Granulin b

Overview
NameGranulin b
Smed IDSMED30034503
Length (bp)757
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Granulin b (SMED30034503) t-SNE clustered cells

Violin plots show distribution of expression levels for Granulin b (SMED30034503) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Granulin b (SMED30034503) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Granulin b (SMED30034503) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034503

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30034503SMESG000002628.1 dd_Smed_v4_67_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034503SMESG000002628.1 dd_Smed_v6_67_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034503SMESG000002628.1 dd_Smed_v6_67_0dd_Smed_v6PMID:29674432
Plass et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
glial cellSMED30034503SMESG000002628.1 dd_Smed_v6_67_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Granulin b vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 82.0333 bits (201), Expect = 2.244e-17
Identity = 61/184 (33.15%), Postives = 83/184 (45.11%), Query Frame = 2
Query:  143 FLMKCPSLFLCALFL--CIFVYDITTDGVTTFKQVDEDGCKNSNKI-CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCI 685
             L  CP   +C L    C+   + TTD +T          K   ++ C +  TCC  + G   CC +T AVCCED  HCCP G TCDT+   C  Q    + W    +K  A  ++P             +++     C +   C    TCC LT+G +GCCP    VCC D + CCP G  C+
Sbjct:   57 HLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTC-EQGPHQVPWM---EKAPAHLSLPD-----------PQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCV 225          

HSP 2 Score: 72.4034 bits (176), Expect = 5.354e-14
Identity = 50/143 (34.97%), Postives = 66/143 (46.15%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C ++   C +  TCC    GK  CC   NA CC D  HCCP+ T CD    +C+  SKE       +     +  +P +TV             ++  CPDG       TCC L +G +GCCP++  VCC D   CCP G  C
Sbjct:   22 CPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCL--SKE-------NATTDLLTKLPAHTVGDV-------KCDMEVSCPDG------YTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTC 142          

HSP 3 Score: 58.5362 bits (140), Expect = 2.243e-9
Identity = 41/123 (33.33%), Postives = 56/123 (45.53%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPY 625
            + +  C   +TCC +  G   CCQ  +AVCCED  HCCP G TC+ K + C               +   + A P   + RSP       +G+K+V C +G  C    TCC      + CCPY
Sbjct:  259 DQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSC---------------EKEVVSAQPATFLARSP------HVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPY 360          

HSP 4 Score: 54.6842 bits (130), Expect = 4.374e-8
Identity = 41/136 (30.15%), Postives = 54/136 (39.71%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C    TCC    G+  CC    AVCC D  HCCP+G TC  +            +     + +  ++ +P      S  R+    IG    C     C    TCC    G + CC     VCC D++ CCP G  C
Sbjct:  186 CPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEG-----------QCQRGSEIVAGLEKMPARRASLSHPRD----IG----CDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTC 302          
BLAST of Granulin b vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 82.0333 bits (201), Expect = 3.265e-17
Identity = 61/184 (33.15%), Postives = 83/184 (45.11%), Query Frame = 2
Query:  143 FLMKCPSLFLCALFL--CIFVYDITTDGVTTFKQVDEDGCKNSNKI-CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCI 685
             L  CP   +C L    C+   + TTD +T          K   ++ C +  TCC  + G   CC +T AVCCED  HCCP G TCDT+   C  Q    + W    +K  A  ++P             +++     C +   C    TCC LT+G +GCCP    VCC D + CCP G  C+
Sbjct:  243 HLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTC-EQGPHQVPWM---EKAPAHLSLPD-----------PQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCV 411          

HSP 2 Score: 80.8777 bits (198), Expect = 7.856e-17
Identity = 52/143 (36.36%), Postives = 69/143 (48.25%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCI 685
            + +  C   +TCC +  G   CCQ  +AVCCED  HCCP G TC+ K + C               +   + A P   + RSP       +G+K+V C +G  C    TCC      + CCPY  GVCC D+R CCP G +C 
Sbjct:  445 DQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSC---------------EKEVVSAQPATFLARSP------HVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCA 566          

HSP 3 Score: 73.9442 bits (180), Expect = 1.666e-14
Identity = 60/198 (30.30%), Postives = 80/198 (40.40%), Query Frame = 2
Query:  200 YDITTDGVTTFKQVDEDG-----CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNG-------RKCIPGSCI*FELY*RLFLDQIGFMKCD 757
            +  + DG + F++   +      C +S   C +  TCC+   G   CC    A CCED  HCCP G  CD  + RCI         T +     A K   + T     L         ++ CPDG       TCC L +G YGCCP     CC D   CCP          KC+       +L  +L    +G +KCD
Sbjct:  103 FHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCI---------TPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGS------TCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCD 285          

HSP 4 Score: 73.1738 bits (178), Expect = 4.026e-14
Identity = 50/143 (34.97%), Postives = 66/143 (46.15%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C ++   C +  TCC    GK  CC   NA CC D  HCCP+ T CD    +C+  SKE       +     +  +P +TV             ++  CPDG       TCC L +G +GCCP++  VCC D   CCP G  C
Sbjct:  208 CPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCL--SKE-------NATTDLLTKLPAHTVGDV-------KCDMEVSCPDG------YTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTC 328          

HSP 5 Score: 59.3066 bits (142), Expect = 1.796e-9
Identity = 40/140 (28.57%), Postives = 57/140 (40.71%), Query Frame = 2
Query:  266 NKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +  C    +C  T  G   CC +  AV C D  HCCP G  C    + C  +S         ++ + AI+                        CPD   +C  + TCC++ +G +GCCP     CC D+  CCP+G  C
Sbjct:   64 DAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRS--------GNNSVGAIQ------------------------CPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFC 171          
BLAST of Granulin b vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 80.8777 bits (198), Expect = 6.527e-17
Identity = 52/143 (36.36%), Postives = 69/143 (48.25%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCI 685
            + +  C   +TCC +  G   CCQ  +AVCCED  HCCP G TC+ K + C               +   + A P   + RSP       +G+K+V C +G  C    TCC      + CCPY  GVCC D+R CCP G +C 
Sbjct:  288 DQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSC---------------EKEVVSAQPATFLARSP------HVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCA 409          

HSP 2 Score: 80.1073 bits (196), Expect = 1.376e-16
Identity = 55/167 (32.93%), Postives = 76/167 (45.51%), Query Frame = 2
Query:  200 YDITTDGVTTFKQ-----VDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCI 685
            +  + DG + F++     V    C +S   C +  TCC+   G   CC    AVCCED  HCCP G TCDT+   C  Q    + W    +K  A  ++P             +++     C +   C    TCC LT+G +GCCP    VCC D + CCP G  C+
Sbjct:  103 FHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQAVCCEDHIHCCPAGFTCDTQKGTC-EQGPHQVPWM---EKAPAHLSLPD-----------PQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCV 254          

