Cullin-1

Overview
NameCullin-1
Smed IDSMED30034505
Length (bp)2832
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cullin-1 (SMED30034505) t-SNE clustered cells

Violin plots show distribution of expression levels for Cullin-1 (SMED30034505) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cullin-1 (SMED30034505) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cullin-1 (SMED30034505) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034505

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30034505h1SMcG0000887 Contig22727newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034505h1SMcG0000887 Contig22727uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30034505h1SMcG0000887 dd_Smed_v4_5770_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034505h1SMcG0000887 dd_Smed_v4_5770_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034505h1SMcG0000887 dd_Smed_v4_5770_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034505h1SMcG0000887 dd_Smed_v4_5770_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
whole organismSMED30034505h1SMcG0000887 dd_Smed_v6_5770_0_1dd_Smed_v6PMID:29291974
Strand et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cullin-1 vs. Ensembl Human
Match: CUL1 (cullin 1 [Source:HGNC Symbol;Acc:HGNC:2551])

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 341/815 (41.84%), Postives = 502/815 (61.60%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT V   N +       S       PG              GA+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W + L RP    +++A++K +EKER  E +N R +  ++   VE+G                            + D +      L+VY + FE+ F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  ++ +G  AI       L +PK+Y++T+LDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W + L +GE+VT+  K  Y  Q ST+Q+AILL +N   +Y+V+++ ++TQ++ +I+ Q+LQI L+ K+LV+  +   +D V             ++ P+T++ LY  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   20 IWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPG--------------GAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELG---------------------------LNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEV-------------ELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 776          
BLAST of Cullin-1 vs. Ensembl Human
Match: CUL1 (cullin 1 [Source:HGNC Symbol;Acc:HGNC:2551])

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 341/815 (41.84%), Postives = 502/815 (61.60%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT V   N +       S       PG              GA+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W + L RP    +++A++K +EKER  E +N R +  ++   VE+G                            + D +      L+VY + FE+ F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  ++ +G  AI       L +PK+Y++T+LDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W + L +GE+VT+  K  Y  Q ST+Q+AILL +N   +Y+V+++ ++TQ++ +I+ Q+LQI L+ K+LV+  +   +D V             ++ P+T++ LY  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   20 IWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPG--------------GAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELG---------------------------LNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEV-------------ELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 776          
BLAST of Cullin-1 vs. Ensembl Human
Match: CUL1 (cullin 1 [Source:HGNC Symbol;Acc:HGNC:2551])

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 341/815 (41.84%), Postives = 502/815 (61.60%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT V   N +       S       PG              GA+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W + L RP    +++A++K +EKER  E +N R +  ++   VE+G                            + D +      L+VY + FE+ F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  ++ +G  AI       L +PK+Y++T+LDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W + L +GE+VT+  K  Y  Q ST+Q+AILL +N   +Y+V+++ ++TQ++ +I+ Q+LQI L+ K+LV+  +   +D V             ++ P+T++ LY  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   20 IWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPG--------------GAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELG---------------------------LNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEV-------------ELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 776          
BLAST of Cullin-1 vs. Ensembl Human
Match: CUL1 (cullin 1 [Source:HGNC Symbol;Acc:HGNC:2551])

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 341/815 (41.84%), Postives = 502/815 (61.60%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT V   N +       S       PG              GA+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W + L RP    +++A++K +EKER  E +N R +  ++   VE+G                            + D +      L+VY + FE+ F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  ++ +G  AI       L +PK+Y++T+LDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W + L +GE+VT+  K  Y  Q ST+Q+AILL +N   +Y+V+++ ++TQ++ +I+ Q+LQI L+ K+LV+  +   +D V             ++ P+T++ LY  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   20 IWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPG--------------GAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELG---------------------------LNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEV-------------ELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 776          
BLAST of Cullin-1 vs. Ensembl Human
Match: CUL1 (cullin 1 [Source:HGNC Symbol;Acc:HGNC:2551])

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 341/815 (41.84%), Postives = 502/815 (61.60%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT V   N +       S       PG              GA+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W + L RP    +++A++K +EKER  E +N R +  ++   VE+G                            + D +      L+VY + FE+ F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  ++ +G  AI       L +PK+Y++T+LDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W + L +GE+VT+  K  Y  Q ST+Q+AILL +N   +Y+V+++ ++TQ++ +I+ Q+LQI L+ K+LV+  +   +D V             ++ P+T++ LY  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   20 IWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPG--------------GAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELG---------------------------LNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEV-------------ELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 776          
BLAST of Cullin-1 vs. Ensembl Celegans
Match: cul-1 (Cullin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17389])

HSP 1 Score: 518.464 bits (1334), Expect = 2.965e-171
Identity = 290/821 (35.32%), Postives = 472/821 (57.49%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKN-EITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSR---KTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG--NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLN-LQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            +W+ L+ G+   +  EN+  + YM LY+ VY+YCT           S + ST   +G  G   R+  S P+   GA  +G E+Y++++EY+K +VI +  KG   + E++LK+  + W  +  S KV++G+  YLNR+W++R+L+EGH+  + +YT AL+ W  NL    +  + DA+++ +  ER    +N R++  +++CLVE+G                   D+S    + D +        L+VY + FE  F++ T  FY  E+ +FL+    +TDY+ KVE R+ +E+ R   +++    + T   L +     L+++ LD +   F  LL  +R  DL RMF L  ++P     +    EN + ++G++A+   + +   + K+Y++T+L+V+++  + V  +F  E  F+++LDK    FIN NAVT+ A       K+ E LA+YCD LL+KSS+  +  +L+E+ ++ M VFKYI+DKDVF  FY+KM ++RLI++LS S++ EA  I++LK  CGYEYTA+L +M +D   S+DL A F     +  G  +++ NV+VLSS SWP       TLPQ+L    + F  F+N    GR+L+W ++  RGE+ +    K Y+F  +T Q+  +LLFN+  SY+V++I  AT+++      I+   ++  VL             K DT L+ E+  ++     + L   Y NK++RV+L+   +K +  ++ E V   V+ DR+  I ACIVR+MKTRK ++HQ+L+ EV+ QLS +F P+V +IKRCI  LIEKEY+ R    KD Y+YLA
Sbjct:   16 VWKKLQDGLDVAYRRENMAPKDYMTLYTSVYDYCT-----------SITLSTSRRDGEDG---RAESSTPARTAGADFVGHEMYQRVEEYVKAYVIAVCEKGAELSGEDLLKYYTTEWENFRISSKVMDGIFAYLNRHWIRRELDEGHENIYMVYTLALVVWKRNLFNDLKDKVIDAMLELIRSERTGSMINSRYISGVVECLVELG------------------VDDSETDAKKDAETK-----KLAVYKEFFEVKFLEATRGFYTQEAANFLSNGGNVTDYMIKVETRLNQEDDRCQLYLN----SSTKTPLATCCESVLISNQLDFLQRHFGGLLVDKRDDDLSRMFKLCDRVPNGLDELRKSLENHIAKEGHQALERVAMEAATDAKLYVKTLLEVHERYQSLVNRSFKNEPGFMQSLDKAATSFINNNAVTKRAPPQAQLTKSAELLARYCDQLLRKSSKMPDEAELEELQTKIMVVFKYIDDKDVFSKFYTKMFSKRLISELSASDEAEANFITKLKSMCGYEYTARLSKMVNDTQVSKDLTADFKEKKADMLGQKSVEFNVLVLSSGSWPTFPTTPITLPQQLSKTIEIFGQFYNEKFNGRRLTWVYSQSRGEITSTAFPKKYVFTATTAQMCTMLLFNEQDSYTVEQIAAATKMDEKSAPAIVGSLIKNLVL-------------KADTELQKED--EVPMTATVSLNKAYMNKKVRVDLSKFTMKQDAVRDTENVQKNVEEDRKSVISACIVRIMKTRKRVQHQQLMTEVITQLSGRFKPKVEMIKRCIGSLIEKEYMLRTEGQKDLYEYLA 780          
BLAST of Cullin-1 vs. Ensembl Celegans
Match: cul-6 (Cullin-6 [Source:UniProtKB/Swiss-Prot;Acc:Q21346])

HSP 1 Score: 364.77 bits (935), Expect = 3.390e-113
Identity = 244/821 (29.72%), Postives = 414/821 (50.43%), Query Frame = 1
Query:   49 AIWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDN--LPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKT---SRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGNIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETK-QEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            A+W  L+ G+  ++  E++ ++ YM LY  VYN CT     N                             SN N  +     LYK+L+ Y++ +VI ++ +    + +E+L      W  + FS ++ N +  YLNRN+V +++E+ + +  +IY  AL  W        +    DA+++ +  ER    +N   +  +++CL E                                         L +Y   FE  F+  T+ FY+ E ++  +K  + +Y+  VE+R+ +EE R   ++  +  +  ++   S+L    ++D L  + +EF  LL A +   L RM++L  ++      +  + E  + ++G+E +   + D+     PK YI  +L+V++  +  + +AF     F+++LDK  + FI  NAVT +A     S ++ ++LA+YCD LLKK+S+  +   LD+ L    TV KYI +KDVFQ +Y    + R+IN+ S S+D E   I+ L  + G EYT  L +M  D   S+DL  +F      KS  ID NV++ ++ +WP   Q K  LP+EL    + F  F+N +H GR+L+W ++  RGEV +   +K Y+F V+  Q+  L LFN+  S+++++I +A ++ +           +    +V      +D V  +D   E +  P   P+ V+ L T Y NK++RV+L   +K  T  +E + V + V+ DR+  I ACIVR+MKTRK+L H  L+ E++ QL ++F P V +IK CI  LIE+ Y++R  N  + Y+YLA
Sbjct:    5 AVWGTLQDGLNLLYRREHMSKKYYMMLYDAVYNICTTTTLAN-----------------------------SNNNSPEFASEFLYKQLENYIRTYVIAIRDRISACSGDELLGKCTIEWDNFKFSTRICNCIFQYLNRNFVSKKVEDKNGEIVEIYKLALDIWKAEFFDNFKVKTIDAILELILLERCGSTINSTHISSVVECLTE-----------------------------------------LDIYKVSFEPQFLDATKLFYKQEVLN--SKETVIEYMITVENRLFQEEYRSRRYLGPSTNDLLIDSCESIL----ISDRLKFLHSEFERLLEARKDEHLTRMYSLCRRVTHGLEDLRVYLEKRILKEGHETLQRLAKDSGLKTTPKEYITKLLEVHEIYFNLINKAFDRNALFMQSLDKASKDFIEANAVTMLAPEKHRSTRSADYLARYCDQLLKKNSKVQDETALDKAL----TVLKYISEKDVFQLYYQNWFSERIINNSSASDDAEEKFITNLTATEGLEYTRNLVKMVEDAKISKDLTTEFKDIKTEKS--IDFNVILQTTGAWPSLDQIKIILPRELSTILKEFDTFYNASHNGRRLNWAYSQCRGEVNSKAFEKKYVFIVTASQLCTLYLFNEQDSFTIEQISKAIEMTA-----------KSTSAIVGSLNPVIDPVLVVDKGNEKDGYP---PDAVVSLNTKYANKKVRVDLTTAIKKATADRETDAVQNTVESDRKYEIKACIVRIMKTRKSLTHTLLINEIISQLKSRFTPNVQMIKICIEILIEQLYIRRSENEHNVYEYLA 729          
BLAST of Cullin-1 vs. Ensembl Celegans
Match: cul-2 (Cullin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q17390])

HSP 1 Score: 312.383 bits (799), Expect = 3.718e-93
Identity = 197/588 (33.50%), Postives = 313/588 (53.23%), Query Frame = 1
Query:  793 SVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKF--------LISPQNK----------SGNIDLNVMVLSSNSWPYTAQE--KFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNL-QLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            + Y + FE P +  TE++Y   +   L     ++Y+++V   + +EE R   ++H      ++E++ ++  K ++  H D++      L+  E   DLR M+ LL  I      M   FE +V +KG EA+S  + +N+P+   ++E +L VY K     T  F  +  F   LDK  +  +N     E  ++  K  E LA+Y D LLKKS++  +  DL+  L   + +F+YIEDKD+FQ FYSKMLA RLI   SIS D E  MI++LK++CGYE+T+KL RMF+D   S++L+  F         + P  K          +G+  LN   LS+NS   TAQ+   F LP+ L P  Q F  F+   H GRKL+W FN+ +G+V   Y  K Y+ Q+  YQ+A LL F +  +  VK+I E   +  + +++ ++  L   +L  +   +  D++ +++ ++                     +KR++  L   Q+    ++E E V + V  DR+  ++  IVR+MKTRK LKH  LV E+++Q   +F+P V  IK+ I  LIEK Y++R ++  D YQYLA
Sbjct:  217 AFYQESFEKPLLTDTEQYYSALAQKMLTDLSCSEYMEQVIVLLEQEEMRAKKYLH----ESSVEKVITLCQKVMIKAHKDKLHAVCHDLITNEENKDLRNMYRLLKPIQAGLSVMVKEFEEYVKKKGLEAVSRLTGENVPQQ--FVENVLRVYNKFNDMKTAVFMDDGEFSSGLDKALQGVVNSK---EPGQSVPKASERLARYTDGLLKKSTKGLSETDLEAKLDSAIVIFRYIEDKDIFQKFYSKMLANRLIASTSISMDAEELMINKLKQACGYEFTSKLSRMFTDIGLSQELSNNFDKHIADIKTVQPDVKFVPTQTMILQAGSWPLNAPQLSTNSNNQTAQDVANFHLPRILQPVIQEFEKFYTGKHNGRKLTWLFNMSQGDVRLTYLDKQYVAQMYVYQMAALLCFERRDAILVKDIGEEIGVSGDYLLKTIRTILDVTLLTCDDQNLTADSLVRLNMSM--------------------TSKRMKFRLQAPQVNKAVEKEQEAVANTVSQDRKYYMECAIVRIMKTRKVLKHNALVTEIMDQTKGRFSPDVPFIKKSIEDLIEKMYIQR-TDQNDEYQYLA 774          
BLAST of Cullin-1 vs. Ensembl Celegans
Match: cul-2 (Cullin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q17390])

HSP 1 Score: 312.383 bits (799), Expect = 3.718e-93
Identity = 197/588 (33.50%), Postives = 313/588 (53.23%), Query Frame = 1
Query:  793 SVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKF--------LISPQNK----------SGNIDLNVMVLSSNSWPYTAQE--KFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNL-QLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            + Y + FE P +  TE++Y   +   L     ++Y+++V   + +EE R   ++H      ++E++ ++  K ++  H D++      L+  E   DLR M+ LL  I      M   FE +V +KG EA+S  + +N+P+   ++E +L VY K     T  F  +  F   LDK  +  +N     E  ++  K  E LA+Y D LLKKS++  +  DL+  L   + +F+YIEDKD+FQ FYSKMLA RLI   SIS D E  MI++LK++CGYE+T+KL RMF+D   S++L+  F         + P  K          +G+  LN   LS+NS   TAQ+   F LP+ L P  Q F  F+   H GRKL+W FN+ +G+V   Y  K Y+ Q+  YQ+A LL F +  +  VK+I E   +  + +++ ++  L   +L  +   +  D++ +++ ++                     +KR++  L   Q+    ++E E V + V  DR+  ++  IVR+MKTRK LKH  LV E+++Q   +F+P V  IK+ I  LIEK Y++R ++  D YQYLA
Sbjct:  217 AFYQESFEKPLLTDTEQYYSALAQKMLTDLSCSEYMEQVIVLLEQEEMRAKKYLH----ESSVEKVITLCQKVMIKAHKDKLHAVCHDLITNEENKDLRNMYRLLKPIQAGLSVMVKEFEEYVKKKGLEAVSRLTGENVPQQ--FVENVLRVYNKFNDMKTAVFMDDGEFSSGLDKALQGVVNSK---EPGQSVPKASERLARYTDGLLKKSTKGLSETDLEAKLDSAIVIFRYIEDKDIFQKFYSKMLANRLIASTSISMDAEELMINKLKQACGYEFTSKLSRMFTDIGLSQELSNNFDKHIADIKTVQPDVKFVPTQTMILQAGSWPLNAPQLSTNSNNQTAQDVANFHLPRILQPVIQEFEKFYTGKHNGRKLTWLFNMSQGDVRLTYLDKQYVAQMYVYQMAALLCFERRDAILVKDIGEEIGVSGDYLLKTIRTILDVTLLTCDDQNLTADSLVRLNMSM--------------------TSKRMKFRLQAPQVNKAVEKEQEAVANTVSQDRKYYMECAIVRIMKTRKVLKHNALVTEIMDQTKGRFSPDVPFIKKSIEDLIEKMYIQR-TDQNDEYQYLA 774          
BLAST of Cullin-1 vs. Ensembl Celegans
Match: cul-2 (Cullin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q17390])

