+EML +G+  NWRETMKILTG  EIKS SLLKFF+PL+ WLK  N+ L+  +GW
Sbjct:   12 IFDSYHNLTELEDYPEVCEEYSNENCAKSWLIKVNEITIRNDNRYANLNYRYGSNINKTNLELLKKFQIIYGKLGNSIQLKAKKFQWKRFSSPNVRKILDKLSKTVRSQDENISRNLVEVKSKIEYIYNNGKPCFGICLPAGEPAIIDLFKKEKDYDKLTGYWVAWRNVTGARIRNLFVKKVELENLGARENGFSDLASFILFEDFEEENFKETVIQLYEGILPLYKELHSFVRYCLWKYYPGKFDKNGPIPAHIFGNVWSQQWTNIFEIVKKCMKSNYQNDFHEQASAKLEKLSVRKMFEMAEEFYNSIGLFKMTNEFWERSVVEQIPGRLIDCHGSAHDFANGVDYRILMCTKKDLNDFTTIHHEMGHIEYFMAYSKLPTFYRNSANSGFHEAIGDTIALAVKTPEHLHKIGLLPEIPKSKEFDIEYLMGSALEKVAFLPFALKMDSYIWSVYNGTIPSSKLNEYWWDLSLKYQGIKPPVERSEKDFDAGAKYHIAFSVPYIRYFISFIIQFQFYESMCDLSGYKGPLHRCDFYQSHKAGNKLLEMLKQGEKNNWRETMKILTGTKEIKSGSLLKFFEPLHVWLKHKNRDLHNRVGW 610          
BLAST of Angiotensin-converting enzyme vs. Planmine SMEST
Match: SMESG000005704.1 (SMESG000005704.1)

HSP 1 Score: 806.979 bits (2083), Expect = 0.000e+0
Identity = 373/599 (62.27%), Postives = 487/599 (81.30%), Query Frame = 2
Query:  218 VFDSYYHMTDLESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLITASIRNENESLVHELIHINNDISYIYNNAKPCFNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            +FDSY+++T+LE YP VC+EY++E CAK W  K+NEI+IRN NR+AN++++Y ++INK NLEL K+FQ I  K+G  ++ K+KKF WK F SP +R+    ++ ++R+++E++   L+ + + I YIYNN KPCF  CL  GE  II LFK EKDY+KL GYW AWRNVTG +I+ LF+++++LEN+G+RENG  D A++ L  DFE+++FK T ++LY  ILPLYKELH +VRYCL K+YPGKFDK+GPIPAHIFGNVW+Q+WTNIF I++ C +     N+ ++A+  L K+ V +MF +AEEFY SIG+FKMT+EFWERS++ +   ++++CHGSAHDF+NGVD+RI MCT+K++ DFTTIHHEMGHIEY+MAYS LPT +R SANSGFHEAIGDTIALAVKTPEHLHKIGL+  +P SK FDI+YLM +ALEKVAFLPFAL MDSYIW +YNG++P S++N++WWDL  +YQG+ PPV+R+E DFD G+KYHI+F V YIRYF+SF+IQFQFYESMC++SGYKGPLHRC+FYQS +AG KL+EML +GK  NWRETMK LTG  EIKS SLLKFF+PL+ WLK  N+ L+  +GW
Sbjct:   28 IFDSYHNLTELEDYPEVCEEYSNENCAKSWLIKVNEITIRNDNRYANLNYRYGSNINKTNLELLKKFQIIYGKLGNSIQLKAKKFQWKRFSSPNVRKILDKLSKTVRSQDENISRNLVEVKSKIEYIYNNGKPCFGICLPAGEPAIIDLFKKEKDYDKLTGYWVAWRNVTGARIRNLFVKKVELENLGARENGFSDLASFILFEDFEEENFKETVIQLYEGILPLYKELHSFVRYCLWKYYPGKFDKNGPIPAHIFGNVWSQKWTNIFEIVKKCMKSNYQNNFHEQASAKLEKLSVRKMFEMAEEFYNSIGLFKMTNEFWERSVVEQIPGRLIDCHGSAHDFANGVDYRILMCTKKDLNDFTTIHHEMGHIEYFMAYSKLPTFYRNSANSGFHEAIGDTIALAVKTPEHLHKIGLLPEIPKSKEFDIEYLMGSALEKVAFLPFALKMDSYIWSVYNGTIPSSKLNEYWWDLSLKYQGIKPPVERSEKDFDAGAKYHIAFSVPYIRYFISFIIQFQFYESMCDLSGYKGPLHRCDFYQSHKAGNKLLEMLKQGKKNNWRETMKTLTGTKEIKSGSLLKFFEPLHVWLKHKNRDLHNRVGW 626          
BLAST of Angiotensin-converting enzyme vs. Planmine SMEST
Match: SMESG000005698.1 (SMESG000005698.1)

HSP 1 Score: 806.979 bits (2083), Expect = 0.000e+0
Identity = 373/602 (61.96%), Postives = 489/602 (81.23%), Query Frame = 2
Query:  209 EPSVFDSYYHMTDLESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLITASIRNENESLVHELIHINNDISYIYNNAKPCFNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            +  +FDSY+++T+LE YP VC+EY++E CAK W  K+NEI+IRN NR+AN++++Y ++INK NLEL K+FQ I  K+G  ++ K+KKF WK F SP +R+    ++ ++R+++E++   L+ + + I YIYNN KPCF  CL  GE  II LFK EKDY+KL GYW AWRNVTG +I+ LF+++++LEN+G+RENG  D A++ L  DFE+++FK T ++LY  ILPLYKELH +VRYCL K+YPGKFDK+GPIPAHIFGNVW+QQWTNIF I++ C +     ++ ++A+  L K+ V +MF +AEEFY SIG+FKMT+EFWERS++ +   ++++CHGSAHDF+NGVD+RI MCT+K++ DFTTIHHEMGHIEY+MAYS LPT +R SANSGFHEAIGDTIALAVKTPEHLHKIGL+  +P SK FDI+YLM +ALEKVAFLPFAL MDSYIW +YNG++P S++N++WWDL  +YQG+ PPV+R+E DFD G+KYHI+F V YIRYF+SF+IQFQFYESMC++SGYKGPLHRC+FYQS +AG KL+EML +G+  NWRETMKILTG  EIKS SLLKFF+PL+ WLK  N+ L+  +GW
Sbjct:   29 QKQIFDSYHNLTELEDYPEVCEEYSNENCAKSWLIKVNEITIRNDNRYANLNYRYGSNINKTNLELLKKFQIIYGKLGNSIQLKAKKFQWKRFSSPNVRKILDKLSKTVRSQDENISRNLVEVKSKIEYIYNNGKPCFGICLPAGEPAIIDLFKKEKDYDKLTGYWVAWRNVTGARIRNLFVKKVELENLGARENGFSDLASFILFEDFEEENFKETVIQLYEGILPLYKELHSFVRYCLWKYYPGKFDKNGPIPAHIFGNVWSQQWTNIFEIVKKCMKSNYQNDFHEQASAKLEKLSVRKMFEMAEEFYNSIGLFKMTNEFWERSVVEQIPGRLIDCHGSAHDFANGVDYRILMCTKKDLNDFTTIHHEMGHIEYFMAYSKLPTFYRNSANSGFHEAIGDTIALAVKTPEHLHKIGLLPEIPKSKEFDIEYLMGSALEKVAFLPFALKMDSYIWSVYNGTIPSSKLNEYWWDLSLKYQGIKPPVERSEKDFDAGAKYHIAFSVPYIRYFISFIIQFQFYESMCDLSGYKGPLHRCDFYQSHKAGNKLLEMLKQGEKNNWRETMKILTGTKEIKSGSLLKFFEPLHVWLKHKNRDLHNRVGW 630          
BLAST of Angiotensin-converting enzyme vs. Planmine SMEST
Match: SMESG000005712.1 (SMESG000005712.1)

HSP 1 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 297/599 (49.58%), Postives = 419/599 (69.95%), Query Frame = 2
Query:  218 VFDSYYHMTDLESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINKKNLELKKRFQRXXXXXXXXXXXXXXXXXXXXXXXPELRRKFRLITASIRNENESLVHELIHINNDISYIYNNAKPCFNKCLEVGESGIIKLFKTEKDYEKLAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFEDDDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKFDKSGPIPAHIFGNVWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYESIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNMVDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPEHLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGSVPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFVSFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWRETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW 2014
            VFDS+Y +T LE YP+ C    SE CA+ W  K+NEI IRN NR AN++++Y+T+I   NL L  +F+    K    L   +K F W+ F S ++R  F +IT S+++ +  +   +I I N I +IYN A+PC+  CL  GESGI+ LF TEK+Y+ L GYW  WR  TG +I+ L++ R  LE   ++ENG ++ A++ +  DF++++F  T +KL+  ++P+YK+LH YVRYCL ++YP +F+K+GPIPAHI G+VWAQ W NIFPII+ C +  +  +   E    LSKM V Q+F   E  Y  +GM++MT+EFWERS+ +KP D++V+CH S+ DFSNG DFR+KMC++K +  F+ IHHEMGHI+Y+MAY HLP ++R SANS F E IGDT+AL++KT   L KIGL+S +P +   +IDYLM  ALE V F+PFA+    ++  LYNGSVP S +N +WW L + YQG+ PP++RTE++FDPGSKYHI+FG+ YIR+FVS L++FQF+ES+C ++    PLH C  YQSK  G  L+E++  G+ + WRE +KI+    +I+S+SLL+FF PL +WL  TNK LNI +GW