HSP 3 Score: 60.077 bits (144), Expect = 6.916e-10
Identity = 41/137 (29.93%), Postives = 55/137 (40.15%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C    +C  T  G   CC +  AV C D  HCCP G  C    + C  +S         ++ + AI+                        CPD   +C  + TCC++ +G +GCCP    VCC D   CCP G  C
Sbjct:   67 CSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRS--------GNNSVGAIQ------------------------CPDSQFECPDFSTCCVMVDGSWGCCPMPQAVCCEDHIHCCPAGFTC 171          
BLAST of Granulin b vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 78.5666 bits (192), Expect = 3.992e-16
Identity = 60/184 (32.61%), Postives = 81/184 (44.02%), Query Frame = 2
Query:  143 FLMKCPSLFLCALFL--CIFVYDITTDGVTTFKQVDEDGCKNSNKI-CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCI 685
             L  CP   +C L    C+   + TTD +T          K   ++ C +  TCC  + G   CC +T AVCCED  HCCP G TCDT+   C  Q    + W    +K  A  ++P             +++     C +   C    TCC      + CCPY  GVCC D+R CCP G +C 
Sbjct:  243 HLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTC-EQGPHQVPWM---EKAPAHLSLPD-----------PQALKRDVPCDNVSSCPSSDTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCA 411          

HSP 2 Score: 73.9442 bits (180), Expect = 1.430e-14
Identity = 59/200 (29.50%), Postives = 83/200 (41.50%), Query Frame = 2
Query:  200 YDITTDGVTTFKQVDEDG-----CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQS-KEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDG-GKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNG-------RKCIPGSCI*FELY*RLFLDQIGFMKCD 757
            +  + DG + F++   +      C +S   C +  TCC+   G   CC    A CCED  HCCP G  CD  + RCI  +   P+            K +P     R+       ++    +CPD   +C    TCC L +G YGCCP     CC D   CCP          KC+       +L  +L    +G +KCD
Sbjct:  103 FHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPL-----------AKKLPAQRTNRA------VALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCD 285          

HSP 3 Score: 73.1738 bits (178), Expect = 3.018e-14
Identity = 50/143 (34.97%), Postives = 66/143 (46.15%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C ++   C +  TCC    GK  CC   NA CC D  HCCP+ T CD    +C+  SKE       +     +  +P +TV             ++  CPDG       TCC L +G +GCCP++  VCC D   CCP G  C
Sbjct:  208 CPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCL--SKE-------NATTDLLTKLPAHTVGDV-------KCDMEVSCPDG------YTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTC 328          

HSP 4 Score: 59.6918 bits (143), Expect = 1.210e-9
Identity = 40/137 (29.20%), Postives = 56/137 (40.88%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C    +C  T  G   CC +  AV C D  HCCP G  C    + C  +S         ++ + AI+                        CPD   +C  + TCC++ +G +GCCP     CC D+  CCP+G  C
Sbjct:   67 CSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRS--------GNNSVGAIQ------------------------CPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFC 171          
BLAST of Granulin b vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 58.5362 bits (140), Expect = 4.996e-10
Identity = 39/119 (32.77%), Postives = 51/119 (42.86%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQS-KEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDG-GKCTGYLTCCLLTNGHYGCCPY 625
            C    +C  T  G   CC +  A CCED  HCCP G  CD  + RCI  +   P+            K +P     R+       ++    +CPD   +C    TCC L +G YGCCP 
Sbjct:   67 CSAGHSCIFTVSGTSSCCPFPEASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLA-----------KKLPAQRTNRA------VALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPM 168          
BLAST of Granulin b vs. Ensembl Celegans
Match: pgrn-1 (ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:Q7JKP2])

HSP 1 Score: 94.3597 bits (233), Expect = 2.187e-22
Identity = 72/186 (38.71%), Postives = 87/186 (46.77%), Query Frame = 2
Query:  134 SEVFLMKCPSLFLCALFLCIFVYDITTDGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKE--PMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPD-GGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            S +F +K   L L  LFL +F+  +T        Q D +        C + +TCC        CC   NAVCC+D SHCCP GTTCD +  RCI   ++  PM+           K   + TVER+   E         VCPD   KC    TCCLL  G YGCCP    VCC D   CCPNG  C
Sbjct:   71 SFIFSIKIMRLIL--LFLAVFLCRVTA------HQCDAE------TECSDDETCCKLGDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGADEKHVPMKK----------KKPARKTVERNQFNEV--------VCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTC 224          
BLAST of Granulin b vs. Ensembl Celegans
Match: pgrn-1 (ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:Q7JKP2])

HSP 1 Score: 93.9745 bits (232), Expect = 3.069e-22
Identity = 72/186 (38.71%), Postives = 87/186 (46.77%), Query Frame = 2
Query:  134 SEVFLMKCPSLFLCALFLCIFVYDITTDGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKE--PMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPD-GGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            S +F +K   L L  LFL +F+  +T        Q D      +   C + +TCC        CC   NAVCC+D SHCCP GTTCD +  RCI   ++  PM+           K   + TVER+   E         VCPD   KC    TCCLL  G YGCCP    VCC D   CCPNG  C
Sbjct:   71 SFIFSIKIMRLIL--LFLAVFLCRVTA------HQCD------AETECSDDETCCKLGDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGADEKHVPMKK----------KKPARKTVERNQFNEV--------VCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTC 224          

HSP 2 Score: 56.9954 bits (136), Expect = 2.655e-9
Identity = 52/174 (29.89%), Postives = 68/174 (39.08%), Query Frame = 2
Query:  236 QVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWY------------------ESIGLKNVCPDGGKCTGYLTCCLLT--NGH--YGCCPYSFGVCCPDKRTCCPNGRKCIPG 691
            Q +E  C +    C +  TCC+ + G   CC   NAVCC DM HCCP G TC        H       + +    I  ++     ++ R P  E+                   ES      C  G  C    TCC +   NG     CCP S  +CC  + TCCP G  C+ G
Sbjct:  173 QFNEVVCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTC--------HGQFCSQNFAM----IPHLRKFASTSIHRKPAVEFLSEEEEDDDDEESTSSEDPESDVDPIACGVGKTCPAKTTCCNVRGKNGEPKTMCCPLSNAICC--ENTCCPAGYHCVDG 332          
BLAST of Granulin b vs. Ensembl Zebrafish
Match: grnb (granulin b [Source:ZFIN;Acc:ZDB-GENE-030131-7393])

HSP 1 Score: 84.7297 bits (208), Expect = 2.525e-18
Identity = 54/145 (37.24%), Postives = 71/145 (48.97%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV-CPDG-GKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C +    C +  TCC    G   CC   NAVCC+D  HCCP+GTTCD  +  C+  +        S   +    A  +  +E++ +    E   ++ V CPD   KC    TCCLL  G YGCCP    VCC D++ CCP G  C
Sbjct:   95 CPDGESECPDDTTCCQMPDGGWGCCPMKNAVCCDDRKHCCPQGTTCDLVHSMCVSTTYG------SSPFLRKFDARRRKPLEKNAVDLPAEVNNIREVICPDKISKCPEDTTCCLLETGSYGCCPMPKAVCCSDQKHCCPEGTTC 233          

HSP 2 Score: 78.9518 bits (193), Expect = 2.802e-16
Identity = 55/162 (33.95%), Postives = 66/162 (40.74%), Query Frame = 2
Query:  218 GVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCP-------DGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
             VT  K  +E    N    C    TCC T  G   CC    AVCCED  HCCPEGT C+     C             DD      ++P           W E +  K + P       +   C G  TCC L++G +GCCP    VCC D   CCP+G  C
Sbjct:  255 AVTVLKPKEEVVPCNETVACSSGTTCCKTPEGSWACCPLPKAVCCEDHIHCCPEGTLCNVAASSC-------------DDPAGLSVSVP-----------WMEKVSTKPIAPPPNKKCDESSSCPGESTCCKLSSGDWGCCPLPEAVCCEDHVHCCPHGSVC 392          