HSP 1 Score: 311.997 bits (798), Expect = 7.125e-93
Identity = 197/588 (33.50%), Postives = 313/588 (53.23%), Query Frame = 1
Query:  793 SVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKF--------LISPQNK----------SGNIDLNVMVLSSNSWPYTAQE--KFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNL-QLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            + Y + FE P +  TE++Y   +   L     ++Y+++V   + +EE R   ++H      ++E++ ++  K ++  H D++      L+  E   DLR M+ LL  I      M   FE +V +KG EA+S  + +N+P+   ++E +L VY K     T  F  +  F   LDK  +  +N     E  ++  K  E LA+Y D LLKKS++  +  DL+  L   + +F+YIEDKD+FQ FYSKMLA RLI   SIS D E  MI++LK++CGYE+T+KL RMF+D   S++L+  F         + P  K          +G+  LN   LS+NS   TAQ+   F LP+ L P  Q F  F+   H GRKL+W FN+ +G+V   Y  K Y+ Q+  YQ+A LL F +  +  VK+I E   +  + +++ ++  L   +L  +   +  D++ +++ ++                     +KR++  L   Q+    ++E E V + V  DR+  ++  IVR+MKTRK LKH  LV E+++Q   +F+P V  IK+ I  LIEK Y++R ++  D YQYLA
Sbjct:  234 AFYQESFEKPLLTDTEQYYSALAQKMLTDLSCSEYMEQVIVLLEQEEMRAKKYLH----ESSVEKVITLCQKVMIKAHKDKLHAVCHDLITNEENKDLRNMYRLLKPIQAGLSVMVKEFEEYVKKKGLEAVSRLTGENVPQQ--FVENVLRVYNKFNDMKTAVFMDDGEFSSGLDKALQGVVNSK---EPGQSVPKASERLARYTDGLLKKSTKGLSETDLEAKLDSAIVIFRYIEDKDIFQKFYSKMLANRLIASTSISMDAEELMINKLKQACGYEFTSKLSRMFTDIGLSQELSNNFDKHIADIKTVQPDVKFVPTQTMILQAGSWPLNAPQLSTNSNNQTAQDVANFHLPRILQPVIQEFEKFYTGKHNGRKLTWLFNMSQGDVRLTYLDKQYVAQMYVYQMAALLCFERRDAILVKDIGEEIGVSGDYLLKTIRTILDVTLLTCDDQNLTADSLVRLNMSMT--------------------SKRMKFRLQAPQVNKAVEKEQEAVANTVSQDRKYYMECAIVRIMKTRKVLKHNALVTEIMDQTKGRFSPDVPFIKKSIEDLIEKMYIQR-TDQNDEYQYLA 791          
BLAST of Cullin-1 vs. Ensembl Fly
Match: Cul1 (gene:FBgn0015509 transcript:FBtr0088848)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 339/834 (40.65%), Postives = 488/834 (58.51%), Query Frame = 1
Query:   40 NLLAIWEDLEVGIQAIFNME-NIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEE-MLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRIN--------SFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSK-STDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKF--LISPQNKSGNIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTK---KTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            NL  IW +L  GI  +F  E ++ R  YM  Y+ VY+YCT V         S++ S RS +G  G              GA+L+G +LY +L+++LK+++ +L  K    + EE +L      W  Y FS  VL+G+C YLNRNWVKR+ EEG K  + IY  AL+AW  +L +     ++ A++K +E+ER  + +N   ++ +I+C VE+                           + D D   +    LSVY + FE  FI  T  FY  ES  FL+ N +T+YLK VE+R+ EE QR+         S++H      T + L S   + L+  HL     EF  LL A+R  DL+RM++L+    +    + S  EN +  +G EAI+   +TD   +PK Y++TILDV+KK  A V  AF+ +  F+ ALDK C +FIN N VT +A ++ K+PE LAKYCD+LLKKSS++    +L++ L++ M VFKYIEDKDVFQ +YSKMLA+RL+N  S S+D EA MIS+LK++CGYEYT KLQRMF D   S+DLN+ F   ++ +N +  ID  + VLSS SWP+     F LP EL    + F +F+   H+GRKL+W + + +GE++ +  +    TY  Q ST+Q+++LL FN  LS++V+++ + TQ +   +IQ+LQI L+ KVL                T+ +NE    + P + + L+ DY+NK+ R+N+N  LK E K E E V   ++ DR++ I A IVR+MK RK L H  L+ EVL QLST+F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   15 NLDDIWSELVEGIMQVFEHEKSLTRSQYMRFYTHVYDYCTSV---------SAAPSGRS-SGKTG--------------GAQLVGKKLYDRLEQFLKSYLSELLTKFKAISGEEVLLSRYTKQWKSYQFSSTVLDGICNYLNRNWVKRECEEGQKGIYKIYRLALVAWKGHLFQVLNEPVTKAVLKSIEEERQGKLINRSLVRDVIECYVELS------------------------FNEEDTDAEQQ---KLSVYKQNFENKFIADTSAFYEKESDAFLSTNTVTEYLKHVENRLEEETQRVRGFNSKNGLSYLH----ETTADVLKSTCEEVLIEKHLKIFHTEFQNLLNADRNDDLKRMYSLVALSSKNLTDLKSILENHILHQGTEAIAKCCTTDAANDPKTYVQTILDVHKKYNALVLTAFNNDNGFVAALDKACGKFINSNVVT-IANSASKSPELLAKYCDLLLKKSSKNPEDKELEDNLNQVMVVFKYIEDKDVFQKYYSKMLAKRLVNHTSASDDAEAMMISKLKQTCGYEYTVKLQRMFQDIGVSKDLNSYFKQYLAEKNLTMEIDFGIEVLSSGSWPFQLSNNFLLPSELERSVRQFNEFYAARHSGRKLNWLYQMCKGELIMNVNRNNSSTYTLQASTFQMSVLLQFNDQLSFTVQQLQDNTQTQQENLIQVLQILLKAKVL----------------TSSDNEN--SLTPESTVELFLDYKNKKRRININQPLKTELKVEQETVHKHIEEDRKLLIQAAIVRIMKMRKRLNHTNLISEVLNQLSTRFKPKVPVIKKCIDILIEKEYLERMEGHKDTYSYLA 774          
BLAST of Cullin-1 vs. Ensembl Fly
Match: Cul1 (gene:FBgn0015509 transcript:FBtr0088847)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 339/834 (40.65%), Postives = 488/834 (58.51%), Query Frame = 1
Query:   40 NLLAIWEDLEVGIQAIFNME-NIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEE-MLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRIN--------SFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSK-STDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKF--LISPQNKSGNIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTK---KTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            NL  IW +L  GI  +F  E ++ R  YM  Y+ VY+YCT V         S++ S RS +G  G              GA+L+G +LY +L+++LK+++ +L  K    + EE +L      W  Y FS  VL+G+C YLNRNWVKR+ EEG K  + IY  AL+AW  +L +     ++ A++K +E+ER  + +N   ++ +I+C VE+                           + D D   +    LSVY + FE  FI  T  FY  ES  FL+ N +T+YLK VE+R+ EE QR+         S++H      T + L S   + L+  HL     EF  LL A+R  DL+RM++L+    +    + S  EN +  +G EAI+   +TD   +PK Y++TILDV+KK  A V  AF+ +  F+ ALDK C +FIN N VT +A ++ K+PE LAKYCD+LLKKSS++    +L++ L++ M VFKYIEDKDVFQ +YSKMLA+RL+N  S S+D EA MIS+LK++CGYEYT KLQRMF D   S+DLN+ F   ++ +N +  ID  + VLSS SWP+     F LP EL    + F +F+   H+GRKL+W + + +GE++ +  +    TY  Q ST+Q+++LL FN  LS++V+++ + TQ +   +IQ+LQI L+ KVL                T+ +NE    + P + + L+ DY+NK+ R+N+N  LK E K E E V   ++ DR++ I A IVR+MK RK L H  L+ EVL QLST+F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   15 NLDDIWSELVEGIMQVFEHEKSLTRSQYMRFYTHVYDYCTSV---------SAAPSGRS-SGKTG--------------GAQLVGKKLYDRLEQFLKSYLSELLTKFKAISGEEVLLSRYTKQWKSYQFSSTVLDGICNYLNRNWVKRECEEGQKGIYKIYRLALVAWKGHLFQVLNEPVTKAVLKSIEEERQGKLINRSLVRDVIECYVELS------------------------FNEEDTDAEQQ---KLSVYKQNFENKFIADTSAFYEKESDAFLSTNTVTEYLKHVENRLEEETQRVRGFNSKNGLSYLH----ETTADVLKSTCEEVLIEKHLKIFHTEFQNLLNADRNDDLKRMYSLVALSSKNLTDLKSILENHILHQGTEAIAKCCTTDAANDPKTYVQTILDVHKKYNALVLTAFNNDNGFVAALDKACGKFINSNVVT-IANSASKSPELLAKYCDLLLKKSSKNPEDKELEDNLNQVMVVFKYIEDKDVFQKYYSKMLAKRLVNHTSASDDAEAMMISKLKQTCGYEYTVKLQRMFQDIGVSKDLNSYFKQYLAEKNLTMEIDFGIEVLSSGSWPFQLSNNFLLPSELERSVRQFNEFYAARHSGRKLNWLYQMCKGELIMNVNRNNSSTYTLQASTFQMSVLLQFNDQLSFTVQQLQDNTQTQQENLIQVLQILLKAKVL----------------TSSDNEN--SLTPESTVELFLDYKNKKRRININQPLKTELKVEQETVHKHIEEDRKLLIQAAIVRIMKMRKRLNHTNLISEVLNQLSTRFKPKVPVIKKCIDILIEKEYLERMEGHKDTYSYLA 774          
BLAST of Cullin-1 vs. Ensembl Fly
Match: Cul1 (gene:FBgn0015509 transcript:FBtr0088845)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 339/834 (40.65%), Postives = 488/834 (58.51%), Query Frame = 1
Query:   40 NLLAIWEDLEVGIQAIFNME-NIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEE-MLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRIN--------SFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSK-STDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKF--LISPQNKSGNIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTK---KTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            NL  IW +L  GI  +F  E ++ R  YM  Y+ VY+YCT V         S++ S RS +G  G              GA+L+G +LY +L+++LK+++ +L  K    + EE +L      W  Y FS  VL+G+C YLNRNWVKR+ EEG K  + IY  AL+AW  +L +     ++ A++K +E+ER  + +N   ++ +I+C VE+                           + D D   +    LSVY + FE  FI  T  FY  ES  FL+ N +T+YLK VE+R+ EE QR+         S++H      T + L S   + L+  HL     EF  LL A+R  DL+RM++L+    +    + S  EN +  +G EAI+   +TD   +PK Y++TILDV+KK  A V  AF+ +  F+ ALDK C +FIN N VT +A ++ K+PE LAKYCD+LLKKSS++    +L++ L++ M VFKYIEDKDVFQ +YSKMLA+RL+N  S S+D EA MIS+LK++CGYEYT KLQRMF D   S+DLN+ F   ++ +N +  ID  + VLSS SWP+     F LP EL    + F +F+   H+GRKL+W + + +GE++ +  +    TY  Q ST+Q+++LL FN  LS++V+++ + TQ +   +IQ+LQI L+ KVL                T+ +NE    + P + + L+ DY+NK+ R+N+N  LK E K E E V   ++ DR++ I A IVR+MK RK L H  L+ EVL QLST+F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   15 NLDDIWSELVEGIMQVFEHEKSLTRSQYMRFYTHVYDYCTSV---------SAAPSGRS-SGKTG--------------GAQLVGKKLYDRLEQFLKSYLSELLTKFKAISGEEVLLSRYTKQWKSYQFSSTVLDGICNYLNRNWVKRECEEGQKGIYKIYRLALVAWKGHLFQVLNEPVTKAVLKSIEEERQGKLINRSLVRDVIECYVELS------------------------FNEEDTDAEQQ---KLSVYKQNFENKFIADTSAFYEKESDAFLSTNTVTEYLKHVENRLEEETQRVRGFNSKNGLSYLH----ETTADVLKSTCEEVLIEKHLKIFHTEFQNLLNADRNDDLKRMYSLVALSSKNLTDLKSILENHILHQGTEAIAKCCTTDAANDPKTYVQTILDVHKKYNALVLTAFNNDNGFVAALDKACGKFINSNVVT-IANSASKSPELLAKYCDLLLKKSSKNPEDKELEDNLNQVMVVFKYIEDKDVFQKYYSKMLAKRLVNHTSASDDAEAMMISKLKQTCGYEYTVKLQRMFQDIGVSKDLNSYFKQYLAEKNLTMEIDFGIEVLSSGSWPFQLSNNFLLPSELERSVRQFNEFYAARHSGRKLNWLYQMCKGELIMNVNRNNSSTYTLQASTFQMSVLLQFNDQLSFTVQQLQDNTQTQQENLIQVLQILLKAKVL----------------TSSDNEN--SLTPESTVELFLDYKNKKRRININQPLKTELKVEQETVHKHIEEDRKLLIQAAIVRIMKMRKRLNHTNLISEVLNQLSTRFKPKVPVIKKCIDILIEKEYLERMEGHKDTYSYLA 774          
BLAST of Cullin-1 vs. Ensembl Fly
Match: Cul1 (gene:FBgn0015509 transcript:FBtr0088846)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 339/834 (40.65%), Postives = 488/834 (58.51%), Query Frame = 1
Query:   40 NLLAIWEDLEVGIQAIFNME-NIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEE-MLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRIN--------SFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSK-STDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKF--LISPQNKSGNIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTK---KTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            NL  IW +L  GI  +F  E ++ R  YM  Y+ VY+YCT V         S++ S RS +G  G              GA+L+G +LY +L+++LK+++ +L  K    + EE +L      W  Y FS  VL+G+C YLNRNWVKR+ EEG K  + IY  AL+AW  +L +     ++ A++K +E+ER  + +N   ++ +I+C VE+                           + D D   +    LSVY + FE  FI  T  FY  ES  FL+ N +T+YLK VE+R+ EE QR+         S++H      T + L S   + L+  HL     EF  LL A+R  DL+RM++L+    +    + S  EN +  +G EAI+   +TD   +PK Y++TILDV+KK  A V  AF+ +  F+ ALDK C +FIN N VT +A ++ K+PE LAKYCD+LLKKSS++    +L++ L++ M VFKYIEDKDVFQ +YSKMLA+RL+N  S S+D EA MIS+LK++CGYEYT KLQRMF D   S+DLN+ F   ++ +N +  ID  + VLSS SWP+     F LP EL    + F +F+   H+GRKL+W + + +GE++ +  +    TY  Q ST+Q+++LL FN  LS++V+++ + TQ +   +IQ+LQI L+ KVL                T+ +NE    + P + + L+ DY+NK+ R+N+N  LK E K E E V   ++ DR++ I A IVR+MK RK L H  L+ EVL QLST+F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   15 NLDDIWSELVEGIMQVFEHEKSLTRSQYMRFYTHVYDYCTSV---------SAAPSGRS-SGKTG--------------GAQLVGKKLYDRLEQFLKSYLSELLTKFKAISGEEVLLSRYTKQWKSYQFSSTVLDGICNYLNRNWVKRECEEGQKGIYKIYRLALVAWKGHLFQVLNEPVTKAVLKSIEEERQGKLINRSLVRDVIECYVELS------------------------FNEEDTDAEQQ---KLSVYKQNFENKFIADTSAFYEKESDAFLSTNTVTEYLKHVENRLEEETQRVRGFNSKNGLSYLH----ETTADVLKSTCEEVLIEKHLKIFHTEFQNLLNADRNDDLKRMYSLVALSSKNLTDLKSILENHILHQGTEAIAKCCTTDAANDPKTYVQTILDVHKKYNALVLTAFNNDNGFVAALDKACGKFINSNVVT-IANSASKSPELLAKYCDLLLKKSSKNPEDKELEDNLNQVMVVFKYIEDKDVFQKYYSKMLAKRLVNHTSASDDAEAMMISKLKQTCGYEYTVKLQRMFQDIGVSKDLNSYFKQYLAEKNLTMEIDFGIEVLSSGSWPFQLSNNFLLPSELERSVRQFNEFYAARHSGRKLNWLYQMCKGELIMNVNRNNSSTYTLQASTFQMSVLLQFNDQLSFTVQQLQDNTQTQQENLIQVLQILLKAKVL----------------TSSDNEN--SLTPESTVELFLDYKNKKRRININQPLKTELKVEQETVHKHIEEDRKLLIQAAIVRIMKMRKRLNHTNLISEVLNQLSTRFKPKVPVIKKCIDILIEKEYLERMEGHKDTYSYLA 774          
BLAST of Cullin-1 vs. Ensembl Fly
Match: Cul2 (gene:FBgn0032956 transcript:FBtr0085900)

HSP 1 Score: 353.214 bits (905), Expect = 1.996e-108
Identity = 229/713 (32.12%), Postives = 377/713 (52.88%), Query Frame = 1
Query:  400 SWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIK-EVEKERLD-------EQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFIS-MTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGNIDLNV----MVLSSNSWPYTAQE--KFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            +W EYS  +K L+ + +YLN+  +K+Q     + F+                    + SDA  + E+ +  LD       E L+   ++ I++ +        +     GTL   +    + +I         K    L +Y ++FE P ++ +  +Y  E+   L +  +++Y+++V   +  E +R   F+H +    +L +L     +  + D L  I +E   +++ ER  DLR M+ +L  IP+   S + + F + +  +G + +S+   +N+     ++E +L V+ K    + + F  +  FL ALDK C   IN+       +   ++ E++AKYCD LLKKS   T   ++D+ L+  +T+FKYIEDKDV+Q FYS++LA+RLI++ S S D E  MI+RLK++CGYE+T KL RMF+D S S DLN KF  +   K  N+DL +     VL + +WP  + +   F +PQE     + F D+++   +GRKL+W  ++  GE+   + KK+YI  + TYQ+AI+LLF  C S S +EI    QL      + +Q  +  K+L  + + +A +T  +I+ NL                  DY NKR +  ++  L+ ET QEVE  I+ VD DR++ + A IVR+MK RK LKH  L++EVL      F P + +IK+C+  LI+K+Y++R +N  D Y Y+A
Sbjct:   99 TWMEYSQGIKYLHQLYIYLNQQHIKKQKITDTESFYG------------------NLSSDAAEQMEIGELGLDIWRLYMIEYLSSELVRHILEGI-------AADRASNGTLDHHRVQIINGVIHSFVEVQDYKKTGSLKLYQELFEGPMLEASGAYYTDEANKLLHRCSVSEYMQEVIRILEYESRRAQKFLHVS----SLPKLRKECEEKFINDRLGFIYSECREMVSEERRQDLRNMYVVLKPIPDNLKSELITTFLDHIKSEGLQTVSALKGENIH--IAFVENMLKVHHKYQELIADVFENDSLFLSALDKACASVINRRPT---ERQPCRSAEYVAKYCDTLLKKSK--TCEAEIDQKLTNNITIFKYIEDKDVYQKFYSRLLAKRLIHEQSQSMDAEEGMINRLKQACGYEFTNKLHRMFTDISVSVDLNNKF--NTHLKDSNVDLGINLAIKVLQAGAWPLGSTQVIPFAVPQEFEKSIKMFEDYYHKLFSGRKLTWLHHMCHGELKLSHLKKSYIVTMQTYQMAIILLFETCDSLSCREIQNTLQLNDETFQKHMQPIIESKLLNASSENLAGET--RIELNL------------------DYTNKRTKFKISSALQKETPQEVEHTINSVDEDRKLFLQAAIVRIMKARKVLKHNALIQEVLSLSKVSFTPNIAMIKKCVESLIDKQYIERTANSGDEYSYMA 753          
BLAST of Cullin-1 vs. Ensembl Zebrafish
Match: cul1a (cullin 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2603])

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 344/815 (42.21%), Postives = 503/815 (61.72%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT V   N  V+    A ++     P               GA+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W E L RP    +++A++K +EKER  E +N R +  ++   VE+G                            + D +      LSVY + FET F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  +Y +G  AI       L +PK+Y++TILDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+M ++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W ++L +GE+VT+  K  Y  Q ST+Q+AILL +N    Y+V+++ ++TQ++ +I++Q+LQI L+ K+LV+  +   +D V             +  P+T++ L+  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   20 IWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN-QVRGGGPAPSKPSKKTP------------TPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRECLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELG---------------------------LNEDDAFAKGPTLSVYKEYFETQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRITDGLGELKKLLETHIYNQGLAAIEKCGESALNDPKMYVQTILDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMVQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYHLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDVYTVQQLTDSTQIKIDILVQVLQILLKSKLLVLEDENANVDEV-------------EFKPDTLIKLFLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 777          
BLAST of Cullin-1 vs. Ensembl Zebrafish
Match: cul1a (cullin 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2603])

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 344/815 (42.21%), Postives = 503/815 (61.72%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT V   N  V+    A ++     P               GA+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W E L RP    +++A++K +EKER  E +N R +  ++   VE+G                            + D +      LSVY + FET F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  +Y +G  AI       L +PK+Y++TILDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+M ++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W ++L +GE+VT+  K  Y  Q ST+Q+AILL +N    Y+V+++ ++TQ++ +I++Q+LQI L+ K+LV+  +   +D V             +  P+T++ L+  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   20 IWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN-QVRGGGPAPSKPSKKTP------------TPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRECLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELG---------------------------LNEDDAFAKGPTLSVYKEYFETQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRITDGLGELKKLLETHIYNQGLAAIEKCGESALNDPKMYVQTILDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMVQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYHLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDVYTVQQLTDSTQIKIDILVQVLQILLKSKLLVLEDENANVDEV-------------EFKPDTLIKLFLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 777          
BLAST of Cullin-1 vs. Ensembl Zebrafish
Match: cul1a (cullin 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2603])

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 344/815 (42.21%), Postives = 503/815 (61.72%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT V   N  V+    A ++     P               GA+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W E L RP    +++A++K +EKER  E +N R +  ++   VE+G                            + D +      LSVY + FET F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  +Y +G  AI       L +PK+Y++TILDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+M ++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W ++L +GE+VT+  K  Y  Q ST+Q+AILL +N    Y+V+++ ++TQ++ +I++Q+LQI L+ K+LV+  +   +D V             +  P+T++ L+  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   20 IWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN-QVRGGGPAPSKPSKKTP------------TPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRECLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELG---------------------------LNEDDAFAKGPTLSVYKEYFETQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRITDGLGELKKLLETHIYNQGLAAIEKCGESALNDPKMYVQTILDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMVQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYHLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDVYTVQQLTDSTQIKIDILVQVLQILLKSKLLVLEDENANVDEV-------------EFKPDTLIKLFLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 777          
BLAST of Cullin-1 vs. Ensembl Zebrafish
Match: cul1b (cullin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2887])

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 345/819 (42.12%), Postives = 508/819 (62.03%), Query Frame = 1
Query:   40 NLLAIWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
             L  IW+DL  GIQ ++  +++ R  YM LY+ VYNYCT V     +   SS  S ++    PG              GA+ +G ELYK+LK++L++++  L   G+   DE +LKF    W +Y FS KVL+G+C YLNR+WV+R+ +EG K  ++IY+ AL+ W E L RP    +++A++K VEKER  E +N R +  ++   VE+G                 + D++ + G             LSVY + FE  F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E+ ++ +G  AI       L +PK+Y++T LDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W ++L +GE+VT+  K  Y  Q ST+Q+AILL FN    YSV+++ ++TQ++++I++Q+LQI L+ K+LV+  +   +D +             D  P+T++ L+  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   16 GLEQIWDDLRSGIQQVYTRQSMARSRYMELYTHVYNYCTSVHQARPTGIPSSKPSKKTPT--PG--------------GAQFVGLELYKRLKDFLRSYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLDGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRECLFRPLNKQVTNAVLKLVEKERNGETINTRLVSGVVQSYVELGL----------------NEDDAFVKGPT-----------LSVYKEYFEAQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRITDGLGELKKLLESHIHNQGLAAIEKCGDSALNDPKMYVQTTLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTRMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLSNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYGSRHSGRKLTWLYHLSKGELVTNCFKNRYTLQASTFQMAILLQFNTENCYSVQQLADSTQIKTDILVQVLQILLKSKLLVLEDENANIDEM-------------DFKPDTLIKLFLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 774          
BLAST of Cullin-1 vs. Ensembl Zebrafish
Match: cul1b (cullin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2887])

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 345/819 (42.12%), Postives = 508/819 (62.03%), Query Frame = 1
Query:   40 NLLAIWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
             L  IW+DL  GIQ ++  +++ R  YM LY+ VYNYCT V     +   SS  S ++    PG              GA+ +G ELYK+LK++L++++  L   G+   DE +LKF    W +Y FS KVL+G+C YLNR+WV+R+ +EG K  ++IY+ AL+ W E L RP    +++A++K VEKER  E +N R +  ++   VE+G                 + D++ + G             LSVY + FE  F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E+ ++ +G  AI       L +PK+Y++T LDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W ++L +GE+VT+  K  Y  Q ST+Q+AILL FN    YSV+++ ++TQ++++I++Q+LQI L+ K+LV+  +   +D +             D  P+T++ L+  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   16 GLEQIWDDLRSGIQQVYTRQSMARSRYMELYTHVYNYCTSVHQARPTGIPSSKPSKKTPT--PG--------------GAQFVGLELYKRLKDFLRSYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLDGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRECLFRPLNKQVTNAVLKLVEKERNGETINTRLVSGVVQSYVELGL----------------NEDDAFVKGPT-----------LSVYKEYFEAQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRITDGLGELKKLLESHIHNQGLAAIEKCGDSALNDPKMYVQTTLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTRMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLSNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYGSRHSGRKLTWLYHLSKGELVTNCFKNRYTLQASTFQMAILLQFNTENCYSVQQLADSTQIKTDILVQVLQILLKSKLLVLEDENANIDEM-------------DFKPDTLIKLFLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 774          
BLAST of Cullin-1 vs. Ensembl Xenopus
Match: cplx1 (complexin 1 [Source:Xenbase;Acc:XB-GENE-5815523])