Sbjct:   38 VFDSFYWLTPLEYYPDSC---LSETCAENWLVKVNEIMIRNENRIANVYYRYATNITSDNLMLLNQFRITKVKYENNLISIAKGFPWQQFYSKKMREMFEIITTSVKSVDPEVFKRIIKIKNRIEHIYNKARPCYKTCLSAGESGIVNLFNTEKNYDTLLGYWIVWRKETGVQIRDLYIDRFNLEIQAAKENGIQNIASFKMFEDFQEENFLETLMKLFDNVMPIYKQLHAYVRYCLAEYYPDRFNKTGPIPAHILGDVWAQNWINIFPIIKQCSRNNNPFHVFHEVNFKLSKMSVNQIFKTVESNYVGMGMYQMTNEFWERSLFTKPNDRIVDCHSSSEDFSNGFDFRVKMCSKKTVSYFSAIHHEMGHIQYFMAYQHLPILYRASANSAFQEIIGDTMALSMKTLSSLEKIGLLSNIPKTFDLEIDYLMLLALENVPFVPFAMINSVFVNSLYNGSVPTSRMNSYWWKLVHTYQGIKPPIERTEENFDPGSKYHIAFGIPYIRHFVSSLLKFQFFESLCEMNKGIEPLHFCTLYQSKNVGSLLIEIMKNGQRKPWREIIKIINRNEDIQSDSLLRFFAPLTQWLIKTNKMLNIHVGW 633          
The following BLAST results are available for this feature:
BLAST of Angiotensin-converting enzyme vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACE4.084e-13642.41angiotensin I converting enzyme [Source:HGNC Symbo... [more]
AC113554.17.783e-13641.79novel protein[more]
ACE7.880e-13142.41angiotensin I converting enzyme [Source:HGNC Symbo... [more]
ACE2.011e-13042.41angiotensin I converting enzyme [Source:HGNC Symbo... [more]
ACE1.319e-10536.80angiotensin I converting enzyme [Source:HGNC Symbo... [more]
back to top
BLAST of Angiotensin-converting enzyme vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
acn-13.314e-4726.22Inactive angiotensin-converting enzyme-related pro... [more]
acn-13.314e-4726.22Inactive angiotensin-converting enzyme-related pro... [more]
back to top
BLAST of Angiotensin-converting enzyme vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acer1.318e-11536.03gene:FBgn0016122 transcript:FBtr0079685[more]
Acer1.318e-11536.03gene:FBgn0016122 transcript:FBtr0333416[more]
Ance1.258e-11434.91gene:FBgn0012037 transcript:FBtr0080553[more]
Ance1.258e-11434.91gene:FBgn0012037 transcript:FBtr0343667[more]
Ance1.258e-11434.91gene:FBgn0012037 transcript:FBtr0080552[more]
back to top
BLAST of Angiotensin-converting enzyme vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ace6.477e-13638.58angiotensin I converting enzyme (peptidyl-dipeptid... [more]
ace22.261e-11136.71angiotensin I converting enzyme 2 [Source:ZFIN;Acc... [more]
ace26.899e-11136.71angiotensin I converting enzyme 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of Angiotensin-converting enzyme vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ace7.242e-14942.80angiotensin I converting enzyme [Source:NCBI gene;... [more]
ace3.382e-14339.33angiotensin I converting enzyme [Source:NCBI gene;... [more]
ace4.227e-14339.33angiotensin I converting enzyme [Source:NCBI gene;... [more]