HSP 3 Score: 73.559 bits (179), Expect = 1.627e-14
Identity = 48/141 (34.04%), Postives = 67/141 (47.52%), Query Frame = 2
Query:  272 ICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLK---NVCPDG-GKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +C +  TCC+T  G   CC   +A CC D  HCC +GT CD ++ +C+             +K H +              +W E +  K    VCPDG  +C    TCC + +G +GCCP    VCC D++ CCP G  C
Sbjct:   27 MCEDGNTCCLTPSGGYGCCPLPHAECCSDHLHCCYQGTLCDLEHSKCV-------------NKTHVL--------------DWVEKVEAKLQAVVCPDGESECPDDTTCCQMPDGGWGCCPMKNAVCCDDRKHCCPQGTTC 140          

HSP 4 Score: 72.4034 bits (176), Expect = 4.116e-14
Identity = 47/141 (33.33%), Postives = 61/141 (43.26%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            + +  C  + TCC    G   CC    AVCCED  HCCP G+ C+   + C   S   +  +V       +K IP  +V              K  C +   C    TCC LT+G + CCP    VCC D+  CCP G  C
Sbjct:  349 DESSSCPGESTCCKLSSGDWGCCPLPEAVCCEDHVHCCPHGSVCNVAAETCETVSDSGLRISVP-----MVKKIPAVSVPSQ-----------KQNCDETSSCPTGTTCCKLTSGSWACCPMPQAVCCADQEHCCPQGYTC 473          

HSP 5 Score: 70.8626 bits (172), Expect = 1.352e-13
Identity = 51/158 (32.28%), Postives = 64/158 (40.51%), Query Frame = 2
Query:  209 TTDGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
              D       + E  C +    C E  TCC+ + G   CC    AVCC D  HCCPEGTTCD  +  C+           ++        IP  TV    L+   E +     C +   C+   TCC    G + CCP    VCC D   CCP G  C
Sbjct:  173 AVDLPAEVNNIREVICPDKISKCPEDTTCCLLETGSYGCCPMPKAVCCSDQKHCCPEGTTCDLIHSTCLS----------ANGVSEMATKIPAVTV----LKPKEEVVP----CNETVACSSGTTCCKTPEGSWACCPLPKAVCCEDHIHCCPEGTLC 312          

HSP 6 Score: 70.8626 bits (172), Expect = 1.661e-13
Identity = 51/155 (32.90%), Postives = 70/155 (45.16%), Query Frame = 2
Query:  233 KQVDEDGCKNSNKICGEQKTCC-MTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYES---IGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            ++V++    ++   C    TCC + +IGK  CC    AVCC+D  HCCP G TC+ +   C                   +  IP +T  +   R W  S   +G ++V C     C    TCC+L  G +GCCP    VCC D   CCP G  C
Sbjct:  501 QRVEDRHMCDAQTSCPRDDTCCFINRIGKWGCCPLPKAVCCKDGDHCCPSGYTCNEEKTSC----------------TKGLHQIPWFT--KKTARVWKSSDELLGHEDVKCDSSTSCPSGSTCCILPTGQWGCCPLVKAVCCEDHEHCCPQGYIC 637          

HSP 7 Score: 68.1662 bits (165), Expect = 1.251e-12
Identity = 43/142 (30.28%), Postives = 55/142 (38.73%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTN-GHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +    C    TCC    G   CC    AVCC D  HCCP+G TCD     C+      M W                   + P     + +  +++C     C    TCC +   G +GCCP    VCC D   CCP+G  C
Sbjct:  430 DETSSCPTGTTCCKLTSGSWACCPMPQAVCCADQEHCCPQGYTCDLAQSSCVRSGLPSMAW-----------------FRKEPALRETQRVEDRHMCDAQTSCPRDDTCCFINRIGKWGCCPLPKAVCCKDGDHCCPSGYTC 554          

HSP 8 Score: 66.2402 bits (160), Expect = 5.508e-12
Identity = 44/143 (30.77%), Postives = 62/143 (43.36%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIP 688
            +S+  C    TCC+   G+  CC    AVCCED  HCCP+G  C  +   C              +K  A  ++    V+   ++           C    +C    +CC L +  + CCPY+  VCC D + CCP G KC P
Sbjct:  594 DSSTSCPSGSTCCILPTGQWGCCPLVKAVCCEDHEHCCPQGYICKLELGTC--------------EKASADVSVSLTAVQMPEIQ-----------CDTFTRCAHTQSCCRLADSTWACCPYTQAVCCKDMKHCCPMGYKCDP 711          
BLAST of Granulin b vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 76.6406 bits (187), Expect = 4.492e-17
Identity = 53/143 (37.06%), Postives = 66/143 (46.15%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKN--VCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            N    C +  TCC TK G   CC    AVCCED  HCCP G  CD     C   S   + W    +K+  ++ I K  V  + +      I   +   CPDG       TCC   +G +GCCP    VCC D   CCP+G+KC
Sbjct:    8 NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGS-VPWV---EKV-PVRPIRKQKVAVTTVSPVSSDIACNDTVACPDGS------TCCKDKDGEWGCCPLPEAVCCEDFIHCCPHGKKC 139          

HSP 2 Score: 47.7506 bits (112), Expect = 1.341e-6
Identity = 27/65 (41.54%), Postives = 30/65 (46.15%), Query Frame = 2
Query:  218 GVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRC 412
             VTT   V  D   N    C +  TCC  K G+  CC    AVCCED  HCCP G  C+     C
Sbjct:   82 AVTTVSPVSSDIACNDTVACPDGSTCCKDKDGEWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSC 146          
BLAST of Granulin b vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 75.8702 bits (185), Expect = 1.871e-16
Identity = 51/155 (32.90%), Postives = 64/155 (41.29%), Query Frame = 2
Query:  218 GVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
             VT       D   N    C +  TCC TK G   CC    AVCCED  HCCP G  CD     C   S   + W         ++ +P   + +  +      +     C D   C    TCC   +G +GCCP    VCC D   CCP+G+KC
Sbjct:   16 AVTQASSASSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSC-EDSSGSVPW---------VEKVPVRPIRKQKVAN--TKVSSDVACNDTVACPDGSTCCKDKDGDWGCCPLPEAVCCEDFIHCCPHGKKC 158          
BLAST of Granulin b vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 77.411 bits (189), Expect = 8.877e-16
Identity = 51/145 (35.17%), Postives = 69/145 (47.59%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPG 691
            +    C    TCC+    +  CC +  AVCC D  HCCPEG  CD + + C+  ++  +E             I + T  RS   +   S+ +K+V C  G  C    TCCL +   +GCCP    VCC D + CCP G KC PG
Sbjct:  890 DEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTTRLYVE-------------ITQLTHIRS--NKPQPSVVVKDVQCGGGFSCHDGETCCLTSQTTWGCCPSPKAVCCDDMQHCCPAGYKCGPG 1019          

HSP 2 Score: 75.8702 bits (185), Expect = 3.602e-15
Identity = 55/157 (35.03%), Postives = 69/157 (43.95%), Query Frame = 2
Query:  218 GVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKN--VCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
             VTT   V  D   N    C +  TCC  K G+  CC    AVCCED  HCCP G  C+     C   S   + W    DK+  ++ I K  V  +        +   +   CPDG       TCC   +G + CCP    VCC D   CCP+G+KC
Sbjct:  539 AVTTVSPVSSDIACNDTVACPDGSTCCKDKDGEWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGS-VPWM---DKV-PVRPIKKQKVAVTQASSASSDVPCNDTAACPDGS------TCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKC 684          