HSP 1 Score: 635.95 bits (1639), Expect = 0.000e+0
Identity = 339/815 (41.60%), Postives = 501/815 (61.47%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT V   N +       S       PG              GA+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W + L +P    +++A++K +EKER  E +N R +  ++   VE+G                            + D +      L+VY + FE+ F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  ++ +G  AI         +PK+Y++T+LDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W + L +GE+VT+  K  Y  Q ST+Q+AILL +N   +Y+V+++ ++TQ++ +I++Q+LQI L+ K+LV+  +   +D V             D+ P+ ++ LY  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   20 IWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPG--------------GAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFKPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELG---------------------------LNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAQNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQFCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILVQVLQILLKSKLLVLEDENANVDDV-------------DLKPDILIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 776          
BLAST of Cullin-1 vs. Ensembl Xenopus
Match: cplx1 (complexin 1 [Source:Xenbase;Acc:XB-GENE-5815523])

HSP 1 Score: 505.753 bits (1301), Expect = 1.512e-167
Identity = 257/569 (45.17%), Postives = 377/569 (66.26%), Query Frame = 1
Query:  790 LSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            L+VY + FE+ F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  ++ +G  AI         +PK+Y++T+LDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W + L +GE+VT+  K  Y  Q ST+Q+AILL +N   +Y+V+++ ++TQ++ +I++Q+LQI L+ K+LV+  +   +D V             D+ P+ ++ LY  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:  116 LTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAQNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQFCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILVQVLQILLKSKLLVLEDENANVDDV-------------DLKPDILIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 667          

HSP 2 Score: 71.633 bits (174), Expect = 4.189e-12
Identity = 30/69 (43.48%), Postives = 47/69 (68.12%), Query Frame = 1
Query:  337 IKLKIKGDGK--TDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAW 537
            ++  I+ DG+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ + + +
Sbjct:   24 LRAGIQQDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSVSWITF 92          
BLAST of Cullin-1 vs. Ensembl Xenopus
Match: cplx1 (complexin 1 [Source:Xenbase;Acc:XB-GENE-5815523])

HSP 1 Score: 504.597 bits (1298), Expect = 2.296e-166
Identity = 257/569 (45.17%), Postives = 377/569 (66.26%), Query Frame = 1
Query:  790 LSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            L+VY + FE+ F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  ++ +G  AI         +PK+Y++T+LDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W + L +GE+VT+  K  Y  Q ST+Q+AILL +N   +Y+V+++ ++TQ++ +I++Q+LQI L+ K+LV+  +   +D V             D+ P+ ++ LY  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:  166 LTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAQNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQFCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILVQVLQILLKSKLLVLEDENANVDDV-------------DLKPDILIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 717          

HSP 2 Score: 99.3673 bits (246), Expect = 1.005e-20
Identity = 58/162 (35.80%), Postives = 86/162 (53.09%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAW 537
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT                                        A+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ + + +
Sbjct:   20 IWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCT---------------------------------------SAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSVSWITF 142          
BLAST of Cullin-1 vs. Ensembl Xenopus
Match: cplx1 (complexin 1 [Source:Xenbase;Acc:XB-GENE-5815523])

HSP 1 Score: 505.368 bits (1300), Expect = 2.438e-166
Identity = 257/569 (45.17%), Postives = 377/569 (66.26%), Query Frame = 1
Query:  790 LSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            L+VY + FE+ F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  ++ +G  AI         +PK+Y++T+LDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W + L +GE+VT+  K  Y  Q ST+Q+AILL +N   +Y+V+++ ++TQ++ +I++Q+LQI L+ K+LV+  +   +D V             D+ P+ ++ LY  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:  191 LTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAQNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQFCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILVQVLQILLKSKLLVLEDENANVDDV-------------DLKPDILIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 742          

HSP 2 Score: 115.161 bits (287), Expect = 1.433e-25
Identity = 64/162 (39.51%), Postives = 93/162 (57.41%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAW 537
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT V   N +       S       PG              GA+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ + + +
Sbjct:   20 IWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPG--------------GAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSVSWITF 167          
BLAST of Cullin-1 vs. Ensembl Xenopus
Match: CUL2 (cullin 2 [Source:NCBI gene;Acc:100492608])

HSP 1 Score: 390.193 bits (1001), Expect = 3.239e-122
Identity = 244/742 (32.88%), Postives = 396/742 (53.37%), Query Frame = 1
Query:  328 NHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKR-QLEEGHKQF-----------HDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGNIDLN----VMVLSSNSWPYT--AQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQ--EVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            NHV +L  +    + E++L      W EYS     ++ +  YLN  ++K+ +L E   Q+            +I   AL  W + ++ P Q  +   L+KE++++R  E  N + +  +I+  V V +                                 K  F L  Y +IFE PF+ +T  +Y+ E+ + L ++  + Y++K+  R+ +EE R   ++H +  NK + E      + ++ADHL  +  E   ++  ER SD+  M+TLL  +      M    +N ++ +G  AIS+ S +N+P    ++E++L+V+ K    V    +G+  F+ ALDK     +N        K+  K PE LAKYCD +LKKS++    +++++ L+ F+TVFKYI+DKDVFQ FY++MLA+RLI+ LS+S D E  MI++LK++CGYE+T+KL RM++D S S DLN KF    +N+   IDL     + VL + +WP T      F +PQEL    Q F  F+N   +GRKL+W   L  GEV  +Y  K Y+  V+TYQ+A+LL FN     + KE+ ++TQ+    + + ++  L  K++  + DK  +D  S    N+                  ++ +KR +  +   ++ +T Q  EVE+  S VD DR+M + A IVR+MK RK L+H  L++EV+ Q   +FNP +++IK+CI  LI+K+Y++R     D Y Y+A
Sbjct:   67 NHVQQLHTRV-LDSAEQVLVMYYRYWEEYSRGADYMDCLYRYLNTQYIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDLWRKLMIEPLQDTLLRMLLKEIKRDRCGEDPNQKVIHGVINSFVHVEQY--------------------------------KKKFPLKFYQEIFELPFLAETGEYYKQEASNLLQESNCSQYMEKILGRLKDEEIRCRKYLHPSSYNKVIHECQ----QRMVADHLQFLHAECHNIIRQERRSDMANMYTLLRAVSNGLPHMIQELQNHIHDEGLRAISNLSQENMPTQ--FVESVLEVHSKFVQLVNSVLNGDQHFMSALDKALTCVVNYRE----PKSVCKAPELLAKYCDNMLKKSAKGMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEETMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYNQHFSGRKLTWLHYLCTGEVKMNYLCKPYVAMVTTYQMAVLLAFNNSEIVTYKELQDSTQMNEKELTKTIKSLLDVKMINHDSDKEDIDGESTFSLNM------------------NFSSKRTKFKITTPMQKDTPQVREVEQTRSAVDEDRKMYLQAAIVRIMKARKILRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA 747          
BLAST of Cullin-1 vs. Ensembl Mouse
Match: Cul1 (cullin 1 [Source:MGI Symbol;Acc:MGI:1349658])

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 341/815 (41.84%), Postives = 502/815 (61.60%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT V   N +       S       PG              GA+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W + L RP    +++A++K +EKER  E +N R +  ++   VE+G                            + D +      L+VY + FE+ F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  ++ +G  AI       L +PK+Y++T+LDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W + L +GE+VT+  K  Y  Q ST+Q+AILL +N   +Y+V+++ ++TQ++ +I+ Q+LQI L+ K+LV+  +   +D V             ++ P+T++ LY  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   20 IWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPG--------------GAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELG---------------------------LNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEV-------------ELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 776          
BLAST of Cullin-1 vs. Ensembl Mouse
Match: Cul1 (cullin 1 [Source:MGI Symbol;Acc:MGI:1349658])

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 297/736 (40.35%), Postives = 445/736 (60.46%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVE 2256
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT V   N +       S       PG              GA+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W + L RP    +++A++K +EKER  E +N R +  ++   VE+G                            + D +      L+VY + FE+ F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  ++ +G  AI       L +PK+Y++T+LDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W + L +GE+VT+  K  Y  Q ST+Q+AILL +N   +Y+V+++ ++TQ++ +I+ Q+LQI L+ K+LV+  +   +D V             ++ P+T++ LY  Y+NK++RVN+N+ +K E KQE E
Sbjct:   20 IWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPG--------------GAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELG---------------------------LNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEV-------------ELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQE 697          
BLAST of Cullin-1 vs. Ensembl Mouse
Match: Cul2 (cullin 2 [Source:MGI Symbol;Acc:MGI:1918995])

HSP 1 Score: 392.889 bits (1008), Expect = 2.304e-123
Identity = 232/728 (31.87%), Postives = 390/728 (53.57%), Query Frame = 1
Query:  364 KTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKR-QLEEGHKQF-----------HDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGNIDLN----VMVLSSNSWPYT--AQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            +++E++L      W EYS     ++ +  YLN  ++K+ +L E   Q+            +I   AL  W + ++ P Q I+   L++E++ +R  E  N + +  +I+  V V +                                 K  F L  Y  IF +PF+ +T  +Y+ E+ + L ++  + Y++KV  R+ +EE R   ++H +   K + E      + ++ADHL  + +E   ++  ER +D+  M+ LL  +      M    +  ++ +G  A S+ + +++P   +++E++L+V+ K    +    +G+  F+ ALDK     +N        K+  K PE LAKYCD LLKKS++    +++++ L+ F+TVFKYI+DKDVFQ FY++MLA+RLI+ LS+S D E AMI++LK++CGYE+T+KL RM++D S S DLN KF    +N+   IDL     + VL + +WP T      F +PQEL    Q F  F++   +GRKL+W   L  GEV  +Y  K Y+  V+TYQ+A+LL FN   + S KE+ ++TQ+    + + ++  L  K++  + +K  +D  S    N+                   + +KR +  +   ++ +T QE+E+  S VD DR+M + A IVR+MK RK L+H  L++EV+ Q   +FNP +++IK+CI  LI+K+Y++R     D Y Y+A
Sbjct:   78 ESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQYIKKNKLTEADIQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQNILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQY--------------------------------KKKFPLKFYQGIFVSPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQ----QRMVADHLQFLHSECHSIIQQERKNDMANMYVLLRAVSSGLPHMIEELQKHIHDEGLRATSNLTQEHMP--TLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYRE----PKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIRNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNM------------------SFSSKRTKFKITTSMQKDTPQELEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA 745          
BLAST of Cullin-1 vs. Ensembl Mouse
Match: Cul2 (cullin 2 [Source:MGI Symbol;Acc:MGI:1918995])

HSP 1 Score: 332.413 bits (851), Expect = 6.587e-101
Identity = 212/728 (29.12%), Postives = 362/728 (49.73%), Query Frame = 1
Query:  364 KTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKR-QLEEGHKQF-----------HDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGNIDLN----VMVLSSNSWPYT--AQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            +++E++L      W EYS     ++ +  YLN  ++K+ +L E   Q+            +I   AL  W + ++ P Q I+   L++E++ +R  E  N + +  +I+  V V +                                 K  F L  Y  IF +PF+ +T  +Y+ E+ + L ++  + Y++KV  R+ +EE R   ++H +   K + E      + ++ADHL  + +E   ++  ER +D+  M+ LL  +      M    +  ++ +G  A S+ + +++P   +++E++L+V+ K    +    +G+  F+ ALDK     +N        K+  K PE LAKYCD LLKKS++    +++++ L+ F+TVFKYI+DKDVFQ FY++MLA+RLI+ LS+S D E AMI++LK++CGYE+T+KL RM++D S S DLN KF    +N+   IDL     + VL + +WP T      F +PQEL    Q F  F++   +GRKL+W   L  GEV  +Y  K Y+  V+TYQ+A+LL FN   + S KE+ ++TQ+    + + ++  L  K++  + +K  +D  S    N+                   + +KR +  +   ++ +T Q                                       V+ Q   +FNP +++IK+CI  LI+K+Y++R     D Y Y+A
Sbjct:   78 ESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQYIKKNKLTEADIQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQNILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQY--------------------------------KKKFPLKFYQGIFVSPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQ----QRMVADHLQFLHSECHSIIQQERKNDMANMYVLLRAVSSGLPHMIEELQKHIHDEGLRATSNLTQEHMP--TLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYRE----PKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIRNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNM------------------SFSSKRTKFKITTSMQKDTPQ---------------------------------------VISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA 706          
BLAST of Cullin-1 vs. Ensembl Mouse
Match: Cul2 (cullin 2 [Source:MGI Symbol;Acc:MGI:1918995])

HSP 1 Score: 291.967 bits (746), Expect = 2.681e-87
Identity = 184/564 (32.62%), Postives = 303/564 (53.72%), Query Frame = 1
Query:  499 QFHDIYTCALLAWTENL---LRPHQTIISDALIKEVEKERLDEQ-----LNHRFLKPI------IDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGNIDLN----VMVLSSNSWPYT--AQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNL 2130
            +F DIY   + A+ E L   L     I  ++ ++ + K  L+ +     + HR+ +        +DCL      GG  P      G         +I    H    K  F L  Y  IF +PF+ +T  +Y+ E+ + L ++  + Y++KV  R+ +EE R   ++H +   K + E      + ++ADHL  + +E   ++  ER +D+  M+ LL  +      M    +  ++ +G  A S+ + +++P   +++E++L+V+ K    +    +G+  F+ ALDK     +N        K+  K PE LAKYCD LLKKS++    +++++ L+ F+TVFKYI+DKDVFQ FY++MLA+RLI+ LS+S D E AMI++LK++CGYE+T+KL RM++D S S DLN KF    +N+   IDL     + VL + +WP T      F +PQEL    Q F  F++   +GRKL+W   L  GEV  +Y  K Y+  V+TYQ+A+LL FN   + S KE+ ++TQ+    + + ++  L  K++  + +K  +D  S    N+
Sbjct:   38 RFSDIYALCV-AYPEPLGERLYAETKIFLESHVRHLYKRVLESEEQVLVMYHRYWEEYSKGADYMDCLY--SDRGGEDPNQKVIHG---------VINSFVHVEQYKKKFPLKFYQGIFVSPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQ----QRMVADHLQFLHSECHSIIQQERKNDMANMYVLLRAVSSGLPHMIEELQKHIHDEGLRATSNLTQEHMP--TLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYRE----PKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIRNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNM 579          
BLAST of Cullin-1 vs. UniProt/SwissProt
Match: sp|Q9WTX6|CUL1_MOUSE (Cullin-1 OS=Mus musculus OX=10090 GN=Cul1 PE=1 SV=1)

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 341/815 (41.84%), Postives = 502/815 (61.60%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT V   N +       S       PG              GA+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W + L RP    +++A++K +EKER  E +N R +  ++   VE+G                            + D +      L+VY + FE+ F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  ++ +G  AI       L +PK+Y++T+LDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W + L +GE+VT+  K  Y  Q ST+Q+AILL +N   +Y+V+++ ++TQ++ +I+ Q+LQI L+ K+LV+  +   +D V             ++ P+T++ LY  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   20 IWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPG--------------GAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELG---------------------------LNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEV-------------ELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 776          
BLAST of Cullin-1 vs. UniProt/SwissProt
Match: sp|Q5R4G6|CUL1_PONAB (Cullin-1 OS=Pongo abelii OX=9601 GN=CUL1 PE=2 SV=1)

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 341/815 (41.84%), Postives = 502/815 (61.60%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT V   N +       S       PG              GA+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W + L RP    +++A++K +EKER  E +N R +  ++   VE+G                            + D +      L+VY + FE+ F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  ++ +G  AI       L +PK+Y++T+LDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W + L +GE+VT+  K  Y  Q ST+Q+AILL +N   +Y+V+++ ++TQ++ +I+ Q+LQI L+ K+LV+  +   +D V             ++ P+T++ LY  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   20 IWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPG--------------GAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELG---------------------------LNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEV-------------ELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 776          
BLAST of Cullin-1 vs. UniProt/SwissProt
Match: sp|Q13616|CUL1_HUMAN (Cullin-1 OS=Homo sapiens OX=9606 GN=CUL1 PE=1 SV=2)

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 341/815 (41.84%), Postives = 502/815 (61.60%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT V   N +       S       PG              GA+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W + L RP    +++A++K +EKER  E +N R +  ++   VE+G                            + D +      L+VY + FE+ F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  ++ +G  AI       L +PK+Y++T+LDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W + L +GE+VT+  K  Y  Q ST+Q+AILL +N   +Y+V+++ ++TQ++ +I+ Q+LQI L+ K+LV+  +   +D V             ++ P+T++ LY  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   20 IWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPG--------------GAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELG---------------------------LNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEV-------------ELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 776          
BLAST of Cullin-1 vs. UniProt/SwissProt
Match: sp|Q24311|CUL1_DROME (Cullin homolog 1 OS=Drosophila melanogaster OX=7227 GN=Cul1 PE=1 SV=2)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 339/834 (40.65%), Postives = 488/834 (58.51%), Query Frame = 1
Query:   40 NLLAIWEDLEVGIQAIFNME-NIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEE-MLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRIN--------SFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSK-STDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKF--LISPQNKSGNIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTK---KTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            NL  IW +L  GI  +F  E ++ R  YM  Y+ VY+YCT V         S++ S RS +G  G              GA+L+G +LY +L+++LK+++ +L  K    + EE +L      W  Y FS  VL+G+C YLNRNWVKR+ EEG K  + IY  AL+AW  +L +     ++ A++K +E+ER  + +N   ++ +I+C VE+                           + D D   +    LSVY + FE  FI  T  FY  ES  FL+ N +T+YLK VE+R+ EE QR+         S++H      T + L S   + L+  HL     EF  LL A+R  DL+RM++L+    +    + S  EN +  +G EAI+   +TD   +PK Y++TILDV+KK  A V  AF+ +  F+ ALDK C +FIN N VT +A ++ K+PE LAKYCD+LLKKSS++    +L++ L++ M VFKYIEDKDVFQ +YSKMLA+RL+N  S S+D EA MIS+LK++CGYEYT KLQRMF D   S+DLN+ F   ++ +N +  ID  + VLSS SWP+     F LP EL    + F +F+   H+GRKL+W + + +GE++ +  +    TY  Q ST+Q+++LL FN  LS++V+++ + TQ +   +IQ+LQI L+ KVL                T+ +NE    + P + + L+ DY+NK+ R+N+N  LK E K E E V   ++ DR++ I A IVR+MK RK L H  L+ EVL QLST+F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   15 NLDDIWSELVEGIMQVFEHEKSLTRSQYMRFYTHVYDYCTSV---------SAAPSGRS-SGKTG--------------GAQLVGKKLYDRLEQFLKSYLSELLTKFKAISGEEVLLSRYTKQWKSYQFSSTVLDGICNYLNRNWVKRECEEGQKGIYKIYRLALVAWKGHLFQVLNEPVTKAVLKSIEEERQGKLINRSLVRDVIECYVELS------------------------FNEEDTDAEQQ---KLSVYKQNFENKFIADTSAFYEKESDAFLSTNTVTEYLKHVENRLEEETQRVRGFNSKNGLSYLH----ETTADVLKSTCEEVLIEKHLKIFHTEFQNLLNADRNDDLKRMYSLVALSSKNLTDLKSILENHILHQGTEAIAKCCTTDAANDPKTYVQTILDVHKKYNALVLTAFNNDNGFVAALDKACGKFINSNVVT-IANSASKSPELLAKYCDLLLKKSSKNPEDKELEDNLNQVMVVFKYIEDKDVFQKYYSKMLAKRLVNHTSASDDAEAMMISKLKQTCGYEYTVKLQRMFQDIGVSKDLNSYFKQYLAEKNLTMEIDFGIEVLSSGSWPFQLSNNFLLPSELERSVRQFNEFYAARHSGRKLNWLYQMCKGELIMNVNRNNSSTYTLQASTFQMSVLLQFNDQLSFTVQQLQDNTQTQQENLIQVLQILLKAKVL----------------TSSDNEN--SLTPESTVELFLDYKNKKRRININQPLKTELKVEQETVHKHIEEDRKLLIQAAIVRIMKMRKRLNHTNLISEVLNQLSTRFKPKVPVIKKCIDILIEKEYLERMEGHKDTYSYLA 774          
BLAST of Cullin-1 vs. UniProt/SwissProt
Match: sp|O60999|CUL1_DICDI (Cullin-1 OS=Dictyostelium discoideum OX=44689 GN=culA PE=1 SV=1)