ace4.698e-14339.33angiotensin I converting enzyme [Source:NCBI gene;... [more]
ace7.414e-14339.33angiotensin I converting enzyme [Source:NCBI gene;... [more]
back to top
BLAST of Angiotensin-converting enzyme vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ace2.602e-13642.24angiotensin I converting enzyme (peptidyl-dipeptid... [more]
Ace4.967e-13337.34angiotensin I converting enzyme (peptidyl-dipeptid... [more]
Ace8.348e-13137.34angiotensin I converting enzyme (peptidyl-dipeptid... [more]
Ace31.641e-11834.06angiotensin I converting enzyme (peptidyl-dipeptid... [more]
Ace21.049e-10335.47angiotensin I converting enzyme (peptidyl-dipeptid... [more]
back to top
BLAST of Angiotensin-converting enzyme vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q50JE5|ACE_MESAU9.196e-13242.68Angiotensin-converting enzyme OS=Mesocricetus aura... [more]
sp|P47820|ACE_RAT6.409e-13141.26Angiotensin-converting enzyme OS=Rattus norvegicus... [more]
sp|Q10751|ACE_CHICK1.107e-13042.45Angiotensin-converting enzyme (Fragment) OS=Gallus... [more]
sp|P09470|ACE_MOUSE5.840e-13037.34Angiotensin-converting enzyme OS=Mus musculus OX=1... [more]
sp|Q9GLN7|ACE_PANTR7.599e-13042.41Angiotensin-converting enzyme OS=Pan troglodytes O... [more]
back to top
BLAST of Angiotensin-converting enzyme vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIB10.000e+048.64Angiotensin-converting enzyme (Fragment) OS=Schmid... [more]
A0A1S5QMZ51.301e-14843.38Angiotensin-converting enzyme OS=Tityus serrulatus... [more]
A0A1S3GZX91.460e-14843.95Angiotensin-converting enzyme OS=Lingula unguis OX... [more]
A0A1W7RA022.156e-14642.94Angiotensin-converting enzyme OS=Hadrurus spadix O... [more]
A0A087UCM76.583e-14645.03Angiotensin-converting enzyme (Fragment) OS=Stegod... [more]
back to top
BLAST of Angiotensin-converting enzyme vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ace9.935e-13937.91angiotensin I converting enzyme [Source:NCBI gene;... [more]
ace22.366e-10936.04angiotensin I converting enzyme 2 [Source:NCBI gen... [more]
back to top
BLAST of Angiotensin-converting enzyme vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ace1.012e-13538.32angiotensin I converting enzyme (peptidyl-dipeptid... [more]
ENSPMAT00000004373.13.601e-8136.80pep scaffold:Pmarinus_7.0:GL477858:25443:42821:1 g... [more]
ENSPMAT00000004370.11.869e-6540.07pep scaffold:Pmarinus_7.0:GL477858:22090:39821:1 g... [more]
back to top