HSP 3 Score: 75.0998 bits (183), Expect = 5.814e-15
Identity = 53/151 (35.10%), Postives = 65/151 (43.05%), Query Frame = 2
Query:  230 FKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
             + V  D   N    C +  TCC TK G   CC    AVCCED  HCCP G  CD     C   S   + W    +K+  ++ I K  V  + +     S+     C D   C    TCC    G + CCP    VCC D   CCP G+KC
Sbjct:  282 HQGVSSDVACNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGS-VSWV---EKV-PVRPIRKQKVAVTQV----SSVSSDVPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKC 423          

HSP 4 Score: 74.7146 bits (182), Expect = 8.705e-15
Identity = 46/141 (32.62%), Postives = 68/141 (48.23%), Query Frame = 2
Query:  263 SNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSK-EPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +N++C   ++CC    G   CC + +  CCED  HCCPEG  C  K+  C + +  +P+    +D  +     +PK       +      I     CPDG  C    + CLL +  YGCCP + G+ C D + CCPN  +C
Sbjct:   21 NNEVCEAGQSCCQDPTGGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHTQPL----ADRTLAKKPDLPKSFRMIFSMPASESDI----TCPDGSSCPAEFS-CLLMSTSYGCCPVAQGLACSDGKHCCPNDHEC 152          

HSP 5 Score: 73.559 bits (179), Expect = 1.694e-14
Identity = 47/141 (33.33%), Postives = 64/141 (45.39%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            N+   C E  TCC    G+  CC ++ AVCC D  HCCP    C+  +  CI                  I    K   E +P  +    +G+   C +   C+   TCCLL+    GCCP+   VCCPD++ CCP G +C
Sbjct:  809 NATHGCPESSTCCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKGDV-------------VIPWYNKIAAESTPAPKL--DLGVVK-CDEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRC 933          

HSP 6 Score: 72.7886 bits (177), Expect = 3.487e-14
Identity = 52/156 (33.33%), Postives = 66/156 (42.31%), Query Frame = 2
Query:  218 GVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
             VT    V  D   N    C +  TCC TK G   CC    AVCCED  HCCP+G  C+    +C             +D +   + + K T  +S            +V C D   C    TCC   +G + CCP    VCC D   CCP+G+KC
Sbjct:  366 AVTQVSSVSSDVPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKC-------------EDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKC 508          

HSP 7 Score: 72.4034 bits (176), Expect = 4.795e-14
Identity = 53/165 (32.12%), Postives = 68/165 (41.21%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKE--PM----------EWTVSDDK---IHAIKAIPKYTV-------ERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C N    C    TCC    G+  CC    AVCC+D  HCCPE T CD K  +C+  + +  PM          EW     K        A P  T        + + L   ++ +     C D   C    TCC   +G + CCP    VCC D   CCP+G+KC
Sbjct:  171 CGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKC 335          

HSP 8 Score: 68.1662 bits (165), Expect = 1.467e-12
Identity = 53/153 (34.64%), Postives = 60/153 (39.22%), Query Frame = 2
Query:  224 TTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            T    V  D   N    C +  TCC  K G   CC    AVCCED  HCCP G  C+     C             DD   ++  + K  V    LR      G K  C     C    TCC    G +GCCP+S  VCC D   CCP   KC
Sbjct:  717 TKVSPVSSDVACNDTVACPDGSTCCKDKDGDWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSC-------------DDPSGSVPWVEKVPVH---LRAGQRPSG-KVKCNATHGCPESSTCCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKC 852          
BLAST of Granulin b vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 77.411 bits (189), Expect = 9.283e-16
Identity = 51/145 (35.17%), Postives = 69/145 (47.59%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPG 691
            +    C    TCC+    +  CC +  AVCC D  HCCPEG  CD + + C+  ++  +E             I + T  RS   +   S+ +K+V C  G  C    TCCL +   +GCCP    VCC D + CCP G KC PG
Sbjct:  714 DEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCVKTTRLYVE-------------ITQLTHIRS--NKPQPSVVVKDVQCGGGFSCHDGETCCLTSQTTWGCCPSPKAVCCDDMQHCCPAGYKCGPG 843          

HSP 2 Score: 75.0998 bits (183), Expect = 5.641e-15
Identity = 53/148 (35.81%), Postives = 64/148 (43.24%), Query Frame = 2
Query:  239 VDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            V  D   N    C +  TCC TK G   CC    AVCCED  HCCP G  CD     C   S   + W    +K+  ++ I K  V  + +     S+     C D   C    TCC    G + CCP    VCC D   CCP G+KC
Sbjct:  285 VSSDVACNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGS-VSWV---EKV-PVRPIRKQKVAVTQV----SSVSSDVPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKC 423          

HSP 3 Score: 74.7146 bits (182), Expect = 7.067e-15
Identity = 46/141 (32.62%), Postives = 68/141 (48.23%), Query Frame = 2
Query:  263 SNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSK-EPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +N++C   ++CC    G   CC + +  CCED  HCCPEG  C  K+  C + +  +P+    +D  +     +PK       +      I     CPDG  C    + CLL +  YGCCP + G+ C D + CCPN  +C
Sbjct:   21 NNEVCEAGQSCCQDPTGGFSCCPFHHGECCEDHLHCCPEGMLCSVKDLTCTNATHTQPL----ADRTLAKKPDLPKSFRMIFSMPASESDI----TCPDGSSCPAEFS-CLLMSTSYGCCPVAQGLACSDGKHCCPNDHEC 152          

HSP 4 Score: 73.559 bits (179), Expect = 1.644e-14
Identity = 47/141 (33.33%), Postives = 64/141 (45.39%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            N+   C E  TCC    G+  CC ++ AVCC D  HCCP    C+  +  CI                  I    K   E +P  +    +G+   C +   C+   TCCLL+    GCCP+   VCCPD++ CCP G +C
Sbjct:  633 NATHGCPESSTCCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKGDV-------------VIPWYNKIAAESTPAPKL--DLGVVK-CDEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRC 757          

HSP 5 Score: 72.7886 bits (177), Expect = 2.969e-14
Identity = 55/163 (33.74%), Postives = 69/163 (42.33%), Query Frame = 2
Query:  218 GVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC--IPGSC 697
             VT    V  D   N    C +  TCC TK G   CC    AVCCED  HCCP+G  C+    +C             +D +   + + K T  +S            +V C D   C    TCC   +G + CCP    VCC D   CCP+G+KC    GSC
Sbjct:  366 AVTQVSSVSSDVPCNDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKC-------------EDPLCTEEPLVKQTPVQSTTTPNVIGTQKSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSC 515          

HSP 6 Score: 72.4034 bits (176), Expect = 4.442e-14
Identity = 56/172 (32.56%), Postives = 71/172 (41.28%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKE--PM----------EWTVSDDK---IHAIKAIPKYTV-------ERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC--IPGSC 697
            C N    C    TCC    G+  CC    AVCC+D  HCCPE T CD K  +C+  + +  PM          EW     K        A P  T        + + L   ++ +     C D   C    TCC   +G + CCP    VCC D   CCP+G+KC    GSC
Sbjct:  171 CGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSC 342          