HSP 1 Score: 533.872 bits (1374), Expect = 2.615e-176
Identity = 314/823 (38.15%), Postives = 473/823 (57.47%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIG--RESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKF---LISPQNKSGNIDLNVMVLSSNSWPY-TAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHY---TKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            IW +LE GI  I    N G  ++ ++ LY+ VY+YC        + Q+ SSA      G P              +GA  +G +LY +L  +LK H+ +L    + K DE +L +  + W  Y+ ++K +N +  Y+NR W+KR++++G K+ ++I+  +L+ W + L  P +  ++++L+  +E ER   Q+N   +K +I+  V +G +    PK T                             L VY   FE  F+  TE +Y  ES  F+++N + DY+KKVE R+ EE +R+  ++H      T  EL +   K L+  H++ I NEF  LL  ++I DL RM++LL +IP     + +  E  V   G +A+SS +T+ + EPKVYIET+L V+KK    VT AF  +  F+ +LDK C RFIN+NAVT  AK+S K+PE LA++ D LLKKS  +    +++++L+  M VFKYIEDKDVFQ FYSKMLA+RLI+  S SED+E  MI +LK +CGYEYT+KLQRMF+D S SR+L  +F   +   +  S NID +V+VL++ SWP       F++P+EL  C Q F  F+   H+GRKL+W  +L +GE+ T Y   +K  Y  Q STYQI +LL FN+  + + +EI E+TQL  +++   L    + K+L+              D  L++EE   I   T   L   ++NK+ ++ +N+ +  + K+E++ +   V+ DR++ I A IVR+MK RK L H  L+ EV+ QL T+FNP+V +IK+CI  LIEKEYL R    KD Y Y+A
Sbjct:   18 IWPELEEGIYKIITDLNKGFPKQKWIALYTHVYDYC-------AASQSKSSAKV----GMPKQ----------QASGANYVGEDLYNRLNLFLKKHMSQLLKLTETKMDEPLLNYYYTEWDRYTSAMKYINNIFQYMNRYWIKREIDDGKKEVYEIFILSLVIWRDCLFTPLKQRLTNSLLDIIESERNGYQINTHLIKGVINGYVSLG-LNREKPKET----------------------------ILQVYKSGFEELFLTATENYYTNESAKFISENSVADYMKKVETRLNEEVKRVQQYLH----QNTESELIAKCEKVLIEKHVEVIWNEFQTLLEKDKIPDLTRMYSLLSRIPRGLEPLRTTLEKHVQNVGLQAVSSIATNGVIEPKVYIETLLKVFKKYNELVTGAFRSDTGFVASLDKACRRFINENAVTIAAKSSSKSPELLARFTDFLLKKSPNNPEESEMEQLLNDVMIVFKYIEDKDVFQDFYSKMLAKRLIHGTSTSEDLEGTMIGKLKSTCGYEYTSKLQRMFTDMSLSRELLDRFNNHIEQVERSSLNIDFSVLVLATGSWPLQPPSTNFSIPKELQACEQLFQKFYQNQHSGRKLNWLHHLSKGELKTKYLQTSKSGYTLQCSTYQIGVLLQFNQYETLTSEEIQESTQLIDSVLKGTLTSLAKSKILLA-------------DPPLDDEE---IAKTTKFSLNKQFKNKKTKIFINVPVLTQVKEEIDSIHKTVEEDRKLQIQAAIVRIMKMRKQLAHSGLMTEVISQLQTRFNPKVNIIKKCIDILIEKEYLMRVEGKKDHYSYVA 770          
BLAST of Cullin-1 vs. TrEMBL
Match: A0A4S2LTL0 (CULLIN_2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004939 PE=3 SV=1)

HSP 1 Score: 729.939 bits (1883), Expect = 0.000e+0
Identity = 396/889 (44.54%), Postives = 557/889 (62.65%), Query Frame = 1
Query:   40 NLLAIWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQN--GAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVG----------RVGGSTPK---ITGTLGQSQHSDNSTLIGQA-----------------------------------------DHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFL-------ISPQNKSGNIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVL-VVNGDKMAMDTVSKID-----TNLENEEIPDI--GPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            NL  +W+DL+ GI  IF ++ + +  YM LY+ VYNYCTFVD                        HR   S  ++Q+  G K++G ELY+KL++YL+ HV  LK+KGD    EEML + + +WT++ F+  VL+G C YL+RNWVKR+ +EG K  ++IY  AL+ W E+LL+PH  ++  ++++E+++ER  E L    L+ II+CLVE+G            GGS P    + G +G +  S  S+  G A                                             ++  +  L VY   FE  F+ +TER+YR+ES+ FL  N + +YL+KVE R+ EE  R+ +++H +    TL +L       LL +H+DR+ +EF  LL  +R  D+ RM+ L+   P    ++ S  E+ V +KG EA+   +   L +PK+YI+TIL +++KNY  V  AF  +  F +ALDKGCERFIN+NAVTE+A + RK+PE LAKY D LLKKS +D   DDL+E L + MTVFKYIEDKDVFQ FYSK LARRL+ + SISED EA+MIS+LKE+CG+EYTAKLQRMF D + +R+LNAKF         SP      +D N+M+LSSN+WPY AQ  F++P EL  C+ +F+ F+   HTGRKLSWC++L RGEVVT+YTK  Y FQVSTYQ++IL+L+N  L +SV  +   T +E   ++QILQI L+ KVL VVN ++ +  +  + D     T+   ++ P++     T + LYTDY+NKR+RV LN+ LK ETKQE E+ +  VD DR++ + ACIVR+MKTRK +KHQ+L+ EV+ QLST+F P ++LIKRCIA LI++EYLKRD+N +D+Y+YLA
Sbjct:    7 NLALVWDDLKSGIDDIFKLKTLKKARYMRLYTHVYNYCTFVD------------------------HRPQASGRTDQSTGGGKVVGLELYRKLRDYLRAHVHSLKLKGDNLNGEEMLSYFEKTWTDFRFAATVLDGTCSYLSRNWVKREQDEGRKHVYEIYELALITWREHLLKPHARVLISSILREIDRERRGEVLLTLRLRKIIECLVELGIKSDTHPHPSPSGGSQPSTEHLPGLMGATSRSPLSSATGPAHSQEWPSSTSSLNPRENVPCRTPLHGAGPATAPLSSADSTSQASATLSSDVRLYVYQDYFERNFLAETERYYRLESIQFLQSNPVPEYLQKVEIRLNEERARVQAYLHVS----TLPKLIRSCEHYLLREHIDRLTSEFVNLLNEDREEDIWRMYKLVGHFPNGMRALVSMVEDHVEEKGCEALRQVAKSALTDPKLYIDTILQIHRKNYNLVLSAFACDPAFTRALDKGCERFINRNAVTELAGSPRKSPELLAKYSDFLLKKSPKDMQIDDLEEALGQVMTVFKYIEDKDVFQKFYSKTLARRLVYNQSISEDAEASMISKLKEACGFEYTAKLQRMFQDVNATRELNAKFANFVQTRETSPGGLLKGVDFNIMILSSNAWPYQAQTPFSIPPELEQCHTTFLSFYQEHHTGRKLSWCYHLSRGEVVTNYTKIRYTFQVSTYQMSILMLYNSSLVHSVNSLQSQTSIELPTLLQILQILLKAKVLRVVNENEASRLSTPRPDPTSSSTSGNADDTPEVQLSGETHLALYTDYKNKRVRVYLNVPLKSETKQETEQTLGNVDLDRKLFVQACIVRIMKTRKIMKHQQLINEVISQLSTRFKPAISLIKRCIADLIDREYLKRDTNERDSYEYLA 867          
BLAST of Cullin-1 vs. TrEMBL
Match: A0A504YQM7 (Cullin-1 OS=Fasciola gigantica OX=46835 GN=FGIG_09784 PE=3 SV=1)

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 401/889 (45.11%), Postives = 555/889 (62.43%), Query Frame = 1
Query:   43 LLAIWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEV------------------------GRVGGS----TPKITGTLGQSQHSDNSTLI----------GQADHDV-------------------SMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGNI-------DLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVV--------NGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            L +IW+DL+ GI  I+ +E++ +  YM LY+ VYNYCTFV   N +  +S SA+ +S NG                 G KL+G ELY+KL++YLK+HV  LK+KGD  + EEML + + SW ++  +  VLNG C YLNR+WVKR+ +EG K  +DIY  AL+ W E+LL+PH  ++ +A+++EVEKER  E L    L+ II+CLVE+                        G +  S    TP        SQ+ D +T +          G+   D+                   S +   +LSVY   FE  F+ +TER+YR ES  FL  N + +YLKKVE R+ EE  R+ +++H +    TL +L       L+ +H++R+ +EF  LL  +R  D+ RM+ L+        ++ S  E+ V +KG+EA+   +   L  PK+YI+TIL ++ K Y  +  AF  +  F +ALDKGCERFIN+NAVTE+A + RK+PE LAKY D LLKKS +D  + D DE   + MTVFKYIEDKDVFQ FYSK LARRL+N+ S SED EA+MIS+LKE+CG+EYTAKLQRMF D +++R+LNAKFL   QN+  ++       D N+MVLSSN+WP+ AQ  F++P EL  C+ +F+ F+   HTGRKL+WC++L RGEVVT+YTK  Y FQVSTYQ+++L+L+N  LSY++  I   T +E   ++QILQI L+ KVL V        N D M   T +  D + E    P + P T++ LYTDY++KR+RV+LN+ LK E KQE E+ +  V+ DRR+ + ACIVR+MKTRK +KHQ+LV EV+ Q S +F P + LIKRCIA LIE+EY+KRDSN +D Y+YLA
Sbjct:    8 LASIWDDLKSGIDDIYKLESMKKSRYMQLYTHVYNYCTFV--PNRAPTSSKSAAEQS-NG-----------------GGKLVGHELYQKLRDYLKSHVSSLKLKGDNLSGEEMLSYFEKSWKDFRSASVVLNGACAYLNRHWVKRECDEGRKNVYDIYALALIKWREHLLKPHARVLINAILREVEKERRGEVLLTSRLRQIIECLVELGITSEQHSHSSPSGTAQSQNEHLPGLMNASSVQRTPLGISANSVSQNPDWATTVPTPDTRESASGRTPMDIQGSTNVPLSSDRNPQNSTLSQETRLNLSVYQDYFERSFLFETERYYRFESAQFLQSNPVPEYLKKVEMRLNEERNRVQAYLHIS----TLPKLIRSCEHYLIGEHINRVTSEFVNLLNDDREEDIWRMYKLVGHFVSGMRALVSTMEDHVEEKGSEALREVAQAALTNPKLYIDTILRIHSKYYHLILSAFACDPAFSRALDKGCERFINRNAVTELAGSPRKSPELLAKYADFLLKKSPKDMPSYDPDEASGQVMTVFKYIEDKDVFQKFYSKTLARRLVNNQSSSEDAEASMISKLKEACGFEYTAKLQRMFQDVNSTRELNAKFLNYLQNQESSVAGIPKGLDFNMMVLSSNAWPFQAQAPFSVPPELEQCHNAFLSFYQEHHTGRKLNWCYHLSRGEVVTNYTKSRYTFQVSTYQMSVLMLYNSSLSYTLGAIQSQTAIEMPTLLQILQILLKAKVLKVLTESDVSQNTDVMNDGTANSTDDSTE----PQLTPETILTLYTDYKHKRVRVHLNVPLKSEAKQETEQTMGNVESDRRLIVQACIVRIMKTRKVMKHQQLVNEVIAQSSARFKPNIPLIKRCIAALIEREYIKRDSNDRDAYEYLA 868          
BLAST of Cullin-1 vs. TrEMBL
Match: A0A4E0R2I6 (Cullin-1 OS=Fasciola hepatica OX=6192 GN=D915_008718 PE=3 SV=1)

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 398/889 (44.77%), Postives = 554/889 (62.32%), Query Frame = 1
Query:   43 LLAIWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEV-------------GRVGGSTPKITGTLGQS---------------QHSDNSTLI----------GQADHDV-------------------SMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGNI-------DLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVV--------NGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            L +IW+DL+ GI  I+ +E++ +  YM LY+ VYNYCTFV   N +  +S SA+ +S NG                 G KL+G ELY+KL++YLK+HV  LK+KGD  + EEML + + SW ++  +  VLNG C YLNR+WVKR+ +EG K  +DIY  AL+ W E+LL+PH  ++ +A+++EVEKER  E L    L+ II+CLVE+             G        + G +  S               Q+ D +T +          G+   D+                   S +   +LSVY   FE  F+ +TER+YR ES  FL  N + +YLKKVE R+ EE  R+ +++H +    TL +L       L+ +H++R+ +EF  LL  +R  D+ RM+ L+        ++ S  E+ V +KG+EA+   +   L  PK+YI+TIL ++ K Y  +  AF  +  F +ALDKGCERFIN+NAVTE+A + RK+PE LAKY D LLKKS +D  + D DE   + MTVFKYIEDKDVFQ FYSK LARRL+N+ S SED EA+MIS+LKE+CG+EYTAKLQRMF D +++R+LNAKFL   QN+  ++       D N+MVLSSN+WP+ AQ  F++P EL  C+ +F+ F+   HTGRKL+WC++L RGEVVT+YTK  Y FQVSTYQ+++L+L+N  LSY++  I   T +E   ++QILQI L+ KVL V        N D M   T +  + + E    P + P T++ LYTDY++KR+RV+LN+ LK E KQE E+ +  V+ DRR+ + ACIVR+MKTRK +KHQ+LV EV+ Q S +F P + LIKRCIA LIE+EY+KRDSN +D Y+YLA
Sbjct:    8 LASIWDDLKSGIDDIYKLESMKKSRYMQLYTHVYNYCTFV--PNRAPTSSKSAAEQS-NG-----------------GGKLVGHELYQKLRDYLKSHVSSLKLKGDNLSGEEMLSYFEKSWKDFRSASVVLNGACAYLNRHWVKRECDEGRKNVYDIYALALIKWREHLLKPHARVLINAILREVEKERRGEVLLTSRLRQIIECLVELGITSEQHSHSSPSGTAQSQNEHLPGLMSASSVQRTPLGISANPVSQNPDWATTVPTPDTRESASGRTPMDIQGSTNVPLSSDRNPQNSTLSQETRLNLSVYQDYFERSFLFETERYYRFESAQFLQSNPVPEYLKKVEMRLNEERNRVQAYLHIS----TLPKLIRSCEHYLIGEHINRVTSEFVNLLNDDREEDIWRMYKLVGHFVSGMRALVSTMEDHVEEKGSEALREVAQAALTNPKLYIDTILRIHSKYYHLILSAFACDPAFSRALDKGCERFINRNAVTELAGSPRKSPELLAKYADFLLKKSPKDMPSYDPDEASGQVMTVFKYIEDKDVFQKFYSKTLARRLVNNQSSSEDAEASMISKLKEACGFEYTAKLQRMFQDVNSTRELNAKFLNYLQNQESSVAGIPKGLDFNMMVLSSNAWPFQAQAPFSVPPELEQCHNAFLSFYQEHHTGRKLNWCYHLSRGEVVTNYTKSRYTFQVSTYQMSVLMLYNSSLSYTLGTIQSQTAIEMPTLLQILQILLKAKVLKVLTESDVSQNTDVMNDGTANSTEDSTE----PQLTPETILTLYTDYKHKRVRVHLNVPLKSEAKQETEQTMGNVESDRRLIVQACIVRIMKTRKVMKHQQLVNEVIAQSSARFKPNIPLIKRCIAALIEREYIKRDSNDRDAYEYLA 868          
BLAST of Cullin-1 vs. TrEMBL
Match: A0A3Q0KPR6 (Putative cullin OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 399/892 (44.73%), Postives = 559/892 (62.67%), Query Frame = 1
Query:   22 IEMSSENLLAIWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVG-------------------------------------RVGGST--------------------PKITGTLGQSQHSDNSTL-IGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKF---LISPQNKSGN----IDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVL-VVNGDKMAMD--TVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            +  S+ NL  +W+DL+ G  AIF +E I R+ YM L++ VYNYCT VDPK+ +  + S+  T                    + G KL+G+ELYKKL+ YLK HV  LK+KG+   DEE L + + +WTE+ F+ +VL+GVC YLNR+WVKR+ EEG K  + +YT AL+ W E+LL+PH  ++  A+++E+E+ER  E L+   L+ II+CLVE+G                                     +  GST                    P   G L     +D ST     A   ++     +LSVY + FE PF+ +TER+YR+ES  FL  N + +YL+KVE R+ EE  R+ +++H +    TL +L       L+ +H+DR+ + F+ L   +R  D+ RM+ L+   P     + S  E+ V  KG EAI   +   L +PK+YI+TIL V++K+Y  V  AF  +  F +ALDKGCERFIN+NAVTE+A   RK+PE LAKY D LLKKS++D   DDL+E L + M VF+YIEDKDVFQ FYSK LARRL+ + S+SED EA+MIS+LKE+CG+EYTAKLQRMF D + +R+LNAKF   L   +  +G+     D N+M+LSSN+WP+ AQ  F++P EL  C+ +F+ F+   HTGRKL+WC++L RGEVVT+YTK  YIFQVSTYQ+++L+L+N  L Y+V  I   T +E   ++QILQI L+ KVL +V+  K  +D  TV   D+N  +     + P+T + LYTDY+NKR+RV LN+ LK ETKQE+E+ +  V+ DR++ + ACIVR+MKTRK +KH +L+ EV+ QL+ +F P V LIKRCI  LIE+EY+KRD+N +D Y+YLA
Sbjct:    1 MSASTGNLALVWDDLKSGFDAIFRLETIKRKRYMELHTHVYNYCTSVDPKSHATPSRSAIET--------------------EPGGKLVGFELYKKLRNYLKAHVHSLKLKGNNLVDEETLSYFEKAWTEFRFASRVLDGVCNYLNRHWVKRECEEGRKNVYVVYTLALITWREHLLKPHARVLISAILREIERERRGEILSTLRLRKIIECLVELGITSDQQSFSTSTLTGTTTSPSEPLPYLMKPFKSNFPPKPSGSTVKPNKSEVESSFQGTSNKTVPNFRGPLHPGDPADESTPNTPSATSSLTSDTRTNLSVYQEYFERPFLTETERYYRLESAQFLQSNTVPEYLQKVETRLNEERIRVQTYLHIS----TLPKLIRSCEHYLIGEHIDRLTSVFSDLFNEDREEDIWRMYRLVGHFPSGIRVLVSVMEDHVADKGWEAIRQVAEAALNDPKLYIDTILKVHQKHYNLVLSAFAWDPAFSRALDKGCERFINRNAVTELAGNQRKSPELLAKYADFLLKKSAKDIQLDDLEETLGQVMNVFRYIEDKDVFQKFYSKTLARRLVYNQSVSEDAEASMISKLKEACGFEYTAKLQRMFQDVNATRELNAKFSDYLQKQEEANGSTIKGTDFNIMILSSNAWPFQAQGPFSIPPELEQCHNTFLAFYQEHHTGRKLTWCYHLSRGEVVTNYTKTRYIFQVSTYQMSVLMLYNSSLVYTVSAIQLQTGIEEATLLQILQILLKAKVLKIVSDPKCELDQSTVISDDSNESH-----LSPDTHLALYTDYKNKRVRVYLNVPLKSETKQEIEQTLGNVESDRKLIVQACIVRIMKTRKVMKHHQLISEVVTQLTPRFKPTVLLIKRCITALIEREYIKRDNNERDAYEYLA 863          
BLAST of Cullin-1 vs. TrEMBL
Match: G4VHP4 (Putative cullin OS=Schistosoma mansoni OX=6183 GN=Smp_150270 PE=3 SV=1)

HSP 1 Score: 707.597 bits (1825), Expect = 0.000e+0
Identity = 395/889 (44.43%), Postives = 552/889 (62.09%), Query Frame = 1
Query:   22 IEMSSENLLAIWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVG-------------------------------------RVGGST--------------------PKITGTLGQSQHSDNSTL-IGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKF---LISPQNKSGN----IDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            +  S+ NL  +W+DL+ G  AIF +E I R+ YM L++ VYNYCT VDPK+ +  + S+  T                    + G KL+G+ELYKKL+ YLK HV  LK+KG+   DEE L + + +WTE+ F+ +VL+GVC YLNR+WVKR+ EEG K  + +YT AL+ W E+LL+PH  ++  A+++E+E+ER  E L+   L+ II+CLVE+G                                     +  GST                    P   G L     +D ST     A   ++     +LSVY + FE PF+ +TER+YR+ES  FL  N + +YL+KVE R+ EE  R+ +++H +    TL +L       L+ +H+DR+ + F+ L   +R  D+ RM+ L+   P     + S  E+ V  KG EAI   +   L +PK+YI+TIL V++K+Y  V  AF  +  F +ALDKGCERFIN+NAVTE+A   RK+PE LAKY D LLKKS++D   DDL+E L + M VF+YIEDKDVFQ FYSK LARRL+   S+SED EA+MIS+LKE+CG+EYTAKLQRMF D + +R+LNAKF   L   +  +G+     D N+M+LSSN+WP+ AQ  F++P EL  C+ +F+ F+   HTGRKL+WC++L RGEVVT+YTK  YIFQVSTYQ+++L+L+N  L Y+V  I   T +E   ++QILQI L+ KVL +  D          D+N  +     + P+T + LYTDY+NKR+RV LN+ LK ETKQE+E+ +  V+ DR++ + ACIVR+MKTRK +KH +L+ EV+ QL+ +F P V LIKRCI  LIE+EY+KRD+N +D Y+YLA
Sbjct:    1 MSASTGNLALVWDDLKSGFDAIFRLETIKRKRYMELHTHVYNYCTSVDPKSHATPSRSAIET--------------------EPGGKLVGFELYKKLRNYLKAHVHSLKLKGNNLVDEETLSYFEKAWTEFRFASRVLDGVCNYLNRHWVKRECEEGRKNVYVVYTLALITWREHLLKPHARVLISAILREIERERRGEILSTLRLRKIIECLVELGITSDQQSFSTSTLTGTTTSPSEPLPYLMKPFKSNFPPKPSGSTVKPNKSEVESSFQGTSNKTVPNFRGPLHPGDPADESTPNTPSATSSLTSDTRTNLSVYQEYFERPFLTETERYYRLESAQFLQSNTVPEYLQKVETRLNEERIRVQTYLHIS----TLPKLIRSCEHYLIGEHIDRLTSVFSDLFNEDREEDIWRMYRLVGHFPSGIRVLVSVMEDHVADKGWEAIRQVAEAALNDPKLYIDTILKVHQKHYNLVLSAFAWDPAFSRALDKGCERFINRNAVTELAGNQRKSPELLAKYADFLLKKSAKDIQLDDLEETLGQVMNVFRYIEDKDVFQKFYSKTLARRLVYKSSVSEDAEASMISKLKEACGFEYTAKLQRMFQDVNATRELNAKFSDYLQKQEEANGSTIKGTDFNIMILSSNAWPFQAQGPFSIPPELEQCHNTFLAFYQEHHTGRKLTWCYHLSRGEVVTNYTKTRYIFQVSTYQMSVLMLYNSSLVYTVSAIQLQTGIEEATLLQILQILLKAKVLKIVSD-------PNDDSNESH-----LSPDTHLALYTDYKNKRVRVYLNVPLKSETKQEIEQTLGNVESDRKLIVQACIVRIMKTRKVMKHHQLISEVVTQLTPRFKPTVLLIKRCITALIEREYIKRDNNERDAYEYLA 853          
BLAST of Cullin-1 vs. Ensembl Cavefish
Match: cul1b (cullin 1 [Source:NCBI gene;Acc:103026940])