BLAST of Angiotensin-converting enzyme vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Angiotensin-converting enzyme vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO379478.417e-14140.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356592.236e-13440.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340632.353e-13141.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO296886.545e-13141.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282973.176e-8341.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Angiotensin-converting enzyme vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000005403.23.105e-13343.62angiotensin-converting enzyme-like [Source:NCBI ge... [more]
ace7.803e-13238.13angiotensin I converting enzyme [Source:NCBI gene;... [more]
ace7.803e-13238.13angiotensin I converting enzyme [Source:NCBI gene;... [more]
ace9.894e-13238.13angiotensin I converting enzyme [Source:NCBI gene;... [more]
ace1.129e-13138.13angiotensin I converting enzyme [Source:NCBI gene;... [more]
back to top
BLAST of Angiotensin-converting enzyme vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005710.10.000e+099.69SMESG000005710.1[more]
SMESG000005698.10.000e+062.27SMESG000005698.1[more]
SMESG000005704.10.000e+062.27SMESG000005704.1[more]
SMESG000005698.10.000e+061.96SMESG000005698.1[more]
SMESG000005712.10.000e+049.58SMESG000005712.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034506 ID=SMED30034506|Name=Angiotensin-converting enzyme|organism=Schmidtea mediterranea sexual|type=transcript|length=2047bp
GCTATGAGTGGTAAGCTCAGATTGTTGTATGATTGCAGGCCTTACCATAT
ACATCTGATAGTCAAGTTGCTATATCTTATTTAAAAACAAAATGGTTTTC
AAGCTAACTCTTTTGATTGTTATTTTAATTCAATCTCTCCAAAGCAGAGA
TAGATTTTTTTCAAAAACAAAAAATGAAATAGATTTCGACGATGAATTTC
AAGCTCTTGAACCTTCGGTTTTCGATAGCTATTACCATATGACAGACTTG
GAAAGCTACCCAAACGTATGCGATGAGTATGCCAGTGAGAAATGCGCAAA
ACTATGGTTTGATAAAATCAACGAGATCTCCATTAGAAATAGAAATCGTT
TCGCGAACATTCATTTCAAATATTCGACAGATATTAACAAAAAGAATCTA
GAGTTGAAAAAGAGATTTCAAAGAATCGGATCTAAAATCGGATTGAAATT
GAAACGTAAGTCGAAAAAATTCCACTGGAAATCGTTTAAATCTCCGGAGC
TTCGAAGGAAGTTTCGACTGATTACGGCTTCTATTCGGAATGAAAATGAA
TCTTTAGTCCATGAACTCATTCATATCAATAATGATATCAGTTATATTTA
CAATAATGCGAAACCTTGTTTTAATAAATGTCTGGAAGTTGGGGAGTCGG
GAATCATAAAATTATTCAAGACAGAAAAGGATTATGAGAAATTAGCCGGC
TATTGGACAGCATGGCGAAATGTTACGGGACAAAAGATAAAAAAATTATT
TCTAAGAAGAATGCAACTGGAAAATATCGGATCGAGAGAAAATGGCCATG
AAGATGCTGCAACTTATGGTTTAAGTTTTGATTTCGAAGATGATGATTTT
AAAAGTACTGCGTTAAAACTTTATGGAGCTATTCTTCCACTTTATAAAGA
ATTGCATGGCTATGTGAGATATTGCCTAAATAAGTTTTACCCAGGAAAAT
TTGATAAAAGCGGACCGATTCCAGCTCATATCTTTGGAAATGTCTGGGCG
CAACAATGGACAAATATATTTCCCATTATTCGTGATTGTGGACAAAAATT
ATCGGCTGAAAATTATCAAGACGAAGCTACGGAAAATTTATCCAAAATGC
CTGTTGAACAAATGTTTACGATCGCTGAAGAATTCTATGAATCTATTGGA
ATGTTTAAGATGACTGATGAATTCTGGGAAAGGAGTATGCTGAGTAAACC
TCAAGATAAAGTTGTGAACTGCCATGGGTCAGCGCATGATTTCTCAAATG
GAGTAGATTTTCGAATAAAAATGTGTACAGAGAAAAATATGGTAGATTTC
ACGACTATCCATCATGAGATGGGGCATATTGAATATTATATGGCCTACAG