HSP 7 Score: 72.4034 bits (176), Expect = 5.112e-14
Identity = 55/155 (35.48%), Postives = 63/155 (40.65%), Query Frame = 2
Query:  218 GVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
             VTT   V  D   N    C +  TCC  K G+  CC    AVCCED  HCCP G  C+     C             DD   ++  + K  V    LR      G K  C     C    TCC    G +GCCP+S  VCC D   CCP   KC
Sbjct:  539 AVTTVSPVSSDIACNDTVACPDGSTCCKDKDGEWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSC-------------DDPSGSVPWVEKVPVH---LRAGQRPSG-KVKCNATHGCPESSTCCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKC 676          
BLAST of Granulin b vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 75.485 bits (184), Expect = 5.318e-15
Identity = 52/144 (36.11%), Postives = 70/144 (48.61%), Query Frame = 2
Query:  272 ICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKE-PMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI 700
             C +  TCC        CC   +AVCC D  HCCP GTTCD  +K+C+ Q+ E P+        +  + AI + +  + P             CPD        TCC L++  +GCCPY+  VCC D   CCP+G  C  GSC+
Sbjct:  215 FCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPL--------LPQMPAIREESANQVPCDA-------TTSCPDKN------TCCHLSSEKWGCCPYAQAVCCDDHIHCCPSGFTCSGGSCV 337          

HSP 2 Score: 72.0182 bits (175), Expect = 8.784e-14
Identity = 64/213 (30.05%), Postives = 82/213 (38.50%), Query Frame = 2
Query:  155 CPSLFLCALFLCIFVYDITTDGVTTFKQVDEDGCK------NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI*FELY*RLF------LDQIGFMKCD 757
            CPS F C+   C+    +    +   ++    G K      +    C E++TCC    GK  CC    AVCC D  HCCPEG TC               E +  +  I      P  T E   +            C D   C    TCC L +G +GCCP +  VCC D   CCP G  C  G C   E    LF        +  ++KCD
Sbjct:  325 CPSGFTCSGGSCV----LAEHSIPWMRKTLAQGLKTTRVQCDDTASCPEKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCSQG------------ECSKMEHSIPWFTKTPALTHEARDVE-----------CDDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGEHSIPLFSKTPALRQETKYVKCD 510          

HSP 3 Score: 65.855 bits (159), Expect = 9.807e-12
Identity = 51/153 (33.33%), Postives = 62/153 (40.52%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV---CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI*FE 709
            ++   C ++ TCC     K  CC Y  AVCC+D  HCCP G TC      C+                H+I  + K   +           GLK     C D   C    TCC L +G +GCCP    VCC D   CCP G  C  G C   E
Sbjct:  288 DATTSCPDKNTCCHLSSEKWGCCPYAQAVCCDDHIHCCPSGFTC--SGGSCVLAE-------------HSIPWMRKTLAQ-----------GLKTTRVQCDDTASCPEKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCSQGECSKME 414          

HSP 4 Score: 65.0846 bits (157), Expect = 2.064e-11
Identity = 45/146 (30.82%), Postives = 59/146 (40.41%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSC 697
            +    C + +TCC    G   CC    AVCC+D  HCCP G TC     +C+          + +  I      P    +   ++           C D   C    TCC L +G +GCCP +  VCC D   CCP G  C  G C
Sbjct:  510 DDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGSQCM----------IGEHSIPWFSKTPALKQKAKDVQ-----------CDDMYSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQC 632          

HSP 5 Score: 63.1586 bits (152), Expect = 7.937e-11
Identity = 48/149 (32.21%), Postives = 61/149 (40.94%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCM-TKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKN-----VCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C +    C    TCCM + +    CC    AVCC+D  HCCP  + CD +  RCI           + D I  +  +P          E  + +GL +      C DG  C    TCC   +  YGCC     VCC D   CCP G  C
Sbjct:  121 CPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCIS----------NQDHIPWMSKLPARVKS-----EGLKLVGLGDEERRVPCLDGTFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTC 254          
BLAST of Granulin b vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 75.485 bits (184), Expect = 6.874e-15
Identity = 52/144 (36.11%), Postives = 70/144 (48.61%), Query Frame = 2
Query:  272 ICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKE-PMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI 700
             C +  TCC        CC   +AVCC D  HCCP GTTCD  +K+C+ Q+ E P+        +  + AI + +  + P             CPD        TCC L++  +GCCPY+  VCC D   CCP+G  C  GSC+
Sbjct:  215 FCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPL--------LPQMPAIREESANQVPCDA-------TTSCPDKN------TCCHLSSEKWGCCPYAQAVCCDDHIHCCPSGFTCSGGSCV 337          

HSP 2 Score: 71.633 bits (174), Expect = 1.234e-13
Identity = 61/197 (30.96%), Postives = 80/197 (40.61%), Query Frame = 2
Query:  155 CPSLFLCALFLCIFVYDITTDGVTTFKQVDEDGCK------NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI*FELY*RLF 727
            CPS F C+   C+    +    +   ++    G K      +    C E++TCC    GK  CC    AVCC D  HCCPEG TC       +  S   + W     K   +  +    +   P+     S+     C D   C    TCC L +G +GCCP +  VCC D   CCP G  C  G C   E    LF
Sbjct:  325 CPSGFTCSGGSCV----LAEHSIPWMRKTLAQGLKTTRVQCDDTASCPEKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCSQGECSKMEHS---IPWFT---KTPMVFFLSLSLLSILPVV----SVARDVECDDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGEHSIPLF 507          

HSP 3 Score: 69.707 bits (169), Expect = 5.410e-13
Identity = 51/159 (32.08%), Postives = 70/159 (44.03%), Query Frame = 2
Query:  227 TFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC-IPGSCI 700
              KQ  +D   +    C + +TCC    G   CC    AVCC+D  HCCP G TC         + +  + W     K  A+K   K  +  +P+  +  +I     C D   C    TCC + +G +GCCP    VCC D   CCP G  C   G+C+
Sbjct:  615 ALKQKAKDVQCDDMYSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQ---CQKGEHSIPWY---SKTPALKQEGKCNLANTPVNVFAGNI---VKCDDSFACKDGYTCCRMVSGVWGCCPIEKAVCCSDHWHCCPQGFTCDARGTCV 764          

HSP 4 Score: 65.855 bits (159), Expect = 1.131e-11
Identity = 51/153 (33.33%), Postives = 62/153 (40.52%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV---CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI*FE 709
            ++   C ++ TCC     K  CC Y  AVCC+D  HCCP G TC      C+                H+I  + K   +           GLK     C D   C    TCC L +G +GCCP    VCC D   CCP G  C  G C   E
Sbjct:  288 DATTSCPDKNTCCHLSSEKWGCCPYAQAVCCDDHIHCCPSGFTC--SGGSCVLAE-------------HSIPWMRKTLAQ-----------GLKTTRVQCDDTASCPEKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCSQGECSKME 414          

HSP 5 Score: 65.4698 bits (158), Expect = 1.277e-11
Identity = 52/180 (28.89%), Postives = 70/180 (38.89%), Query Frame = 2
Query:  158 PSLFLCALFLCIFVYDITTDGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSC 697
            P   L + F+C F        V  + + D+         C + +TCC    G   CC    AVCC+D  HCCP G TC     +C+          + +  I      P    +   ++           C D   C    TCC L +G +GCCP +  VCC D   CCP G  C  G C
Sbjct:  531 PLCLLFSPFICPF-------SVAKYVKCDD------THSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGSQCM----------IGEHSIPWFSKTPALKQKAKDVQ-----------CDDMYSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQC 674          