HSP 1 Score: 643.654 bits (1659), Expect = 0.000e+0
Identity = 345/815 (42.33%), Postives = 507/815 (62.21%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT V   N          TR     P    +  + +P+   GA+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W E L RP    +++A++K +E+ER  E +N R +  ++   VE+G                            + D +      LSVY + FET F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  ++ +G  AI       L +PK+Y++TILDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W ++L +GE+VT+  K  Y  Q ST+Q+AILL FN   SY+V+++ +++Q++ +I++Q+LQI L+ K+LV+  +   +D +             D  P+T++ L+  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   15 IWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN---------QTRGAGVPPA---KPSKKSPT-PGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRECLFRPLNKQVTNAVLKLIERERNGETINTRLISGVVQSYVELG---------------------------LNEDDAFAKGPTLSVYKEYFETQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRITDGLGELKKLLETHIHNQGLAAIEKCGDSALNDPKMYVQTILDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLSNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYHLSKGELVTNCFKNRYTLQASTFQMAILLQFNTENSYTVQQLADSSQIKIDILVQVLQILLKSKLLVLEDENANIDEM-------------DFKPDTLIKLFLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 772          
BLAST of Cullin-1 vs. Ensembl Cavefish
Match: cul1a (cullin-1 [Source:NCBI gene;Acc:111194478])

HSP 1 Score: 642.884 bits (1657), Expect = 0.000e+0
Identity = 346/815 (42.45%), Postives = 501/815 (61.47%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT V   N               G P +        P    GA+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W E L RP    +++A++K +EKER  E +N R +  ++   VE+G                            + D +      LSVY + FET F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  +Y +G  AI       L +PK+Y++TILDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+M ++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W ++L +GE+VT+  K  Y  Q ST+Q+AILL +N    Y+V+++ ++TQ++ +I++Q+LQI L+ K+LV+  +   +D V             D  P+T++ LY  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   20 IWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQP----------RGPGVPPSKPSKKAPTPG---GAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRECLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELG---------------------------LNEDDAFAKGPTLSVYKEYFETQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRITDGLGELKKLLETHIYNQGLAAIEKCGEAALNDPKIYVQTILDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMVQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYHLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDVYTVQQLTDSTQIKIDILVQVLQILLKSKLLVLEDENANVDEV-------------DFKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKMLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 777          
BLAST of Cullin-1 vs. Ensembl Cavefish
Match: cul1b (cullin 1 [Source:NCBI gene;Acc:103026940])

HSP 1 Score: 602.053 bits (1551), Expect = 0.000e+0
Identity = 318/757 (42.01%), Postives = 468/757 (61.82%), Query Frame = 1
Query:  244 SHESNPSNQNGAKLIG----WXXXXXXXXXXXNHVIKLKIKGDGK--TDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            S+    SN +G K IG    W+             ++  I+ DG+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W E L RP    +++A++K +E+ER  E +N R +  ++   VE+G                            + D +      LSVY + FET F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  ++ +G  AI       L +PK+Y++TILDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   YQ F  F+ + H+GRKL+W ++L +GE+VT+  K  Y  Q ST+Q+AILL FN   SY+V+++ +++Q++ +I++Q+LQI L+ K+LV+  +   +D +             D  P+T++ L+  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:    2 SNRQTMSNPHGLKQIGLDQIWDD------------LRAGIQQDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRECLFRPLNKQVTNAVLKLIERERNGETINTRLISGVVQSYVELG---------------------------LNEDDAFAKGPTLSVYKEYFETQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRITDGLGELKKLLETHIHNQGLAAIEKCGDSALNDPKMYVQTILDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLSNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYHLSKGELVTNCFKNRYTLQASTFQMAILLQFNTENSYTVQQLADSSQIKIDILVQVLQILLKSKLLVLEDENANIDEM-------------DFKPDTLIKLFLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 702          
BLAST of Cullin-1 vs. Ensembl Cavefish
Match: cul1b (cullin 1 [Source:NCBI gene;Acc:103026940])

HSP 1 Score: 581.252 bits (1497), Expect = 0.000e+0
Identity = 326/815 (40.00%), Postives = 479/815 (58.77%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT V   N          TR     P    +  + +P+   GA+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W E L RP    +++A++K +E+ER  E +N R +  ++   VE+G                            + D +      LSVY + FET F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  ++ +G  AI       L +PK+Y++TILDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT+MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP E                                             ST+Q+AILL FN   SY+V+++ +++Q++ +I++Q+LQI L+ K+LV+  +   +D +             D  P+T++ L+  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   15 IWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN---------QTRGAGVPPA---KPSKKSPT-PGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRECLFRPLNKQVTNAVLKLIERERNGETINTRLISGVVQSYVELG---------------------------LNEDDAFAKGPTLSVYKEYFETQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH----ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRITDGLGELKKLLETHIHNQGLAAIEKCGDSALNDPKMYVQTILDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLSNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSE--------------------------------------------ASTFQMAILLQFNTENSYTVQQLADSSQIKIDILVQVLQILLKSKLLVLEDENANIDEM-------------DFKPDTLIKLFLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA 728          
BLAST of Cullin-1 vs. Ensembl Cavefish
Match: cul2 (cullin 2 [Source:NCBI gene;Acc:103040496])

HSP 1 Score: 391.349 bits (1004), Expect = 8.941e-123
Identity = 239/740 (32.30%), Postives = 389/740 (52.57%), Query Frame = 1
Query:  328 NHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKR-QLEEGHKQF-----------HDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKF--LISPQN--KSGNIDLNVMVLSSNSWPYT--AQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            NHV +L  K   +++E++L      W EYS     ++ +  YLN  ++K+ +L E   Q+            +I   AL  W + ++ P Q  +   L+KE++ +R  E  N + +  +I+  V V +                                 K  F L  Y +IFE PF+ KT  +Y+ E+ + L ++  + Y++KV  R+ +EE R   ++H +   K + E      + ++ADHL  +  E   ++  E+  D+  M+TLL  +      M    +  ++ +G  A S+ S +N+P    ++E++L+V+ K    +    +G+  F+ ALDK     +N        K+  K PE LAKYCD LLKKS++    +++++ L+ F+TVFKYI+DKDVFQ FY++MLA+RLI+ LS+S D E AMI++LK++CGYE+T+KL RM++D S S DLN KF   I  Q       I   + VL + +WP T      F +PQEL    Q F  F+N   +GRKL+W   L  GEV  +Y  K Y+  V+TYQ+A+LL FN   +   KE+ ++TQ+    + + ++  L  K++  +  K  ++  S    N+                   + +KR +  +   ++ +T QE+E+  S VD DR+M + A IVR+MK RK L+H  L++EV+ Q   +FNP +++IK+CI  LI+K+Y++R     D Y Y+A
Sbjct:   67 NHVRQL-YKKVLESEEKVLLMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMIEPLQATLIRMLLKEIKNDRCGEDPNQKVIHGVINSFVHVEQY--------------------------------KKKFPLKFYQEIFEGPFLTKTGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEVRCRKYLHPSSYAKVIHECQ----QRMVADHLQFLHGECQNIVRQEKRDDMANMYTLLRAVSNGLPHMIQELQVHIHDEGLRATSNLSQENMPTQ--FVESVLEVHSKFVQLINTVLNGDQHFMSALDKALTSVVNYRE----PKSICKAPELLAKYCDNLLKKSAKGMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSLSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKTQEIVVDLGISFQIYVLQAGAWPLTQVPSSTFAIPQELEKSVQMFELFYNQHFSGRKLTWLHYLCTGEVKMNYLSKPYVAMVTTYQMAVLLAFNNSETVGYKELQDSTQMSEKELQKTIKSLLDVKMINHDSQKEEIEAESTFSLNM------------------SFTSKRTKFKITTSMQRDTPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKILRHNALIQEVINQSKARFNPSISMIKKCIEVLIDKQYIERSQTSADEYSYVA 745          
BLAST of Cullin-1 vs. Ensembl Sea Lamprey
Match: cul1b (cullin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2887])

HSP 1 Score: 649.818 bits (1675), Expect = 0.000e+0
Identity = 346/816 (42.40%), Postives = 514/816 (62.99%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQ-HSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            IW+DL+ GIQ ++  +++ +  YM LY+ VYNYCT V   N           ++ +G   N  ++ +  PS   GA+ +G ELYK+LK++LK +++ L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W E L +P    +++A++K +EKER  E +N R +  ++   VE+G            L +   H+   TL                SVY + FE+ F+  TERFY  ES DFL++N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+   +EF  LL  ++  DL RM++L+ +I +    + S  E  ++ +G  AI       L +PK+Y++TILDV+KK  A V  AF+ +  F+ +LDK C RFIN NAVT+MA+TS K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL+N  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   +Q F  F+++ H+GRKLSW + L +GE+VT+  K  Y  Q ST+Q+A+LL +N   +Y+V+++ E TQ++ +I++Q+LQI L+ K+LV+  +   +D V             D+ P T++ L+  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   18 IWDDLKAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQAN-----------QARSGAMANTSKNKKGQPSG--GAQFVGLELYKRLKDFLKMYLLNLLKDGEDLMDEGVLKFYTQQWEDYRFSSKVLNGICSYLNRHWVRRECDEGRKGIYEIYSLALVTWRECLFKPLNKQVTNAVLKLIEKERTGETINTRLISGVVGSYVELG------------LNEDDLHAKGPTL----------------SVYKEAFESQFLLDTERFYTRESTDFLSQNPVTEYMKKAETRLLEEQRRVQVYLH----ESTHDELARKCEQVLIEKHLENFYSEFQNLLDDDKNEDLARMYSLVSRILDGLGELKSLLETHIHNQGLSAIEKCGEGALNDPKIYVQTILDVHKKYNALVMSAFNNDAGFVASLDKACGRFINTNAVTKMAQTSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQRFYAKMLAKRLVNHNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKNHLANSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSHQRFTTFYSSQHSGRKLSWLYQLSKGELVTNCFKNRYTLQASTFQMAVLLQYNSEDAYTVQQLHENTQIKMDILVQVLQILLKSKLLVLEDENTNVDEV-------------DLQPETLIRLFLGYKNKKLRVNINVPMKAEQKQEQETTHKNIEEDRKLVIQAAIVRIMKMRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDMLIEKEYLERVDGEKDTYSYLA 775          
BLAST of Cullin-1 vs. Ensembl Sea Lamprey
Match: cul1b (cullin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2887])

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 338/820 (41.22%), Postives = 496/820 (60.49%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESN-PSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKF-IQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLE---SNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            IW+DL+ GIQ ++  +++ +  YM LY+ VYNYCT V                            H++N PS   GA+ +G ELYK+LK++LK +++ L  K         L       W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W E L +P    +++A++K +EKER  E +N R                     I+G +G                         LSVY + FE+ F+  TERFY  ES DFL++N +T+Y+KK E R+ EE++R+  ++H      T +EL     + L+  HL+   +EF  LL  ++  DL RM++L+ +I +    + S  E  ++ +G  AI       L +PK+Y++TILDV+KK  A V  AF+ +  F+ +LDK C RFIN NAVT+MA+TS K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL+N  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL   +Q F  F+++ H+GRKLSW + L +GE+VT+  K  Y  Q ST+Q+A+LL +N   +Y+V+++ E TQ++    +I++Q+LQI L+ K+LV+  +   +D V             D+ P T++ L+  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:    6 IWDDLKAGIQQVYTRQSMAKSRYMELYTHVYNYCTSV----------------------------HQANQPSG--GAQFVGLELYKRLKDFLKMYLLNLLKKVPAALFRPRLSHKCTVQWEDYRFSSKVLNGICSYLNRHWVRRECDEGRKGIYEIYSLALVTWRECLFKPLNKQVTNAVLKLIEKERTGETINTRL--------------------ISGVVGSYA---------------------TLSVYKEAFESQFLLDTERFYTRESTDFLSQNPVTEYMKKAETRLLEEQRRVQVYLH----ESTHDELARKCEQVLIEKHLENFYSEFQNLLDDDKNEDLARMYSLVSRILDGLGELKSLLETHIHNQGLSAIEKCGEGALNDPKIYVQTILDVHKKYNALVMSAFNNDAGFVASLDKACGRFINTNAVTKMAQTSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQRFYAKMLAKRLVNHNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKNHLANSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSHQRFTTFYSSQHSGRKLSWLYQLSKGELVTNCFKNRYTLQASTFQMAVLLQYNSEDAYTVQQLHENTQIKMKTKDILVQVLQILLKSKLLVLEDENTNVDEV-------------DLQPETLIRLFLGYKNKKLRVNINVPMKAEQKQEQETTHKNIEEDRKLVIQAAIVRIMKMRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDMLIEKEYLERVDGEKDTYSYLA 737          
BLAST of Cullin-1 vs. Ensembl Sea Lamprey
Match: cul2 (cullin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-8032])

HSP 1 Score: 390.193 bits (1001), Expect = 4.547e-123
Identity = 231/728 (31.73%), Postives = 393/728 (53.98%), Query Frame = 1
Query:  364 KTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQ------LEEGH-----KQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGNIDLNV----MVLSSNSWPYT--AQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGET-KQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            +++E +L      W EYS     ++ +  YLN  ++K+       ++ G+     +Q  +I   AL  W   ++ P +  +   L+KE++ +R  E  N + +  +I+  V V +                                 K  F L  Y  +FE+ F+ +T  +++ E+   L     + Y+++V  R+ +EE R   ++H +  +K + E      + ++ADHL  + +E   ++  E   D+  M+TLL  +P+A   M +  +  + Q+G +AIS+ S +N+P    ++E++L+V+ K    +T    G+ +F+ ALDK C   +N        K+  K+PE LAKYCD +LKK+++    +++D+ LS  + VFKYI+DKDVFQ FY++MLA+RLI+ LS+S D E +MI++LK++CGYE+T+KL RM++D S S DLN KF    + +   IDL V     VL + +WP +      F +PQEL  C + F  F+N +  GRKL+W   L  GE+  +Y  K Y+  V+TYQ+ +LL FN     + +E+  +TQL    +++ ++  +  K++  +G +                   +I P  +  L  ++ +KR +  +   ++ +T +QEVE+  S VD DR+M + A IVR+MK+RK LKH  L++EV+ Q   +F P V++IK+CI  LI+K+Y++R+ N  D Y Y+A
Sbjct:   77 ESEERILIMYHGYWEEYSKGSDYMDCLYRYLNTQFIKKSKLSEADIQYGYGMDSSEQLMEIGELALDIWRRLMIEPLEGSLVRVLLKEIKNDRSGENPNQKVIHGVINSFVHVEQY--------------------------------KKKFPLKFYQDVFESAFLVETGEYFKQEASRLLQTCNCSQYMQQVLGRLKDEEVRCRKYLHPSSYSKVISECQ----QRMVADHLQFLHSECQTIVRQELRDDMANMYTLLRTVPQALQHMVTEQQEHIRQEGLKAISNLSHENMPTQ--FVESVLEVHSKYVQLITSVLSGDQQFMSALDKACSAVVNYRE----PKSLCKSPELLAKYCDGMLKKTAKGMTENEVDDKLSNSIVVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEESMINKLKQACGYEFTSKLHRMYTDMSLSADLNNKFGNFIKEQETPIDLGVGFQIYVLQAGAWPLSQLPSTPFVIPQELEKCVRMFEIFYNDSFNGRKLTWLHYLCTGEMKMNYLPKPYVATVTTYQMGVLLAFNGAEQVTYRELEYSTQLNERELVKTIRSLIDVKLVNSSGKE------------------DEITPECIFSLNMEFSSKRTKFKITSAMQKDTPQQEVEQTRSAVDEDRKMYLKAAIVRIMKSRKVLKHNALIQEVISQSRARFIPSVSMIKKCIEDLIDKQYIERNQNSTDEYNYVA 744          
BLAST of Cullin-1 vs. Ensembl Sea Lamprey
Match: cul4b (cullin 4B [Source:ZFIN;Acc:ZDB-GENE-041008-208])

HSP 1 Score: 204.142 bits (518), Expect = 3.538e-56
Identity = 123/409 (30.07%), Postives = 209/409 (51.10%), Query Frame = 1
Query:  796 VYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTP-LLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKF--LISPQNKSGNIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEAT 2013
            +Y   FE  F+ +T R Y  E    + + E+ +YL  V  R+ EE  RI +++       T + L + + K LL +HL  I+ +    LL   RI +L  ++ L  ++      +  H+ +++   G   + +   D     K  ++ +LD  +K    V   F    +F+ A+ +  E FINK           K  E +AKY D  L+  +++   ++L+ +L + M +F++I  KDVF+ FY K LA+RL+   S S D E +M+S+LK  CG  +T+KL+ MF D   S+D+  +F   +  QN + NI+L V +L+   WP     +  LP E++   + F  F+   H+GRKL W  +LG   + + + +     QVS +Q  +LL+FN+   +S+++I  AT
Sbjct:  223 IYQDCFEQRFLVETNRLYAAEGQRLMQEREVPEYLHHVNKRLEEESDRIITYLD----QSTQKSLIATVEKQLLGEHLTAILQKGAANLLDENRIPELSLLYQLFSRVKGGIQVLLQHWADYIKVFGTTIVVNPEKD-----KTMVQELLDFKEKVDVIVEVCFQRSDKFINAMKEAFETFINKRL--------NKPAELIAKYVDSKLRAGNKEATDEELERLLDKIMIIFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGGAFTSKLEGMFKDMELSKDIMIQFKQYMQNQNDANNIELTVNILTMGYWPTYTPMEVHLPPEMVKLQEVFKTFYLGKHSGRKLQWQPSLGHCVLKSEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEDIRTAT 614          
BLAST of Cullin-1 vs. Ensembl Sea Lamprey
Match: cul5a (cullin 5a [Source:ZFIN;Acc:ZDB-GENE-030131-5426])

HSP 1 Score: 99.3673 bits (246), Expect = 3.931e-22
Identity = 67/282 (23.76%), Postives = 134/282 (47.52%), Query Frame = 1
Query:  670 GRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFD--LSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSR------------KTPEFLAKYCDMLLKKS--SRDTNTDDLDEIL 1467
            GR+  S  K+  +    +  D+  +IG  +  V++  N +  L +Y + FE  ++  T+ FYR ++  +L +N + +++K  + ++ EEEQR   ++       +++ L       L+    + I+ E + ++ A     L+ MF L+ ++P     M    E  +   G   + + +     + + Y+E +L ++ +    V +AF  + RFL A DK  +  +N   + ++   S+            K PE LA YCDMLL+K+  S+   ++++D  L
Sbjct:  156 GRLQDSAMKLVHSERLGEAFDSQLVIGVRESYVNLCSNAEDRLQIYRENFEKAYLDATDTFYRTQAPAYLQQNGVQNFMKYADAKLKEEEQRALRYLETRKDCNSVQALVDCCVNALVTSFKETILAECSGMIKANETEKLQLMFQLMDRVPAGIEPMLKDLEEHIVSAGLADMVATAESITTDSEKYVEQLLMLFHRFSRLVKDAFRDDPRFLTARDKAYKAVVNDATIFKLELPSKQKGLSSKTQPESKCPELLANYCDMLLRKTPLSKKLTSEEIDAKL 437          
BLAST of Cullin-1 vs. Ensembl Yeast
Match: CDC53 (Cullin; structural protein of SCF complexes (which also contain Skp1p, Cdc34p, Hrt1p and an F-box protein) involved in ubiquitination; SCF promotes the G1-S transition by targeting G1 cyclins and the Cln-CDK inhibitor Sic1p for degradation; human homolog CUL1 can complement yeast cdc53 null mutant [Source:SGD;Acc:S000002290])