TCATTTGCCAACTATATTTAGAGGCTCTGCAAATTCAGGATTCCATGAAG
CTATTGGTGATACTATTGCATTGGCAGTGAAAACACCAGAGCATCTCCAT
AAAATTGGCTTAATATCTCGAGTTCCTGACTCAAAAGGTTTTGACATCGA
CTATTTGATGGCAACCGCTTTAGAAAAAGTGGCATTTTTACCTTTTGCTT
TGTCCATGGATAGCTATATATGGGGATTGTATAACGGTTCAGTTCCTTTA
TCAGAAGTAAACAAGCATTGGTGGGACTTACGATACAGATATCAAGGTTT
AATGCCACCCGTTAAAAGAACAGAAGACGATTTTGATCCTGGTTCAAAAT
ATCACATATCCTTTGGTGTATCTTATATTCGTTACTTTGTTAGCTTTTTG
ATTCAGTTTCAATTTTATGAATCTATGTGCAACATTAGCGGTTATAAGGG
ACCCCTGCATCGATGTAATTTTTATCAATCAAAAGAAGCTGGACTAAAAT
TGATGGAAATGCTTTCGAAAGGAAAAAGTCAGAATTGGAGAGAAACAATG
AAAATCCTTACGGGGGCCACCGAAATAAAATCCGAATCCTTGTTGAAATT
CTTTGACCCGTTGTATAAATGGTTGAAATTCACAAATAAAAAGCTGAATA
TTCCAATCGGGTGGTAAATCTGAAAGTTGCATAATTGATAATTCATA
back to top

protein sequence of SMED30034506-orf-1

>SMED30034506-orf-1 ID=SMED30034506-orf-1|Name=SMED30034506-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=642bp
MVFKLTLLIVILIQSLQSRDRFFSKTKNEIDFDDEFQALEPSVFDSYYHM
TDLESYPNVCDEYASEKCAKLWFDKINEISIRNRNRFANIHFKYSTDINK
KNLELKKRFQRIGSKIGLKLKRKSKKFHWKSFKSPELRRKFRLITASIRN
ENESLVHELIHINNDISYIYNNAKPCFNKCLEVGESGIIKLFKTEKDYEK
LAGYWTAWRNVTGQKIKKLFLRRMQLENIGSRENGHEDAATYGLSFDFED
DDFKSTALKLYGAILPLYKELHGYVRYCLNKFYPGKFDKSGPIPAHIFGN
VWAQQWTNIFPIIRDCGQKLSAENYQDEATENLSKMPVEQMFTIAEEFYE
SIGMFKMTDEFWERSMLSKPQDKVVNCHGSAHDFSNGVDFRIKMCTEKNM
VDFTTIHHEMGHIEYYMAYSHLPTIFRGSANSGFHEAIGDTIALAVKTPE
HLHKIGLISRVPDSKGFDIDYLMATALEKVAFLPFALSMDSYIWGLYNGS
VPLSEVNKHWWDLRYRYQGLMPPVKRTEDDFDPGSKYHISFGVSYIRYFV
SFLIQFQFYESMCNISGYKGPLHRCNFYQSKEAGLKLMEMLSKGKSQNWR
ETMKILTGATEIKSESLLKFFDPLYKWLKFTNKKLNIPIGW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001548Peptidase_M2
Vocabulary: molecular function
TermDefinition
GO:0008237metallopeptidase activity
GO:0008241peptidyl-dipeptidase activity
GO:0004180carboxypeptidase activity
GO:0008233peptidase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001548Peptidase M2, peptidyl-dipeptidase APRINTSPR00791PEPDIPTASEAcoord: 291..312
score: 60.23
coord: 535..563
score: 62.64
coord: 403..419
score: 60.29
coord: 472..497
score: 44.55
coord: 507..534
score: 60.42
coord: 371..396
score: 58.33
coord: 431..451
score: 68.65
coord: 257..284
score: 43.15
IPR001548Peptidase M2, peptidyl-dipeptidase APFAMPF01401Peptidase_M2coord: 65..641
e-value: 2.5E-180
score: 600.9
IPR001548Peptidase M2, peptidyl-dipeptidase APANTHERPTHR10514ANGIOTENSIN-CONVERTING ENZYMEcoord: 52..641
IPR001548Peptidase M2, peptidyl-dipeptidase ACDDcd06461M2_ACEcoord: 72..632
e-value: 0.0
score: 716.311
NoneNo IPR availablePANTHERPTHR10514:SF42ANGIOTENSIN-CONVERTING ENZYMEcoord: 52..641
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.713
NoneNo IPR availableSUPERFAMILYSSF55486Metalloproteases ("zincins"), catalytic domaincoord: 70..641