HSP 6 Score: 63.1586 bits (152), Expect = 9.857e-11
Identity = 45/144 (31.25%), Postives = 56/144 (38.89%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCM-TKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C +    C    TCCM + +    CC    AVCC+D  HCCP  + CD +  RCI           + D I  +  +P                  +  C DG  C    TCC   +  YGCC     VCC D   CCP G  C
Sbjct:  121 CPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCIS----------NQDHIPWMSKLPARVKSEGLKLVGLGDEERRVPCLDGTFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTC 254          

HSP 7 Score: 60.8474 bits (146), Expect = 4.381e-10
Identity = 52/170 (30.59%), Postives = 65/170 (38.24%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSD---DKIHAI------------------------KAIPKYTVERSPLREWYESIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCI 685
            + +  C +  TCC    G   CC    AVCC D  HCCP+G TCD +    + Q   P    V     D  H+I                            K  +E SP     + + L  V C     C    TCC    G + CC Y+ GVCCPD   CCP G  C+
Sbjct:  714 DDSFACKDGYTCCRMVSGVWGCCPIEKAVCCSDHWHCCPQGFTCDARGTCVLGQFSIPWLTKVPALPFDGTHSICDDTHTCPSGTTCCPGEGGGWRCCPVEEKEAIETSPSDTSVQGLRLDYVWCDSQYACFDGQTCCRGLGGVWNCCVYTQGVCCPDMVHCCPYGYVCL 883          

HSP 8 Score: 60.8474 bits (146), Expect = 5.370e-10
Identity = 47/148 (31.76%), Postives = 59/148 (39.86%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYE------SIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI 700
            C + +TCC    G   CC    AVCC+D  HCCP G TC     +    S      T +  +  A            PL   +       S+     C D   C    TCC L +G +GCCP +  VCC D   CCP G  C    C+
Sbjct:  454 CPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGEHSIPLFSKTPALRQETACARRCGDDEYPFPLCLLFSPFICPFSVAKYVKCDDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGSQCM 601          
BLAST of Granulin b vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 68.5514 bits (166), Expect = 1.257e-12
Identity = 50/147 (34.01%), Postives = 64/147 (43.54%), Query Frame = 2
Query:  272 ICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKE-PMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI*FE 709
             C +  TCC        CC   +AVCC D  HCCP GTTCD  +K+C+ Q+ E P+        +  + AI + +  + P                    T   TCC L +G +GCCP    VCC D   CCP G  C  G C   E
Sbjct:  208 FCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPL--------LPQMPAIREESANQVPCD----------------ATTKKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCSQGECSKME 330          

HSP 2 Score: 66.2402 bits (160), Expect = 6.799e-12
Identity = 54/165 (32.73%), Postives = 66/165 (40.00%), Query Frame = 2
Query:  281 EQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI*FELY*RLF------LDQIGFMKCD 757
            +++TCC    GK  CC    AVCC D  HCCPEG TC               E +  +  I      P  T E   +            C D   C    TCC L +G +GCCP +  VCC D   CCP G  C  G C   E    LF        +  ++KCD
Sbjct:  285 KKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCSQG------------ECSKMEHSIPWFTKTPALTHEARDVE-----------CDDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGEHSIPLFSKTPALRQETKYVKCD 426          

HSP 3 Score: 62.7734 bits (151), Expect = 9.536e-11
Identity = 45/148 (30.41%), Postives = 61/148 (41.22%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC-IPGSCI 700
            +    C + +TCC    G   CC    AVCC+D  HCCP G TC     +C+          + +  I      P    +   ++           C D   C    TCC L +G +GCCP +  VCC D   CCP G  C   G+C+
Sbjct:  426 DDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGSQCM----------IGEHSIPWFSKTPALKQKAKDVQ-----------CDDMYSCADGQTCCRLASGDWGCCPIAQAVCCSDHWHCCPQGFTCDARGTCV 550          

HSP 4 Score: 62.7734 bits (151), Expect = 9.805e-11
Identity = 47/145 (32.41%), Postives = 61/145 (42.07%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCM-TKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C +    C    TCCM + +    CC    AVCC+D  HCCP  + CD +  RCI  +++ + W                 + + P R   E    + V C DG  C    TCC   +  YGCC     VCC D   CCP G  C
Sbjct:  121 CPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCI-SNQDHIPW-----------------MSKLPARVKSEGDEERRVPCLDGTFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTC 247          

HSP 5 Score: 62.7734 bits (151), Expect = 1.137e-10
Identity = 50/142 (35.21%), Postives = 61/142 (42.96%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI 700
            C + +TCC    G   CC    AVCC+D  HCCP G TC     +C  Q  E           H+I    K    R       E+  +K  C D   C    TCC L +G +GCCP +  VCC D   CCP G  C    C+
Sbjct:  357 CPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGGQC--QKGE-----------HSIPLFSKTPALRQ------ETKYVK--CDDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGSQCM 475          

HSP 6 Score: 49.6766 bits (117), Expect = 2.358e-6
Identity = 37/132 (28.03%), Postives = 50/132 (37.88%), Query Frame = 2
Query:  227 TFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCP 622
              KQ  +D   +    C + +TCC    G   CC    AVCC D  HCCP+G TCD +    + Q   P            +  +P    +           G  ++C D   C    TCC    G + CCP
Sbjct:  489 ALKQKAKDVQCDDMYSCADGQTCCRLASGDWGCCPIAQAVCCSDHWHCCPQGFTCDARGTCVLGQFSIPW-----------LTKVPALPFD-----------GTHSICDDTHTCPSGTTCCPGEGGGWRCCP 598          
BLAST of Granulin b vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 68.5514 bits (166), Expect = 1.430e-12
Identity = 49/146 (33.56%), Postives = 62/146 (42.47%), Query Frame = 2
Query:  272 ICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI*FE 709
             C +  TCC        CC   +AVCC D  HCCP GTTCD  +K+C+ Q+ E          +  + AI + +  + P                    T   TCC L +G +GCCP    VCC D   CCP G  C  G C   E
Sbjct:  228 FCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGE-------GPLLPQMPAIREESANQVPCD----------------ATTKKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCSQGECSKME 350          

HSP 2 Score: 66.2402 bits (160), Expect = 8.175e-12
Identity = 54/165 (32.73%), Postives = 66/165 (40.00%), Query Frame = 2
Query:  281 EQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI*FELY*RLF------LDQIGFMKCD 757
            +++TCC    GK  CC    AVCC D  HCCPEG TC               E +  +  I      P  T E   +            C D   C    TCC L +G +GCCP +  VCC D   CCP G  C  G C   E    LF        +  ++KCD
Sbjct:  305 KKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCSQG------------ECSKMEHSIPWFTKTPALTHEARDVE-----------CDDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGEHSIPLFSKTPALRQETKYVKCD 446          

HSP 3 Score: 62.7734 bits (151), Expect = 1.084e-10
Identity = 45/148 (30.41%), Postives = 61/148 (41.22%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC-IPGSCI 700
            +    C + +TCC    G   CC    AVCC+D  HCCP G TC     +C+          + +  I      P    +   ++           C D   C    TCC L +G +GCCP +  VCC D   CCP G  C   G+C+
Sbjct:  446 DDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGSQCM----------IGEHSIPWFSKTPALKQKAKDVQ-----------CDDMYSCADGQTCCRLASGDWGCCPIAQAVCCSDHWHCCPQGFTCDARGTCV 570          