HSP 1 Score: 324.324 bits (830), Expect = 7.780e-98
Identity = 251/873 (28.75%), Postives = 420/873 (48.11%), Query Frame = 1
Query:   34 SENLLAIWEDLEVGIQAIFNMEN------------IGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISS----------KSTDNLPE-----------PKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSR----KTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQN-----KSGNIDLNVMVLSSNSWPYTAQE-KFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKK---TYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRV-------NLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            S++L A W  +E GI  I   E             +    YM +Y+ +YNYC      N S ++S   ST S  G                    L+G E+Y+KLK YLKN+++  K        E  L+F    W  ++     LN    Y+NR WV+++  +G +   D+ T  L+ W E +  P + ++ + L+ +V   R  + +    +   I  LV +G                            D     K+N  L+VY+++FE PF+KKT+ +Y   + D+L K+ +T+Y+ +  + +  EE+ +  +      + T + L+  L K L+ DH++++ NEF  LL A  I  +  ++ L+ +       M S FEN+V + G   ISS          K+ +  P+           PK YI+ +L+V+        E+F  +I   KALD  C  FIN N     A + +    KT E LAKY D+LLKK+++     D+ +     +T+FKY+ DKD F+  Y ++ A+RLI+  S S + E  +I RL+ +   EYT K+ +MF D   S+ L   F ++ +N     K+   DL   VL+ N WP++ QE +F LP+EL+P ++   + ++  H GR L W + L RGE+     K     + F V+ +Q+AILLL+N     +++ I E T L    +   +  F++ K  ++      +D + K +T  +    P     T ++  +  +N  ++        N   +L  +   E E +   ++ +R++ ++ACIVR+MK ++ L H  LV E + Q   +FN +V+++KR I  LI+K YL+R  +  ++Y YLA
Sbjct:    8 SDDLEATWNFIEPGINQILGNEKNQASTSKRVYKILSPTMYMEVYTAIYNYCV-----NKS-RSSGHFSTDSRTG----------------QSTILVGSEIYEKLKNYLKNYILNFK----QSNSETFLQFYVKRWKRFTIGAIFLNHAFDYMNRYWVQKERSDGKRHIFDVNTLCLMTWKEVMFDPSKDVLINELLDQVTLGREGQIIQRSNISTAIKSLVALG---------------------------IDPQDLKKLN--LNVYIQVFEKPFLKKTQEYYTQYTNDYLEKHSVTEYIFEAHEIIKREEKAMTIYWD----DHTKKPLSMALNKVLITDHIEKLENEFVVLLDARDIEKITSLYALIRRDFTLIPRMASVFENYVKKTGENEISSLLAMHKHNIMKNENANPKKLALMTAHSLSPKDYIKKLLEVHDIFSKIFNESFPDDIPLAKALDNACGAFININEFALPAGSPKSATSKTSEMLAKYSDILLKKATKPEVASDMSD--EDIITIFKYLTDKDAFETHYRRLFAKRLIHGTSTSAEDEENIIQRLQAANSMEYTGKITKMFQDIRLSKILEDDFAVALKNEPDYSKAKYPDLQPFVLAENMWPFSYQEVEFKLPKELVPSHEKLKESYSQKHNGRILKWLWPLCRGELKADIGKPGRMPFNFTVTLFQMAILLLYNDADVLTLENIQEGTSLTIQHIAAAMVPFIKFK--LIQQVPPGLDALVKPETQFKLSR-PYKALKTNINFASGVKNDILQSLSGGGHDNHGNKLGNKRLTEDERIEKELNTERQIFLEACIVRIMKAKRNLPHTTLVNECIAQSHQRFNAKVSMVKRAIDSLIQKGYLQRGDDG-ESYAYLA 815          
BLAST of Cullin-1 vs. Ensembl Yeast
Match: CUL3 (Ubiquitin-protein ligase; forms a complex with Elc1p that polyubiquitylates monoubiquitylated RNA polymerase II to trigger its proteolysis; cullin family member with similarity to Cdc53p and human CUL3 [Source:SGD;Acc:S000003235])

HSP 1 Score: 118.242 bits (295), Expect = 1.166e-27
Identity = 106/429 (24.71%), Postives = 191/429 (44.52%), Query Frame = 1
Query: 1264 ATVTEAFHGEIRFLKALDKGCERFIN-----KNAV------TEMAKTSRKTPEFLAKYCDMLLKKS-SRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGNIDLNVMVLSSNSWPYTA----QEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNL---NLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            + + E +  +  FL+++D G  R  N      NA+         +K      E+L+ Y D  +K++  +D     + + L     +   + +KD+F+  Y K L+RRL+   S+ E IE  M+  +K+  G  +T+KL+ M  D S S ++   F  S  N    +     VL+  SWP+ +     E  +LP  +      F  +++  +  R L W  +L   E+   +    Y    S Y   I LLF      ++ EI E T +  + V          K LV     M+M T+ +    L+          +V + ++   N++++V +    L  +          +   D++  M + A IVR+MKT   L HQ+L+    ++  ++ +   +++KR I  LIEKEY++R+++    Y YL+
Sbjct:  334 SEIVELYRSQHSFLESIDFGSVRLNNLTGDVSNAILGDVFSMYFSKEGALPSEYLSTYVDHCMKRTKEKDAEIVKIKQDLLDSTKLIGLLTEKDIFEKIYKKQLSRRLLQQRSLVE-IEKWMVQMIKKVLGTFFTSKLEIMLRDISLSSEMYQAFQHSTINSIEYLSFAPQVLTRTSWPFQSTNPIDEGISLPPRMSQILAGFEGYYSLKYKERVLKWAHHLSVIEIGCQFNSGYYEISFSVYAGVIFLLFEDYEELTLGEIYELTHIPIDDV----------KSLV-----MSMSTIPRCKI-LKKSSSSGNMKFSVNYFFSS-PNRKVKVPVIACPLPSQKSDNLATASSVDTYDNEIVMELSAIIVRIMKTEGKLSHQQLLERTTKRTQSRLSLTPSILKRSIQLLIEKEYIQRNADDPSYYHYLS 744          
BLAST of Cullin-1 vs. Ensembl Nematostella
Match: EDO37570 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFF7])

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 340/822 (41.36%), Postives = 504/822 (61.31%), Query Frame = 1
Query:   40 NLLAIWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAIS--SKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGNIDLN--VMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            NL  IW+DL+ GIQ ++N +++ ++ YM LY+ VYNYCT       SV   S +        P            NQ GA+ +G ELYK+LKE+LK++++ ++  G    DE +L+F  S W +Y FS KVLNGVC YLNR+WV+R+ +EG K  ++IY  AL+ W E+L RP    +++A+++ +E+ER  E +N R +  +I C VE+G            L + + S      G A           L+VY + FE+ F++ TERFY  ES++FL +N +T+Y+KK E R+ EE++R+N ++H      T +EL     + L+  HLD    EF  LL  ++  DL RM++L  +IP+  + + +  EN +  +G  A+    +   N+  P  Y+  I+ V K        +F  +  F+ ALDK   +FIN NAVT+ A+ S K+PE LA+YCD LLKKSS++    +L++IL+  M VFKYIEDKDVFQ FY+ MLA+RL+   S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN KF     N +G++DL+  + VLSS SWP+     F+LP E+   +Q F  F+++ H+GRKL W ++  +GE+VT+  K  Y  Q STYQ+ +LL+FN   SY+V++I E TQL+  ++IQ+L I L+ K+L+        DT          E++  + P++V+ L+  Y+NK++RVN+N+ +K E + E E+    ++ DR++ I A IVR+MK RK LKHQ L+ EVL QLS++F P+V  IK+CI  LIEKEYL+R    KDTY YLA
Sbjct:   15 NLDEIWDDLKEGIQHVYNQQSMSKQRYMELYTHVYNYCT-------SVHQQSQSRVPKQKKAP------------NQGGAQFVGHELYKRLKEFLKSYLLNMQKDGADLMDESVLRFYSSRWEDYRFSSKVLNGVCAYLNRHWVRRECDEGRKGIYEIYQLALVTWREHLFRPLNKQVTNAVLRLIERERNGETINTRLVSGVIQCYVELG------------LNEEEQSSK----GPA-----------LTVYKQYFESVFLEDTERFYTAESVEFLRENPVTEYMKKAEARLLEEQRRVNVYLH----ESTQDELARKCEQVLIEKHLDIFYAEFQNLLNDDKNEDLGRMYSLGSRIPDGLVQLRTLLENHICYQGLNALEKCGEQAYNVSTPASYVIIIIFVSKMCNYYFIMSFKNDAGFVAALDKAFGKFINSNAVTKQAQASSKSPELLARYCDSLLKKSSKNPEEAELEDILNSVMVVFKYIEDKDVFQKFYANMLAKRLVQHNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNDKFKAHLAN-TGSLDLDFTIQVLSSGSWPFQQSWTFSLPAEMEKSHQRFTTFYSSQHSGRKLHWLYHKSKGELVTNCFKNRYTLQASTYQMGVLLMFNTADSYTVEQIQEQTQLKMELLIQVLGILLKTKLLLC-------DTC---------EDVSGLEPSSVLKLFFGYKNKKLRVNINVPMKTEQRNEQEQTHKYIEEDRKLLIQAAIVRIMKMRKMLKHQPLLAEVLSQLSSRFKPRVPTIKKCIDILIEKEYLERVEGEKDTYAYLA 769          
BLAST of Cullin-1 vs. Ensembl Nematostella
Match: EDO49091 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI48])

HSP 1 Score: 341.658 bits (875), Expect = 1.349e-104
Identity = 232/730 (31.78%), Postives = 367/730 (50.27%), Query Frame = 1
Query:  370 DEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFH----------DIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAK---FLISPQNKSGNIDLNVMVLSSNSWPY--TAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISR----VDHDRRMAIDACIVR---VMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            D ++L+   S W +YS     ++ +  YLN +  K++ +      +          DI   AL  W   ++ P +  +   L+ E+ K+R  E                            GT     H    + +G  ++    +    LS+Y   FE P +++T  +YR E+ D LA+N  + Y++KV+ R+ +E+ R   F+H    ++ + E  +     ++ +H+  +  E   ++  E+ +DL RM+ LL  IP     M +  E  V + G    + K       P  Y++ +LDV+ K    + E FH +  F  +LDK C   +N       A+   K+PE LAKYCD++LKKS+++ +  +LDE L   + VFKYI+DKD+FQ FYSKMLA+RLI++LSIS D E AMISRLK +CGYEYT +L  MF+D S S DLN+    FL + Q   G I+ +++VL S +WP   T+   F++PQELI   Q F  F+N    GRKL+W  +L  GEV  +Y K+TY   VST+Q+A++LLFN  L ++  E+   TQL +  + +I+Q                    S +D  L N+   D        L  ++ +KR ++ +   ++ ++ Q V  + +R     D+      +  +VR   + +T  TL       +V+ Q   +F P V +IK+CI  LI+K+YL R    KD Y Y+A
Sbjct:   80 DIDILREYHSHWAKYSQGSSYMDLLFRYLNSHLKKQKQDYVEISPYTVTPICPDAIDIGPLALSIWKSIMIEPLKETLVQHLLAEIRKDRNGE----------------------------GTQQNVVHDTIKSFVGVQEY----QSKGALSLYESEFEKPLLQETGEYYRREAADLLAENPCSVYIQKVDVRIQDEDLRARKFLHPVSYSRVIRECEA----RMVEEHIPYLQAECRQMVRGEKCADLSRMYKLLKHIPRGLHVMVTELEQHVEETGQNHDTQKFI-CFQGPFQYVDAMLDVHSKFTKLIDETFHADQAFHASLDKACTTIVN---YRHDARKPSKSPELLAKYCDLILKKSNKNLSDSELDEKLGEVIIVFKYIDDKDIFQKFYSKMLAKRLIHNLSISMDAEEAMISRLKHACGYEYTNRLHWMFTDMSISSDLNSSFSDFLATAQVNMG-INFSLLVLQSGAWPLGQTSVSPFSIPQELIRPVQMFEQFYNGKFNGRKLAWLQHLSNGEVKLNYCKRTYFLTVSTFQMAVMLLFNDKLQFTFSELSTLTQLLNKELTRIIQ--------------------SLVDVKLLNKTEDDDSKEATYSLNMNFSSKRTKLKITSAVQRDSPQVVILLSTRGTADSDNWHLHLAEKPMVRSYHLQQTNDTLF--SFCLQVISQSRARFIPSVPMIKKCIEALIDKQYLDRQEGSKDEYSYVA 746          
BLAST of Cullin-1 vs. Ensembl Nematostella
Match: EDO35660 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKY8])

HSP 1 Score: 277.715 bits (709), Expect = 1.325e-82
Identity = 179/577 (31.02%), Postives = 302/577 (52.34%), Query Frame = 1
Query:  772 MKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINE-FTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKS--GNIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            ++M  D+ +Y   FE+ F++ T+  Y  E   ++ + ++  YL  V+ R+ EE  R+   IH+  ++ T + L   + K LL  HL  I+ + F  L+ + RI+DL  M+ L  ++ +    + + F  F+ ++G   + +   D     K  ++ +LD  ++    + EAF    +F+ A+ +  E FINK           K  E +AK+ D  L+  +++   ++L+ +L R M +F++I  KDV++ FY K LA+RL+   S S D E +M+S+LK+ CG  +T+KL+ MF D   S+D+  +F    Q++S   N+D+ V +L+   WP        LP E++   ++F  F+   H+GRKL W   LG   V   +++     QVS +Q  +LL+FN+   YS+++I +AT +E   + + LQ    GK  V+                 +  +  DI    +     ++++K IR+ +N     ET +E      RV  DR+  IDA IVR+MKTRKTL H  LV E+  QL  KF  + T +K+ I  LIE++Y++RD    + Y Y+A
Sbjct:   36 LRMLADIQMYEDAFESKFLEATDVLYSQEGNRYMQETDVPKYLAHVDKRLKEEMDRL---IHYLDQS-TRKPLILCVEKQLLGQHLTSILQKGFDNLMLSNRIADLALMYQLFGRVRKGMEELCAAFSGFIKKQGISIVLNPEKD-----KTMVQELLDFKEQLDTMIAEAFMKSEKFVNAMKESFESFINKRP--------NKPAELIAKFVDSKLRAGNKEATEEELERLLDRIMVIFRFIHGKDVYEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKQECGAAFTSKLEGMFKDMELSKDVMVQFRQYLQHQSLPWNMDMVVSILTMGYWPTYLPMDVHLPTEMVHYQETFKKFYLAKHSGRKLQWQNTLGHCVVKADFSEVKKELQVSLFQTLVLLMFNEGNEYSLEDIKQATGVEDGELRRTLQSLACGKARVIK----------------KRPQSKDIEDGDIFTFNKEFKHKLIRIKINQVQMKETPEENVNTTERVFQDRQYQIDAAIVRIMKTRKTLSHTLLVSELYTQL--KFPVKPTDLKKRIESLIERDYMERDKEIANQYHYVA 577          
BLAST of Cullin-1 vs. Ensembl Nematostella
Match: EDO35230 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM65])

HSP 1 Score: 264.618 bits (675), Expect = 1.127e-76
Identity = 194/734 (26.43%), Postives = 358/734 (48.77%), Query Frame = 1
Query:  346 KIKGD--GKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPH--QTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGN---IDLNVMVLSSNSWP-YTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYT----------KKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            KI+ D     +   L  + ++W ++  S+ ++  + MY++R +V++          ++Y   L+ + + ++R    +  +   L+  V KER  E ++   ++     LV +G               S+H                       VY + FE PF++++  FY++E   FLA+N  + Y++KVE R+ EE +R   ++  +     ++ +   L +  +   +D   +    +L  ++I DL RM+ L Y++ E   ++      ++ ++G   +  + ++    P   I+ +L++  +    +   F  +  F +A+    E F+N N          K+PEFL+ + D  LKK  +  +  +++ +L + M +F+++++KDVF+ +Y + LA+RL+   S+S+D E  MIS+LK  CG ++T+KL+ MF D + S   N +F     N   N   +DL V VL++  WP  +   K  +P +    +  F  F+   H+GR+L+    LG  E+   +           ++ +IFQ+S+YQ+ IL+LFN    ++ ++I++ T +    + + LQ    GK            T   +    + ++I      +V  L+T  +  R+++   L  KGE++ E +E  ++VD DR+  I+A IVR+MK RK   H  LV EV EQL  +F P   +IK+ I GLIE+EYL R    +  Y Y+A
Sbjct:   25 KIRKDVVASLNNNFLDTLNAAWNDHQTSMVMIRDILMYMDRVYVQQN------GVDNVYNLGLILFRDKVVRYGNIRDHLCQTLLSLVRKERRGEVVDRMAIRNACQMLVILG-------------IDSRH-----------------------VYEEDFERPFLEESAEFYKMEGQKFLAENSASIYIQKVETRINEESERAKHYLDPSTEESVVKVVEEELIRKHMKTIVDMENSGVIHMLKHDKIEDLARMYRLFYRVKEGLKTVCDCMRGYLREQGKAVVVDEESETARNPISCIQNLLELKDRFDHFLHNGFSSDRLFKQAIGSEFEYFLNLNG---------KSPEFLSLFIDDKLKKGVKGYSEQEVEVVLDKCMVLFRFLQEKDVFERYYKQHLAKRLLLQKSVSDDSEKNMISKLKTECGCQFTSKLEGMFKDMTVSHTTNEEFRQHLSNSQINLLGVDLIVRVLTTGFWPTQSGNHKCNVPPQAQHAFDCFKRFYLGNHSGRQLTLQPQLGTAELNATFPPVKKEGASLGQRKHIFQMSSYQMCILMLFNSQERWTYEDILQQTLIPERDLNRALQSLACGKA-----------TQRVLSKEPKGKDITATDVFSVNDLFTS-KLHRVKIQTVLA-KGESEPERKETRTKVDEDRKHEIEAAIVRIMKARKKRPHNLLVAEVTEQLKARFLPSPQVIKKRIEGLIEREYLARTPEDRKVYLYVA 694          
BLAST of Cullin-1 vs. Ensembl Nematostella
Match: EDO38761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC24])

HSP 1 Score: 211.46 bits (537), Expect = 2.318e-57
Identity = 176/642 (27.41%), Postives = 305/642 (47.51%), Query Frame = 1
Query:  673 RVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFD--LSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKG-NEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERF---INKNAVTEMAKTSR---------------KTPEFLAKYCDMLLKKS--SRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKE-SCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGNID-LNVMVLSSNSWPYTAQE-KFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFN-KCLSY-SVKEIVEATQLESNIVIQILQIF-----LRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNL--NLQLKGE-TKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYL 2490
            R+  S  K+       +  D+  +IG  +  V++  +    L +Y + FE  +I  TE FY+ ++  +L +N + +Y++  E ++ EEEQR   ++       ++  L       L+    + I+ E   ++AA     L  MF L+ ++      M    E+++   G N+ +++  T      K Y+E +L ++ +  A V EAF+ + RFL A DK  + F   +N   + ++   S+               + PE LA YCDMLL+K+  S+   +D+++  L   + V KY+ +KDVF  ++   L RRLI D S   ++E  M+  L++     +Y  KL RMF D   S DLN +F  + ++K    D +N+ +L++ +W   ++    +LP EL  C     +F+   H+GRKL W   +  G +        +  +V+T+Q+++L  +N + L + S + +  AT+L  + + + L        L+ ++L       +    +       N++   I    V         KR +VNL   LQL  +  KQE  E I  +   R + I   IV++MK RK + +  L  E++E L   F PQ  +IK     LIE +YLKRD    +T+ YL
Sbjct:  155 RLQSSAMKLVHAERNGEAFDSQLVIGVRESYVNLSSDASDKLMIYRENFEKAYIDATEEFYKAQASSYLQENGVQNYMRYAEMKLKEEEQRALRYLETRKGCNSVAVLTECCVNVLVGSFKETILAEGPGMIAANETKKLLLMFQLMDRVKGGVDPMIQSLESYIVTTGLNDMLAAAETITTDSEK-YVEQLLALFNRFSAMVKEAFNDDPRFLTARDKAPQAFKTVVNDTKIFKLELPSKGKGSGALSVKPQPESRCPELLANYCDMLLRKTTYSKKLTSDEIESKLKDVLLVLKYVVNKDVFMRYHKAHLTRRLILDTSADSEMEENMVEWLRDVGMPADYINKLARMFQDIKVSEDLNQEFKRTCRDKGDIADSINIKILNAGAWSRASERIPVSLPTELEDCIPEVEEFYRKNHSGRKLQWHHLMSNGVITFSNKTGKFDLEVTTFQMSVLFAWNERPLDHISYENLRLATELPDSELRKTLWSMVSIPKLKRQILTCEPAVRSPKDFTDSSMFWVNQDFALIKNGKV--------QKRGKVNLIGRLQLSTDKAKQEENEGIVAL---RILRIQEAIVKIMKMRKRITNAALQTELVEILKNMFIPQKKMIKEQTEWLIEHKYLKRDEEDINTFIYL 784          
BLAST of Cullin-1 vs. Ensembl Medaka
Match: cul1a (cullin 1 [Source:NCBI gene;Acc:101155471])