HSP 4 Score: 62.7734 bits (151), Expect = 1.125e-10
Identity = 47/145 (32.41%), Postives = 61/145 (42.07%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCM-TKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C +    C    TCCM + +    CC    AVCC+D  HCCP  + CD +  RCI  +++ + W                 + + P R   E    + V C DG  C    TCC   +  YGCC     VCC D   CCP G  C
Sbjct:  141 CPDGRSECPTLTTCCMMSDMSSWGCCPMPQAVCCDDHMHCCPHNSECDVQQGRCI-SNQDHIPW-----------------MSKLPARVKSEGDEERRVPCLDGTFCPDGSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTC 267          

HSP 5 Score: 62.3882 bits (150), Expect = 1.379e-10
Identity = 50/142 (35.21%), Postives = 61/142 (42.96%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI 700
            C + +TCC    G   CC    AVCC+D  HCCP G TC     +C  Q  E           H+I    K    R       E+  +K  C D   C    TCC L +G +GCCP +  VCC D   CCP G  C    C+
Sbjct:  377 CPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTC--SGGQC--QKGE-----------HSIPLFSKTPALRQ------ETKYVK--CDDTHSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGSQCM 495          

HSP 6 Score: 49.6766 bits (117), Expect = 2.671e-6
Identity = 37/132 (28.03%), Postives = 50/132 (37.88%), Query Frame = 2
Query:  227 TFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCP 622
              KQ  +D   +    C + +TCC    G   CC    AVCC D  HCCP+G TCD +    + Q   P            +  +P    +           G  ++C D   C    TCC    G + CCP
Sbjct:  509 ALKQKAKDVQCDDMYSCADGQTCCRLASGDWGCCPIAQAVCCSDHWHCCPQGFTCDARGTCVLGQFSIPW-----------LTKVPALPFD-----------GTHSICDDTHTCPSGTTCCPGEGGGWRCCP 618          
BLAST of Granulin b vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 76.2554 bits (186), Expect = 2.100e-15
Identity = 56/167 (33.53%), Postives = 69/167 (41.32%), Query Frame = 2
Query:  200 YDITTDGVTTFKQVDED----GCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHA-IKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +  + DG + F+  D       C  S   C +  TCC+   G   CC    A CCED  HCCP G +CD  + RC           VS    H  +K  P     R+       S+    VCPD   +C    TCC L  G YGCCP    +CC D   CCP    C
Sbjct:  116 FHCSADGKSCFQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRC-----------VSPTGTHTLLKKFPAQKTNRA------VSLPFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVC 265          

HSP 2 Score: 73.1738 bits (178), Expect = 2.555e-14
Identity = 46/143 (32.17%), Postives = 65/143 (45.45%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C ++   C +  TCC    GK  CC   NA+CC D  HCCP+ T CD    +C+ ++               +  +P Y V+            ++  CP+G       TCC L  G +GCCP++  VCC D   CCP G +C
Sbjct:  220 CPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNY----------TTDLLTKLPGYPVKEV-------KCDMEVSCPEG------YTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQC 339          

HSP 3 Score: 71.2478 bits (173), Expect = 1.257e-13
Identity = 54/153 (35.29%), Postives = 70/153 (45.75%), Query Frame = 2
Query:  224 TTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            TT  Q+ + GC + +  C   +TCC +  G   CCQ  +AVCCED  HCCP G TC+ K + C             +  +  I+  P   +   P     E       C +G  C    TCC  + G + CCPY  GVCC D R CCP G  C
Sbjct:  445 TTPLQIGDIGC-DQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTC-------------EKDVDFIQ--PPVLLTLGPKVGNVE-------CGEGHFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGGFHC 574          

HSP 4 Score: 70.8626 bits (172), Expect = 1.665e-13
Identity = 54/163 (33.13%), Postives = 68/163 (41.72%), Query Frame = 2
Query:  203 DITTDGVTTFKQVDEDGCKNSNKI-CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCI 685
            + TTD +T          K   ++ C E  TCC    G   CC +  AVCCED  HCCP G  C T+   C                   I  +P      +PLR     I   +  C D  +C    TCC L +G +GCCP    VCC D + CCP G  C+
Sbjct:  276 NYTTDLLTKLPGYPVKEVKCDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTC----------------EMGILQVPWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTCL 422          

HSP 5 Score: 60.8474 bits (146), Expect = 3.457e-10
Identity = 41/145 (28.28%), Postives = 57/145 (39.31%), Query Frame = 2
Query:  248 DGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            DG   ++  C    +C +T  G   CC ++  V C D  HCCP+G  C    K C   S  P+                             +  G +  CPD        TCC++ +G +GCCP     CC D+  CCP+G  C
Sbjct:   71 DGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSCFQMSDNPLGAV--------------------------QCPGSQFECPDSA------TCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASC 183          

HSP 6 Score: 55.0694 bits (131), Expect = 2.719e-8
Identity = 42/136 (30.88%), Postives = 53/136 (38.97%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C    TCC    G   CC    AVCC D  HCCP+G TC  +                 D  +  ++ IP    + +PL+           CP G       TCC    G + CC     VCC D++ CCP G  C
Sbjct:  383 CPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTCLAQGY-----------CQKGDTMVAGLEKIPAR--QTTPLQIGDIGCDQHTSCPVG------QTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTC 499          
BLAST of Granulin b vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 71.633 bits (174), Expect = 2.309e-14
Identity = 55/154 (35.71%), Postives = 72/154 (46.75%), Query Frame = 2
Query:  224 TTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            TT  Q+ + GC + +  C   +TCC +  G   CCQ  +AVCCED  HCCP G TC+ K + C             +  +  I+  P   +   P         + NV C +G  C    TCC  + G + CCPY  GVCC D R CCP G  C
Sbjct:   90 TTPLQIGDIGC-DQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTC-------------EKDVDFIQ--PPVLLTLGP--------KVGNVECGEGHFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGGFHC 219          
BLAST of Granulin b vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 62.3882 bits (150), Expect = 2.296e-11
Identity = 41/145 (28.28%), Postives = 57/145 (39.31%), Query Frame = 2
Query:  248 DGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            DG   ++  C    +C +T  G   CC ++  V C D  HCCP+G  C    K C   S  P+                             +  G +  CPD        TCC++ +G +GCCP     CC D+  CCP+G  C
Sbjct:   58 DGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSCFQMSDNPLGAV--------------------------QCPGSQFECPDSA------TCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASC 170          

HSP 2 Score: 51.2174 bits (121), Expect = 1.995e-7
Identity = 38/125 (30.40%), Postives = 49/125 (39.20%), Query Frame = 2
Query:  200 YDITTDGVTTFKQVDED----GCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHA-IKAIPKYTVERSPLREWYESIGLKNVCPDG 559
            +  + DG + F+  D       C  S   C +  TCC+   G   CC    A CCED  HCCP G +CD  + RC           VS    H  +K  P     R+       S+    VCPD 
Sbjct:  103 FHCSADGKSCFQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRC-----------VSPTGTHTLLKKFPAQKTNRA------VSLPFSVVCPDA 210          
BLAST of Granulin b vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 53.9138 bits (128), Expect = 4.713e-8
Identity = 42/136 (30.88%), Postives = 53/136 (38.97%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C    TCC    G   CC    AVCC D  HCCP+G TC  +                 D  +  ++ IP    + +PL+           CP G       TCC    G + CC     VCC D++ CCP G  C
Sbjct:    5 CPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTCLAQGY-----------CQKGDTMVAGLEKIPAR--QTTPLQIGDIGCDQHTSCPVGQ------TCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTC 121          