HSP 1 Score: 627.476 bits (1617), Expect = 0.000e+0
Identity = 338/808 (41.83%), Postives = 498/808 (61.63%), Query Frame = 1
Query:   52 IWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSN-QNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSG-NIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNC 2469
            IW+DL  GIQ ++  +++ +  YM LY+ VYNYCT       SV  +     R      G+ H +  S  S    GA+ +G ELYK+LKE+LKN++  L   G+   DE +LKF    W +Y FS KVLNG+C YLNR+WV+R+ +EG K  ++IY+ AL+ W E L RP    +++A++K +E+ER  E +N R +  ++   VE+G                            + + +      LSVY + FE  F+  TERFY  ES +FL +N +T+Y+KK E R+ EE++R+  ++H + ++    EL     + L+  HL+    EF  LL A++  DL RM+ L+ +I +    +    E  ++ +G  AI       L +PKVY++T LDV+KK  A V  AF+ +  F+ ALDK C RFIN NAVT MA++S K+PE LA+YCD LLKKSS++    +L++ L++ M VFKYIEDKDVFQ FY+KMLA+RL++  S S+D EA+MIS+LK++CG+EYT+KLQRMF D   S+DLN +F     N    ++D ++ VLSS SWP+     F LP EL+  YQ F  F+ + H+GRKL+W ++L +GE+VT+  K  Y  Q ST+Q+AILL +N   SY+V+++ ++TQ++++I+IQ+LQI L+ K+LV+  +   +D V             D  P+TV+ L+  Y+NK++RVN+N+ +K E KQE E     ++ DR++ I A IVR+MK RK LKHQ+L+ EVL QLS++F P+V +IK+CI  LIEKE      NC
Sbjct:   21 IWDDLRAGIQKVYTRQSMPKSRYMELYTHVYNYCT-------SVHQTGQGPGR------GSGHPAKPSKKSTTPGGAQFVGLELYKRLKEFLKNYLTSLLKDGEDLMDECVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRECLFRPLNKQVTNAVLKLIERERNGETINTRLISGVVQSYVELG---------------------------LNEEDAFTKGPTLSVYKEYFECQFLTDTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESSQD----ELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRITDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKVYVQTTLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTRMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPTELVRSYQRFTSFYGSRHSGRKLTWLYHLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDSYTVQQLTDSTQIKTDILIQVLQILLKSKLLVLEDENANVDEV-------------DFKPDTVIKLFLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEPTNPTKNC 771          
BLAST of Cullin-1 vs. Ensembl Medaka
Match: cul2 (cullin 2 [Source:NCBI gene;Acc:101155234])

HSP 1 Score: 393.66 bits (1010), Expect = 8.891e-124
Identity = 237/740 (32.03%), Postives = 392/740 (52.97%), Query Frame = 1
Query:  328 NHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKR-QLEEGHKQF-----------HDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKF--LISPQNKSGN--IDLNVMVLSSNSWPYT--AQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            NHV +L  K   +++E++L      W EYS     ++ +  YLN  ++K+ +L E   Q+            +I   AL  W + ++ P Q ++   L+ E++ +R  E  N + +  +I+  V V +                                 K  F L  Y +IFE PF+ KT  +Y+ E+ + + ++  + Y++KV  R+ +EE R   ++H +   K + E      + ++ADHL  +  E   ++  E+  D+  M+TLL  +      M    +  ++ +G    S+ S +N+P   +++E++L+V+ K    +    +G+  F+ ALDK     +N        K+  K PE LAKYCD LLKKS++    +++++ L+ F+TVFKYI+DKD+FQ FY++MLA+RLI+ LS+S D E AMI++LK++CGYE+T+KL RM++D S S DLN KF   I  Q    +  I   + VL + +WP T      F +PQEL    Q F  F+N   +GRKL+W   L  GEV  +Y  K Y+  V+TYQ+A+LL FN   + + KE+ + TQ+    + + ++  L  K+L  + +K  ++T S    N+                   + +KR +  +   ++ +T QE+E+  S VD DR+M + A IVR+MK RK L+H  L++EV+ Q   +FNP +++IK+CI  LI+K+Y++R     D Y Y+A
Sbjct:   67 NHVRQL-YKKVLESEEKVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMIEPLQAVLIRMLLNEIKNDRCGENPNQKVIHGVINSFVHVEQY--------------------------------KKKFPLKFYQEIFEGPFLMKTGEYYKQEASNLMQESNCSQYMEKVLARLKDEEVRCRKYLHPSSYAKVIHECQ----QRMVADHLQFLHGECQNIIRQEKREDMANMYTLLRAVSSGLPHMIQELQVHIHNEGIRGTSNLSQENMP--TLFVESVLEVHSKFVQLINTVLNGDQHFMSALDKALTSVVNFRE----PKSICKAPELLAKYCDNLLKKSAKGMTENEVEDKLTSFITVFKYIDDKDIFQKFYARMLAKRLIHGLSLSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKTQETVVDLGISFQIYVLQAGAWPLTHVPSSTFAIPQELEKSVQMFELFYNQHFSGRKLTWLHYLCTGEVKMNYLSKPYVAMVTTYQMAVLLAFNNSQTVTYKELQDGTQMNEKELQKTVKSLLDVKMLNHDSEKEDIETESTFSLNM------------------SFTSKRTKFKITTSMQKDTPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVINQSKARFNPSISMIKKCIEVLIDKQYIERSQTSADEYSYVA 745          
BLAST of Cullin-1 vs. Ensembl Medaka
Match: cul2 (cullin 2 [Source:NCBI gene;Acc:101155234])

HSP 1 Score: 355.525 bits (911), Expect = 1.745e-109
Identity = 223/744 (29.97%), Postives = 380/744 (51.08%), Query Frame = 1
Query:  328 NHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKR-QLEEGHKQF-----------HDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGNIDLNV-----MVLSSNSWPYTAQEKFTL-----PQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            NHV +L  K   +++E++L      W EYS     ++ +  YLN  ++K+ +L E   Q+            +I   AL  W + ++ P Q ++   L+ E++ +R  E  N + +  +I+  V V +                                 K  F L  Y +IFE PF+ KT  +Y+ E+ + + ++  + Y++KV  R+ +EE R   ++H +   K + E      + ++ADHL  +  E   ++  E+  D+  M+TLL  +      M    +  ++ +G    S+ S +N+P   +++E++L+V+ K    +    +G+  F+ ALDK                        LAKYCD LLKKS++    +++++ L+ F+TVFKYI+DKD+FQ FY++MLA+RLI+ LS+S D E AMI++LK++CGYE+T+KL RM++D S S DLN KF    + +   +DL +     ++     W      +  L     P     C++    F+N   +GRKL+W   L  GEV  +Y  K Y+  V+TYQ+A+LL FN   + + KE+ + TQ+    + + ++  L  K+L  + +K  ++T S    N+                   + +KR +  +   ++ +T QE+E+  S VD DR+M + A IVR+MK RK L+H  L++EV+ Q   +FNP +++IK+CI  LI+K+Y++R     D Y Y+A
Sbjct:   67 NHVRQL-YKKVLESEEKVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMIEPLQAVLIRMLLNEIKNDRCGENPNQKVIHGVINSFVHVEQY--------------------------------KKKFPLKFYQEIFEGPFLMKTGEYYKQEASNLMQESNCSQYMEKVLARLKDEEVRCRKYLHPSSYAKVIHECQ----QRMVADHLQFLHGECQNIIRQEKREDMANMYTLLRAVSSGLPHMIQELQVHIHNEGIRGTSNLSQENMP--TLFVESVLEVHSKFVQLINTVLNGDQHFMSALDK------------------------LAKYCDNLLKKSAKGMTENEVEDKLTSFITVFKYIDDKDIFQKFYARMLAKRLIHGLSLSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKTQETVVDLGISFQIYVLQVRGGWSLAPHTRPLLDIRHPPGARKECFEL---FYNQHFSGRKLTWLHYLCTGEVKMNYLSKPYVAMVTTYQMAVLLAFNNSQTVTYKELQDGTQMNEKELQKTVKSLLDVKMLNHDSEKEDIETESTFSLNM------------------SFTSKRTKFKITTSMQKDTPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVINQSKARFNPSISMIKKCIEVLIDKQYIERSQTSADEYSYVA 726          
BLAST of Cullin-1 vs. Ensembl Medaka
Match: cul2 (cullin 2 [Source:NCBI gene;Acc:101155234])

HSP 1 Score: 332.028 bits (850), Expect = 7.159e-101
Identity = 217/740 (29.32%), Postives = 364/740 (49.19%), Query Frame = 1
Query:  328 NHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKR-QLEEGHKQF-----------HDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKF--LISPQNKSGN--IDLNVMVLSSNSWPYT--AQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            NHV +L  K   +++E++L      W EYS     ++ +  YLN  ++K+ +L E   Q+            +I   AL  W + ++ P Q ++   L+ E++ +R  E  N + +  +I+  V V +                                 K  F L  Y +IFE PF+ KT  +Y+ E+ + + ++  + Y++KV  R+ +EE R   ++H +   K + E      + ++ADHL  +  E   ++  E+  D+  M+TLL  +      M    +  ++ +G    S+ S +N+P   +++E++L+V+ K    +    +G+  F+ ALDK     +N        K+  K PE LAKYCD LLKKS++    +++++ L+ F+TVFKYI+DKD+FQ FY++MLA+RLI+ LS+S D E AMI++LK++CGYE+T+KL RM++D S S DLN KF   I  Q    +  I   + VL + +WP T      F +PQEL    Q F  F+N   +GRKL+W   L  GEV  +Y  K Y+  V+TYQ+A+LL FN   + + KE+ + TQ+    + + ++  L  K+L  + +K  ++T S    N+                   + +KR +  +   ++ +T Q                                       V+ Q   +FNP +++IK+CI  LI+K+Y++R     D Y Y+A
Sbjct:   67 NHVRQL-YKKVLESEEKVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMIEPLQAVLIRMLLNEIKNDRCGENPNQKVIHGVINSFVHVEQY--------------------------------KKKFPLKFYQEIFEGPFLMKTGEYYKQEASNLMQESNCSQYMEKVLARLKDEEVRCRKYLHPSSYAKVIHECQ----QRMVADHLQFLHGECQNIIRQEKREDMANMYTLLRAVSSGLPHMIQELQVHIHNEGIRGTSNLSQENMP--TLFVESVLEVHSKFVQLINTVLNGDQHFMSALDKALTSVVNFRE----PKSICKAPELLAKYCDNLLKKSAKGMTENEVEDKLTSFITVFKYIDDKDIFQKFYARMLAKRLIHGLSLSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKTQETVVDLGISFQIYVLQAGAWPLTHVPSSTFAIPQELEKSVQMFELFYNQHFSGRKLTWLHYLCTGEVKMNYLSKPYVAMVTTYQMAVLLAFNNSQTVTYKELQDGTQMNEKELQKTVKSLLDVKMLNHDSEKEDIETESTFSLNM------------------SFTSKRTKFKITTSMQKDTPQ---------------------------------------VINQSKARFNPSISMIKKCIEVLIDKQYIERSQTSADEYSYVA 706          
BLAST of Cullin-1 vs. Ensembl Medaka
Match: cul4a (cullin-4A [Source:NCBI gene;Acc:101154851])

HSP 1 Score: 272.322 bits (695), Expect = 7.536e-80
Identity = 180/578 (31.14%), Postives = 292/578 (50.52%), Query Frame = 1
Query:  772 MKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINE-FTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKS--GNIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLN-LQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            + M  DL VY   FE  F+ +T+R Y  E    + + ++ +YL  V  R+ EE  RI S++       T + L   + K LL +H+  I+ +  + LL   R+++L  ++ L  K+     ++   + +++   G E + +   D     K  ++ +LD   K        F     F+ A+ +  E FINK           K  E +AKY D  L+  +++   ++L+ IL + M +F++I  KDVF+ FY K LA+RL+   S S D E +M+S+LK  CG  +T+KL+ MF D   S+D+  +F    QN+S   NI+L V +L+   WP     +  LP E++   + F  F+   H+GRKL W   LG   +   + +     QVS +Q  +LL+FN+   +SV+EI  AT +E   + + LQ    GK  V+N                +N    D+      +  +D+++K  R+ +N +Q+K ET +E      RV  DR+  IDA +VR+MK RKTL H  LV E+  QL  KF  +   +K+ I  LI+++Y++RD    + Y Y+A
Sbjct:   71 LGMLSDLQVYKDSFEERFLAETDRLYAAEGQRLMQERDVPEYLHHVARRLEEENDRILSYLD----QSTQKPLICCVEKQLLGEHMTAILQKGLSNLLDENRVTELALLYQLFSKVKGGLPTLLQFWRDYIKSFGGEIVCTPEKD-----KDMVQDLLDFKDKMDNVAQSCFGRNEGFINAMKEAFETFINKRP--------NKPAELIAKYVDSKLRAGNKEATEEELERILDKIMIIFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMIQFKQHMQNQSEPSNIELTVNILTMGYWPSYTPMEVHLPAEMVKLQEVFKLFYLGKHSGRKLQWQPTLGHAVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSVEEIRAATGIEEGELKRTLQSLACGKARVLN----------------KNPRGKDVEDGDRFNFNSDFKHKLFRIKINQIQMK-ETVEEQVNTTERVFQDRQYQIDAAVVRIMKMRKTLSHNLLVSELYNQL--KFPVKPGDLKKRIESLIDRDYMERDKETPNQYHYVA 612          
BLAST of Cullin-1 vs. Planmine SMEST
Match: SMESG000008644.1 (SMESG000008644.1)

HSP 1 Score: 1683.31 bits (4358), Expect = 0.000e+0
Identity = 821/822 (99.88%), Postives = 821/822 (99.88%), Query Frame = 1
Query:   28 MSSENLLAIWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWXXXXXXXXXXXNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGNIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            MSSENLLAIWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWELYKKLKEYLKNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGNIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKM MDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA
Sbjct:    1 MSSENLLAIWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNVSVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWELYKKLKEYLKNHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGNIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMVMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 822          
BLAST of Cullin-1 vs. Planmine SMEST
Match: SMESG000001134.1 (SMESG000001134.1)

HSP 1 Score: 249.595 bits (636), Expect = 2.640e-70
Identity = 197/778 (25.32%), Postives = 365/778 (46.92%), Query Frame = 1
Query:  328 NHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKRQLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLNHRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINE----FTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSRKTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGN---IDLNVMVLSSNSWP-YTAQEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTK------------------------------------------------KTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            +H+IK++ +   +     L F+   W ++  ++ ++  + MY++R +V    +       ++Y   ++ + + +LR H+ I                    R L+  +  +V+  R G    ++       Q  D   ++ Q   D        L++Y + FE  F++++  FYR ES   L +N    Y+ +V   + +E +R   F++     K ++    VL + L+ +H++ ++N      T +L+ ++ S++  MF LL ++     +M+S    F+ ++G + +    T     P++YI+ ++ +  +    +  A      F   ++   E FIN+N+         ++PE+L+ Y D  LK+ ++  +  D+D I  + + +F+Y++DKD+F+ +Y + LA+RL+   S S+D E +MIS+L   CG  +T+KL+ MF D + S+ L  +F    Q  + N   IDL V VL++  WP  TA +   +P E    +  +  F+   H GR ++   NLG  E+  +Y +                                                + +I QVSTYQ+ IL+ FN+   YS +E+VE T++    + + L        + ++  K     + K   N   E I          +   + +K I++ +      ET+ EV+E  ++VD +R+  I+A IVR+MK RK+L H  LV EV+EQL ++F P   +IK+ I  L+E++YL R  + +  Y YLA
Sbjct:   86 DHMIKIRDEVLERLTNNFLAFLNRCWKDHITAMVMIRDILMYMDRVYVTTTDKP------NVYNTGMIIFRDTVLR-HEAI-------------------RRHLRVTLLDMVKRERHGEVISRL-------QLRDACQMLAQLGVD-------KLNIYEEDFENYFLEQSRDFYRSESERLLTENASNLYITQVNKIIEDEAKRARDFLNSTTEAKIVQ----VLNEELIKNHIESVVNTENFGLTHMLSNKKYSEIALMFNLLKRVDNGLATMSSCISRFLREEGRKIVEDDKT-----PQIYIQELIYLRDRANDLLLNALLNNQLFKNQINSDFEFFINQNS---------RSPEYLSLYIDDKLKRGTKGISDQDIDAIFDKCIILFRYLQDKDIFERYYKQHLAKRLLMSKSQSDDQEKSMISKLLIECGGVFTSKLEGMFKDMAISKTLMEEFHSQLQMYTTNTLGIDLFVRVLTTGLWPTQTATQTVCMPDEAQNAFSIYSRFYLGKHNGRVINLQPNLGNVELTAYYMQSQPSTFQSLTATDGVSEPNFNQGYQSSQIVGDVGASFNSFSGSTSQSIRKFILQVSTYQMIILMKFNRKSKYSYEELVEETKIPERDLTRCL--------ISLSLSKSTQRILLKEPKNKNTEFI----ATDTFSINESFTSKHIKIKIQSIAVKETEPEVKETKNKVDENRKYVIEATIVRIMKARKSLAHNLLVAEVIEQLKSRFVPTPQMIKQRIESLLERDYLARSDDDRKVYHYLA 793          
BLAST of Cullin-1 vs. Planmine SMEST
Match: SMESG000020142.1 (SMESG000020142.1)

HSP 1 Score: 213.001 bits (541), Expect = 1.103e-57
Identity = 170/619 (27.46%), Postives = 310/619 (50.08%), Query Frame = 1
Query:  730 DNSTLIGQADH--DVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEM-----------AKTSRKTPEFLAKYCDMLLKK--SSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKE-SCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGNID--LNVMVLSSNSWPYTA-QEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKK-TYIFQVSTYQIAILLLFNKCLSYSVKEI-VEATQLESNIVIQILQIFL-----RGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYR-NKRIRVNL----NLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            D+  +IG  +   ++S K    LS+Y + FE  +++ TE+FYR E+  +L  + + +Y+  V+ ++ EE  R + ++  +  +++++ L     + ++    + I+ EF  ++ A   S L  M+ LL ++P     M    E+ +   G   +   +   +  P+ Y+ ++LD++++    +  AF+ +  FL A DK  +  +N  ++ ++            K   + PE LA YCDMLL+K  ++R   T+ +++ L   + + KY+ +KDVF G Y   L RRL+ + S   ++E  M+ +L++     +   KL RMF D    +DLNA+F  + +N   N+   +N+ +L+  +W     +   TLP+EL        +F+   H GR ++W + +  G VVT  TK   +   V+T+Q+AIL  +N   S     + +E+ Q+ + + +  L+  L      GK+     DK  +    K  +  E  E  +   N    L    +   R R+NL     L L  +T+++ E  I  +   R+  +   I+++MK+R+ ++H EL  E+LE L   F P   LIK  I  LIE+EY+KRD+N   ++ Y+A
Sbjct:  169 DSQLVIGVRESYVNLSTKAESKLSIYQENFEKAYLEHTEQFYRREASQYLTDHGVCEYMAWVKQKLEEESNRAHKYLETSQESESVKNLEKKCVEIMIMSFTEIILAEFPSMIKANDTSKLSLMYDLLKRVPNGINPMLDLLEDHIKHSGLNDMMENADSIVSAPEKYVNSLLDMFERFTKLIELAFYTDPEFLTARDKAFQFIVNDTSIFKLDIATSNKPGSVKKPESRCPELLASYCDMLLRKGPTNRRLTTEQVEQRLQCVILLLKYVTNKDVFLGHYKPHLTRRLLLENSADNELEENMVEKLRDVGVPADMVNKLSRMFQDIKVCKDLNAEFKDALRNNRENVAEIVNIKILNGGAWMQQGLRVPLTLPRELEDYIPEVEEFYRKKHQGRMITWNYLMSHG-VVTFETKNGKFDLDVTTFQMAILFSWN---SRPFDRLSLESLQMATGLAMGDLKRNLWSLSEHGKL-----DKQLLVYEPKAKSAEEFTENTEFWINHDFSLIKQGKVQNRGRLNLIGRMPLTLDKKTQEQDESAIVEL---RKYRVQEGIIKIMKSRRQMRHIELCSELLELLRNLFQPSQRLIKEVIEWLIEEEYIKRDANDLSSFLYIA 775          
BLAST of Cullin-1 vs. Planmine SMEST
Match: SMESG000020142.1 (SMESG000020142.1)

HSP 1 Score: 213.001 bits (541), Expect = 1.295e-57
Identity = 170/619 (27.46%), Postives = 310/619 (50.08%), Query Frame = 1
Query:  730 DNSTLIGQADH--DVSMKMNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEM-----------AKTSRKTPEFLAKYCDMLLKK--SSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLINDLSISEDIEAAMISRLKE-SCGYEYTAKLQRMFSDKSTSRDLNAKFLISPQNKSGNID--LNVMVLSSNSWPYTA-QEKFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKK-TYIFQVSTYQIAILLLFNKCLSYSVKEI-VEATQLESNIVIQILQIFL-----RGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYR-NKRIRVNL----NLQLKGETKQEVEEVISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            D+  +IG  +   ++S K    LS+Y + FE  +++ TE+FYR E+  +L  + + +Y+  V+ ++ EE  R + ++  +  +++++ L     + ++    + I+ EF  ++ A   S L  M+ LL ++P     M    E+ +   G   +   +   +  P+ Y+ ++LD++++    +  AF+ +  FL A DK  +  +N  ++ ++            K   + PE LA YCDMLL+K  ++R   T+ +++ L   + + KY+ +KDVF G Y   L RRL+ + S   ++E  M+ +L++     +   KL RMF D    +DLNA+F  + +N   N+   +N+ +L+  +W     +   TLP+EL        +F+   H GR ++W + +  G VVT  TK   +   V+T+Q+AIL  +N   S     + +E+ Q+ + + +  L+  L      GK+     DK  +    K  +  E  E  +   N    L    +   R R+NL     L L  +T+++ E  I  +   R+  +   I+++MK+R+ ++H EL  E+LE L   F P   LIK  I  LIE+EY+KRD+N   ++ Y+A
Sbjct:  169 DSQLVIGVRESYVNLSTKAESKLSIYQENFEKAYLEHTEQFYRREASQYLTDHGVCEYMAWVKQKLEEESNRAHKYLETSQESESVKNLEKKCVEIMIMSFTEIILAEFPSMIKANDTSKLSLMYDLLKRVPNGINPMLDLLEDHIKHSGLNDMMENADSIVSAPEKYVNSLLDMFERFTKLIELAFYTDPEFLTARDKAFQFIVNDTSIFKLDIATSNKPGSVKKPESRCPELLASYCDMLLRKGPTNRRLTTEQVEQRLQCVILLLKYVTNKDVFLGHYKPHLTRRLLLENSADNELEENMVEKLRDVGVPADMVNKLSRMFQDIKVCKDLNAEFKDALRNNRENVAEIVNIKILNGGAWMQQGLRVPLTLPRELEDYIPEVEEFYRKKHQGRMITWNYLMSHG-VVTFETKNGKFDLDVTTFQMAILFSWN---SRPFDRLSLESLQMATGLAMGDLKRNLWSLSEHGKL-----DKQLLVYEPKAKSAEEFTENTEFWINHDFSLIKQGKVQNRGRLNLIGRMPLTLDKKTQEQDESAIVEL---RKYRVQEGIIKIMKSRRQMRHIELCSELLELLRNLFQPSQRLIKEVIEWLIEEEYIKRDANDLSSFLYIA 775          
BLAST of Cullin-1 vs. Planmine SMEST
Match: SMESG000006288.1 (SMESG000006288.1)

HSP 1 Score: 195.667 bits (496), Expect = 8.312e-52
Identity = 166/617 (26.90%), Postives = 284/617 (46.03%), Query Frame = 1
Query:  799 YVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAEEEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERISDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTD---NLPEP-KVYIETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINK-------------------------------NAVTEMAKTSRKTP---EFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFYSKMLARRLI-NDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRDLNAKF---------LISPQNKSGNIDLNVMVLSSNSWPYTAQE-KFTLPQELIPCYQSFIDFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKCLSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTNLENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEE---VISRVDHDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIAGLIEKEYLKRDSNCKDTYQYLA 2493
            Y  +FE   +  T+ FY++ + D  +    +DY+ +  +   +EEQR          +++L++++    + ++AD +  I +    ++  E  +DLR MF LL     +   + S   N +Y    EA+ S       N+    + ++  +     + Y    E F  + +F   +DK   + IN+                               N ++ +   + K P   E L +Y D LL+K ++  N  + ++ +  F+ +FKYIEDKD FQ +Y + L +RLI    ++  D E  +I+++K  CG EYT+  QRMF+D      LN  F         ++ P N         MVL++ SWP  +   +FT+  +L+ C+  F +F+   + GR+L         E+   YT K Y   + T Q  ILL      +Y V    E T LES          L+G + + N  ++    +S I+  L       I  + +  +  ++ +KR +  L L  K +    + E   V  +++ DR+  I A IVR+MK+RK L H  L++EVL+Q   +F P + +IK+CI  LI+K Y++R+ +  D Y YLA
Sbjct:  209 YENLFENDLLIATKSFYQLWAADKSSNLSCSDYVIQALELRKKEEQRCR-----LCYSESLKKISDYFRQIIVADQIIFINSNVKNIVDNELKTDLRNMFALL-----SPYDLCSEMRNRMYDHTVEAVRSTIGGVYINIANAHQQFVSELTKTRDRFYNFNREIFEEDTQFRNVIDKAFNKAINEKHQMSPVKAMYSNTSKDGLSIMNDSIEQIDSNVISSIPNLNLKLPKPAELLNRYADNLLRKQAKSMNDQEFEKAVMNFIILFKYIEDKDAFQKYYQRSLCKRLIYGGQNLMMDNEENVINQIKSVCGLEYTSPFQRMFNDIQLISQLNKTFSDYLNDNTDIVMPCNSQ------FMVLTNCSWPINSNSLEFTINCDLLKCFSIFYNFYLHKYQGRELKLTNQFSTVELQLCYTSKPYFLTIGTLQATILL------NYDVINSDEIT-LES----------LKGTLTISNDSELEKALLSLIENRLL------IKSDDLYLINRNFVSKRTKFRLLLSSKDKESTAITEHETVDRQINDDRKFFIQAAIVRIMKSRKQLNHTMLMKEVLDQAKGRFLPAIPMIKKCIEILIDKCYMERNPDNNDIYSYLA 786          
The following BLAST results are available for this feature:
BLAST of Cullin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CUL10.000e+041.84cullin 1 [Source:HGNC Symbol;Acc:HGNC:2551][more]
CUL10.000e+041.84cullin 1 [Source:HGNC Symbol;Acc:HGNC:2551][more]
CUL10.000e+041.84cullin 1 [Source:HGNC Symbol;Acc:HGNC:2551][more]
CUL10.000e+041.84cullin 1 [Source:HGNC Symbol;Acc:HGNC:2551][more]
CUL10.000e+041.84cullin 1 [Source:HGNC Symbol;Acc:HGNC:2551][more]
back to top
BLAST of Cullin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cul-12.965e-17135.32Cullin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17389][more]
cul-63.390e-11329.72Cullin-6 [Source:UniProtKB/Swiss-Prot;Acc:Q21346][more]
cul-23.718e-9333.50Cullin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q17390][more]
cul-23.718e-9333.50Cullin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q17390][more]
cul-27.125e-9333.50Cullin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q17390][more]
back to top
BLAST of Cullin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cul10.000e+040.65gene:FBgn0015509 transcript:FBtr0088848[more]
Cul10.000e+040.65gene:FBgn0015509 transcript:FBtr0088847[more]
Cul10.000e+040.65gene:FBgn0015509 transcript:FBtr0088845[more]
Cul10.000e+040.65gene:FBgn0015509 transcript:FBtr0088846[more]
Cul21.996e-10832.12gene:FBgn0032956 transcript:FBtr0085900[more]
back to top
BLAST of Cullin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cul1a0.000e+042.21cullin 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2603][more]
cul1a0.000e+042.21cullin 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2603][more]
cul1a0.000e+042.21cullin 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2603][more]
cul1b0.000e+042.12cullin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2887][more]
cul1b0.000e+042.12cullin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2887][more]
back to top
BLAST of Cullin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cplx10.000e+041.60complexin 1 [Source:Xenbase;Acc:XB-GENE-5815523][more]
cplx11.512e-16745.17complexin 1 [Source:Xenbase;Acc:XB-GENE-5815523][more]
cplx12.296e-16645.17complexin 1 [Source:Xenbase;Acc:XB-GENE-5815523][more]
cplx12.438e-16645.17complexin 1 [Source:Xenbase;Acc:XB-GENE-5815523][more]
CUL23.239e-12232.88cullin 2 [Source:NCBI gene;Acc:100492608][more]
back to top
BLAST of Cullin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cul10.000e+041.84cullin 1 [Source:MGI Symbol;Acc:MGI:1349658][more]
Cul10.000e+040.35cullin 1 [Source:MGI Symbol;Acc:MGI:1349658][more]
Cul22.304e-12331.87cullin 2 [Source:MGI Symbol;Acc:MGI:1918995][more]
Cul26.587e-10129.12cullin 2 [Source:MGI Symbol;Acc:MGI:1918995][more]
Cul22.681e-8732.62cullin 2 [Source:MGI Symbol;Acc:MGI:1918995][more]
back to top
BLAST of Cullin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WTX6|CUL1_MOUSE0.000e+041.84Cullin-1 OS=Mus musculus OX=10090 GN=Cul1 PE=1 SV=... [more]
sp|Q5R4G6|CUL1_PONAB0.000e+041.84Cullin-1 OS=Pongo abelii OX=9601 GN=CUL1 PE=2 SV=1[more]
sp|Q13616|CUL1_HUMAN0.000e+041.84Cullin-1 OS=Homo sapiens OX=9606 GN=CUL1 PE=1 SV=2[more]
sp|Q24311|CUL1_DROME0.000e+040.65Cullin homolog 1 OS=Drosophila melanogaster OX=722... [more]
sp|O60999|CUL1_DICDI2.615e-17638.15Cullin-1 OS=Dictyostelium discoideum OX=44689 GN=c... [more]
back to top
BLAST of Cullin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LTL00.000e+044.54CULLIN_2 domain-containing protein OS=Opisthorchis... [more]
A0A504YQM70.000e+045.11Cullin-1 OS=Fasciola gigantica OX=46835 GN=FGIG_09... [more]
A0A4E0R2I60.000e+044.77Cullin-1 OS=Fasciola hepatica OX=6192 GN=D915_0087... [more]
A0A3Q0KPR60.000e+044.73Putative cullin OS=Schistosoma mansoni OX=6183 PE=... [more]
G4VHP40.000e+044.43Putative cullin OS=Schistosoma mansoni OX=6183 GN=... [more]
back to top
BLAST of Cullin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cul1b0.000e+042.33cullin 1 [Source:NCBI gene;Acc:103026940][more]
cul1a0.000e+042.45cullin-1 [Source:NCBI gene;Acc:111194478][more]
cul1b0.000e+042.01cullin 1 [Source:NCBI gene;Acc:103026940][more]
cul1b0.000e+040.00cullin 1 [Source:NCBI gene;Acc:103026940][more]
cul28.941e-12332.30cullin 2 [Source:NCBI gene;Acc:103040496][more]
back to top
BLAST of Cullin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cul1b0.000e+042.40cullin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2887][more]
cul1b0.000e+041.22cullin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2887][more]
cul24.547e-12331.73cullin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-8032][more]
cul4b3.538e-5630.07cullin 4B [Source:ZFIN;Acc:ZDB-GENE-041008-208][more]
cul5a3.931e-2223.76cullin 5a [Source:ZFIN;Acc:ZDB-GENE-030131-5426][more]
back to top
BLAST of Cullin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CDC537.780e-9828.75Cullin; structural protein of SCF complexes (which... [more]
CUL31.166e-2724.71Ubiquitin-protein ligase; forms a complex with Elc... [more]
back to top
BLAST of Cullin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO375700.000e+041.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490911.349e-10431.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356601.325e-8231.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352301.127e-7626.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387612.318e-5727.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cullin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cul1a0.000e+041.83cullin 1 [Source:NCBI gene;Acc:101155471][more]
cul28.891e-12432.03cullin 2 [Source:NCBI gene;Acc:101155234][more]
cul21.745e-10929.97cullin 2 [Source:NCBI gene;Acc:101155234][more]
cul27.159e-10129.32cullin 2 [Source:NCBI gene;Acc:101155234][more]
cul4a7.536e-8031.14cullin-4A [Source:NCBI gene;Acc:101154851][more]
back to top
BLAST of Cullin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008644.10.000e+099.88SMESG000008644.1[more]
SMESG000001134.12.640e-7025.32SMESG000001134.1[more]
SMESG000020142.11.103e-5727.46SMESG000020142.1[more]
SMESG000020142.11.295e-5727.46SMESG000020142.1[more]
SMESG000006288.18.312e-5226.90SMESG000006288.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034505 ID=SMED30034505|Name=Cullin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2832bp
TCTATATAAATCTTATATGTTATAGAAATGAGTAGTGAAAATTTGTTAGC
GATTTGGGAGGATCTAGAAGTTGGAATCCAAGCTATTTTTAATATGGAAA
ACATAGGGAGAGAAAGTTACATGAATTTATACAGTCAAGTTTATAACTAC
TGTACTTTTGTTGATCCTAAAAACGTATCAGTTCAAAACTCTTCAAGTGC
TAGCACAAGAAGTCACAATGGATTTCCTGGAAATTTTCATCGATCTCACG
AATCCAATCCTTCTAATCAAAATGGAGCTAAATTAATTGGATGGGAATTA
TATAAAAAACTCAAGGAATATTTAAAAAATCATGTTATAAAATTGAAAAT
TAAAGGTGATGGTAAAACTGATGAAGAAATGTTGAAATTTATTCAATCAT
CATGGACAGAATACAGTTTTTCTGTTAAGGTCCTAAATGGAGTTTGTATG
TATTTAAATAGAAATTGGGTTAAAAGACAATTGGAAGAAGGGCATAAGCA
ATTTCATGACATTTACACGTGTGCCTTGTTAGCATGGACAGAAAATCTTT
TACGGCCCCATCAGACCATAATTTCAGATGCATTGATAAAAGAAGTGGAA
AAGGAAAGATTAGATGAACAATTAAATCACAGATTTCTAAAACCGATTAT
TGACTGTTTGGTTGAAGTTGGTAGAGTTGGCGGGAGCACTCCAAAAATCA
CAGGAACCCTGGGCCAGTCACAACATTCTGACAATTCTACATTAATCGGA
CAAGCAGATCATGATGTTAGCATGAAAATGAATTTCGATTTATCTGTATA
TGTGAAAATTTTCGAAACACCTTTTATAAAAAAGACTGAAAGATTTTATC
GAATAGAAAGTATGGATTTTCTTGCAAAGAATGAAATTACAGACTATCTT
AAAAAAGTTGAAGATCGAATGGCAGAAGAAGAACAACGAATTAATTCATT
TATACATTTTGCACCTCGTAATAAAACGTTAGAAGAACTTAATTCAGTTC
TTACTAAAACTCTATTGGCAGATCATCTAGATCGAATAATAAATGAATTT
ACACCTCTTCTTGCTGCCGAAAGAATATCAGACTTAAGAAGAATGTTTAC
TTTGTTATACAAAATTCCCGAAGCTTTTATTTCAATGACTTCTCATTTTG
AAAATTTTGTGTATCAGAAAGGCAATGAAGCGATCAGTAGTAAAAGTACA
GATAATTTACCGGAACCAAAAGTCTACATCGAAACTATTTTAGATGTTTA
TAAAAAAAATTACGCTACTGTTACTGAAGCATTTCACGGAGAAATCAGAT
TTTTAAAAGCACTTGACAAGGGCTGTGAGAGATTTATTAATAAAAATGCT
GTGACTGAAATGGCTAAAACTTCACGTAAAACTCCGGAATTTCTTGCCAA
ATATTGTGATATGCTTTTAAAAAAAAGTTCACGTGACACAAACACCGATG
ATCTCGACGAAATTCTATCTAGATTTATGACTGTTTTCAAATATATAGAG
GATAAAGATGTTTTCCAAGGATTCTATTCTAAAATGCTGGCTCGTAGGTT
AATAAATGACTTATCAATATCCGAAGACATCGAAGCAGCTATGATTTCCA
GATTAAAGGAATCTTGTGGATATGAATATACAGCTAAATTACAAAGAATG
TTCAGTGATAAGTCAACCAGTCGTGATCTTAATGCAAAATTTTTAATCAG
TCCTCAAAATAAATCTGGAAACATCGACCTTAACGTAATGGTTCTCAGCT
CAAATTCTTGGCCGTACACTGCACAAGAAAAATTCACATTACCACAAGAA
TTGATTCCTTGTTATCAGTCGTTTATCGATTTTTTCAATACGGCTCACAC
TGGACGAAAACTTAGTTGGTGTTTTAATTTGGGCCGTGGAGAGGTTGTTA
CTCATTATACAAAGAAAACATATATATTCCAAGTTTCCACTTATCAAATA
GCGATTTTATTGCTTTTCAATAAATGTCTTTCTTATTCTGTAAAAGAAAT
AGTCGAAGCTACTCAACTTGAGTCAAATATCGTTATCCAAATTCTGCAAA
TTTTCCTTCGTGGCAAAGTTTTAGTTGTTAATGGGGACAAAATGGCTATG
GATACTGTATCGAAAATTGACACCAATCTCGAAAATGAAGAGATACCTGA
CATTGGCCCTAATACAGTTATGCATTTATATACGGATTACAGAAATAAAA
GAATTCGTGTTAACCTTAATCTCCAGTTGAAAGGGGAAACCAAACAAGAA
GTTGAAGAAGTCATATCTCGTGTGGACCATGATCGTAGAATGGCTATCGA
TGCGTGTATTGTACGCGTAATGAAAACCAGAAAAACTCTTAAACATCAAG
AACTAGTTCGAGAGGTTTTGGAACAATTATCTACTAAATTCAACCCACAA
GTGACCCTTATCAAGCGTTGTATAGCAGGATTGATCGAAAAGGAATATTT
GAAAAGAGACAGTAATTGTAAAGACACATATCAGTATCTTGCCTAGTAGA
ATAGATCAGCAGAAATCGCTTTACCAGTTGATGATGATGATTCGTGTGCT
CCTTATTTTAACTATTACGCAACATATTCCTTATATAATATTAACGTGTT
TCTTGAAGAAAGTTGTAATTTTTGTTTGAGCAGCCGTTGAACAACTGTAA
AGATGCTTGATAAAAATGAAGAGATTGATTGATCAAGTTCTATGTGTTCT
ACAAGCAGCTGCCATTGTCAGTACATATTTGCTGTTGAGTTCTTGATTTA
TTGTATTTTGTTAAGGTTTGTATAAAAATTATTTGTACCTAAATACTACC
AATTTATCATCAATAAATTTCTTAGTGAGATC
back to top

protein sequence of SMED30034505-orf-1

>SMED30034505-orf-1 ID=SMED30034505-orf-1|Name=SMED30034505-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=823bp
MSSENLLAIWEDLEVGIQAIFNMENIGRESYMNLYSQVYNYCTFVDPKNV
SVQNSSSASTRSHNGFPGNFHRSHESNPSNQNGAKLIGWELYKKLKEYLK
NHVIKLKIKGDGKTDEEMLKFIQSSWTEYSFSVKVLNGVCMYLNRNWVKR
QLEEGHKQFHDIYTCALLAWTENLLRPHQTIISDALIKEVEKERLDEQLN
HRFLKPIIDCLVEVGRVGGSTPKITGTLGQSQHSDNSTLIGQADHDVSMK
MNFDLSVYVKIFETPFIKKTERFYRIESMDFLAKNEITDYLKKVEDRMAE
EEQRINSFIHFAPRNKTLEELNSVLTKTLLADHLDRIINEFTPLLAAERI
SDLRRMFTLLYKIPEAFISMTSHFENFVYQKGNEAISSKSTDNLPEPKVY
IETILDVYKKNYATVTEAFHGEIRFLKALDKGCERFINKNAVTEMAKTSR
KTPEFLAKYCDMLLKKSSRDTNTDDLDEILSRFMTVFKYIEDKDVFQGFY
SKMLARRLINDLSISEDIEAAMISRLKESCGYEYTAKLQRMFSDKSTSRD
LNAKFLISPQNKSGNIDLNVMVLSSNSWPYTAQEKFTLPQELIPCYQSFI
DFFNTAHTGRKLSWCFNLGRGEVVTHYTKKTYIFQVSTYQIAILLLFNKC
LSYSVKEIVEATQLESNIVIQILQIFLRGKVLVVNGDKMAMDTVSKIDTN
LENEEIPDIGPNTVMHLYTDYRNKRIRVNLNLQLKGETKQEVEEVISRVD
HDRRMAIDACIVRVMKTRKTLKHQELVREVLEQLSTKFNPQVTLIKRCIA
GLIEKEYLKRDSNCKDTYQYLA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000101muscle cell
PLANA:0000136whole organism
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036317Cullin_homology_sf
IPR036390WH_DNA-bd_sf
IPR016158Cullin_homology
IPR019559Cullin_neddylation_domain
IPR001373Cullin_N
IPR011991WHTH_DNA-bd_dom
IPR016157Cullin_CS
IPR016159Cullin_repeat-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0031625ubiquitin protein ligase binding
Vocabulary: biological process
TermDefinition
GO:0006511ubiquitin-dependent protein catabolic process
GO:0006513protein monoubiquitination
GO:0006915apoptotic process
GO:0008283cell proliferation
GO:0009887animal organ morphogenesis
GO:0016567protein ubiquitination
GO:0031146SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
Vocabulary: cellular component
TermDefinition
GO:0031461cullin-RING ubiquitin ligase complex
GO:0019005SCF ubiquitin ligase complex
GO:1990452Parkin-FBXW7-Cul1 ubiquitin ligase complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 287..307
NoneNo IPR availableGENE3DG3DSA:1.20.1310.10coord: 10..180
e-value: 3.1E-44
score: 153.0
NoneNo IPR availableGENE3DG3DSA:1.10.10.2620coord: 567..737
e-value: 1.4E-50
score: 173.0
NoneNo IPR availableGENE3DG3DSA:1.20.1310.10coord: 181..336
e-value: 1.9E-26
score: 94.2
NoneNo IPR availableGENE3DG3DSA:1.20.1310.10coord: 337..451
e-value: 4.8E-29
score: 102.5
NoneNo IPR availableGENE3DG3DSA:1.20.1310.10coord: 453..566
e-value: 3.0E-40
score: 138.9
NoneNo IPR availablePANTHERPTHR11932CULLINcoord: 7..825
NoneNo IPR availablePANTHERPTHR11932:SF81CULLIN-1coord: 7..825
IPR019559Cullin protein, neddylation domainSMARTSM00884Cullin_Nedd8_2coord: 752..819
e-value: 2.5E-31
score: 120.1
IPR019559Cullin protein, neddylation domainPFAMPF10557Cullin_Nedd8coord: 755..816
e-value: 2.6E-27
score: 94.7
IPR016158Cullin homology domainSMARTSM00182cul_2coord: 484..630
e-value: 1.2E-63
score: 227.4
IPR016158Cullin homology domainPROSITEPS50069CULLIN_2coord: 454..680
score: 54.614
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 738..825
e-value: 5.2E-32
score: 111.6
IPR001373Cullin, N-terminalPFAMPF00888Cullincoord: 13..691
e-value: 2.7E-159
score: 531.7
IPR016157Cullin, conserved sitePROSITEPS01256CULLIN_1coord: 798..825
IPR036317Cullin homology domain superfamilySUPERFAMILYSSF75632Cullin homology domaincoord: 451..734
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 737..825
IPR016159Cullin repeat-like-containing domain superfamilySUPERFAMILYSSF74788Cullin repeat-likecoord: 12..446