HSP 2 Score: 53.5286 bits (127), Expect = 7.083e-8
Identity = 44/135 (32.59%), Postives = 61/135 (45.19%), Query Frame = 2
Query:  224 TTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPY 625
            TT  Q+ + GC + +  C   +TCC +  G   CCQ  +AVCCED  HCCP G TC+ K + C             +  +  I+  P   +   P         + NV C +G  C    TCC  + G + CCPY
Sbjct:   67 TTPLQIGDIGC-DQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTC-------------EKDVDFIQ--PPVLLTLGP--------KVGNVECGEGHFCHDNQTCCKDSAGVWACCPY 177          
BLAST of Granulin b vs. UniProt/SwissProt
Match: sp|P28797|GRN_CAVPO (Progranulin OS=Cavia porcellus OX=10141 GN=GRN PE=1 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 4.500e-17
Identity = 51/159 (32.08%), Postives = 72/159 (45.28%), Query Frame = 2
Query:  206 ITTDGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            + + G+          C +S   C +  TCC+   G+  CC   NA+CC D  HCCP+ T CD +  RC+ Q+K              +  +P +TV       W      +  CP+G       TCC L +G +GCCP+   VCC D   CCP G +C
Sbjct:  206 VVSPGLLPAALPTSVICPDSRSQCPDDTTCCLLASGEYGCCPMPNAICCSDHLHCCPQDTVCDLRQSRCLSQNKAKT----------LLTKLPSWTV-------WDVECDQEVSCPEG------QTCCRLQSGKWGCCPFPKAVCCEDHVHCCPEGFRC 341          

HSP 2 Score: 78.1814 bits (191), Expect = 3.000e-15
Identity = 54/172 (31.40%), Postives = 73/172 (42.44%), Query Frame = 2
Query:  188 CIFVYDITTDGVTTFKQVD-----EDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQ-SKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDG-GKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C + +  +TDG T  ++ D        C      C +  TCC    G   CC    A CCED  HCCP G +CD  + RC+      P+   +   + +   A     V    L     ++    +CPD   +C    TCCLL +G YGCCP    +CC D   CCP    C
Sbjct:   99 CPYGFHCSTDGGTCIQRPDIHLLGAVQCPGGEFECPDSSTCCHMLDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHIRCVTALGSHPLTTKLPAQRTNYTGAEGTPVVSPGLLP---AALPTSVICPDSRSQCPDDTTCCLLASGEYGCCPMPNAICCSDHLHCCPQDTVC 267          

HSP 3 Score: 72.4034 bits (176), Expect = 3.551e-13
Identity = 51/154 (33.12%), Postives = 67/154 (43.51%), Query Frame = 2
Query:  221 VTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            + +  Q  + GC + +  C   +TCC    G   CCQ  +AVCCED  HCCP G TC+ K + C            + D  H            +PL        +   C D   C    TCC  + G + CCP+  GVCC D+R CCP G  C
Sbjct:  444 LMSLSQTTDVGC-DQHASCPVGQTCCPKLGGGWACCQLPHAVCCEDGQHCCPAGYTCNVKARSC----------EKAADGAHLA----------APLAVGSTGGVMDVACGDRHFCHDEQTCCRDSRGGWACCPFHQGVCCKDQRHCCPAGFHC 576          

HSP 4 Score: 58.9214 bits (141), Expect = 9.182e-9
Identity = 42/141 (29.79%), Postives = 57/141 (40.43%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
             S   C    +C +T  G   CC ++ A+ C D  HCCP G  C T    CI +             IH + A+              +  G +  CPD        TCC + +G +GCCP     CC D+  CCP+G  C
Sbjct:   62 QSPANCPIGHSCVLTAAGTAACCPFSQAMACGDGHHCCPYGFHCSTDGGTCIQRP-----------DIHLLGAV--------------QCPGGEFECPDSS------TCCHMLDGSWGCCPMPQASCCEDRVHCCPHGASC 171          

HSP 5 Score: 53.9138 bits (128), Expect = 5.184e-7
Identity = 44/125 (35.20%), Postives = 55/125 (44.00%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKN--VCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCC 643
            C E +TCC  + GK  CC +  AVCCED  HCCPEG  C T+   C  Q    + W     K  A  + P       P         L++   C +   C     CC L +G +GCCP S G  C
Sbjct:  303 CPEGQTCCRLQSGKWGCCPFPKAVCCEDHVHCCPEGFRCHTEKDTC-EQGLLQVPWA---QKTPAQPSRPSQPSPPGPPGPPSPPGPLRSEISCDEVVSCAPGNICCRLASGEWGCCPSSEGYLC 423          
BLAST of Granulin b vs. UniProt/SwissProt
Match: sp|P28799|GRN_HUMAN (Progranulin OS=Homo sapiens OX=9606 GN=GRN PE=1 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 1.568e-16
Identity = 61/184 (33.15%), Postives = 83/184 (45.11%), Query Frame = 2
Query:  143 FLMKCPSLFLCALFL--CIFVYDITTDGVTTFKQVDEDGCKNSNKI-CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCI 685
             L  CP   +C L    C+   + TTD +T          K   ++ C +  TCC  + G   CC +T AVCCED  HCCP G TCDT+   C  Q    + W    +K  A  ++P             +++     C +   C    TCC LT+G +GCCP    VCC D + CCP G  C+
Sbjct:  243 HLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTC-EQGPHQVPWM---EKAPAHLSLPD-----------PQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCV 411          

HSP 2 Score: 80.8777 bits (198), Expect = 3.773e-16
Identity = 52/143 (36.36%), Postives = 69/143 (48.25%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCI 685
            + +  C   +TCC +  G   CCQ  +AVCCED  HCCP G TC+ K + C               +   + A P   + RSP       +G+K+V C +G  C    TCC      + CCPY  GVCC D+R CCP G +C 
Sbjct:  445 DQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSC---------------EKEVVSAQPATFLARSP------HVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCA 566          

HSP 3 Score: 73.9442 bits (180), Expect = 8.001e-14
Identity = 60/198 (30.30%), Postives = 80/198 (40.40%), Query Frame = 2
Query:  200 YDITTDGVTTFKQVDEDG-----CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNG-------RKCIPGSCI*FELY*RLFLDQIGFMKCD 757
            +  + DG + F++   +      C +S   C +  TCC+   G   CC    A CCED  HCCP G  CD  + RCI         T +     A K   + T     L         ++ CPDG       TCC L +G YGCCP     CC D   CCP          KC+       +L  +L    +G +KCD
Sbjct:  103 FHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCI---------TPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGS------TCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCD 285          

HSP 4 Score: 73.1738 bits (178), Expect = 1.933e-13
Identity = 50/143 (34.97%), Postives = 66/143 (46.15%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C ++   C +  TCC    GK  CC   NA CC D  HCCP+ T CD    +C+  SKE       +     +  +P +TV             ++  CPDG       TCC L +G +GCCP++  VCC D   CCP G  C
Sbjct:  208 CPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCL--SKE-------NATTDLLTKLPAHTVGDV-------KCDMEVSCPDG------YTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTC 328          

HSP 5 Score: 59.3066 bits (142), Expect = 8.626e-9
Identity = 40/140 (28.57%), Postives = 57/140 (40.71%), Query Frame = 2
Query:  266 NKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +  C    +C  T  G   CC +  AV C D  HCCP G  C    + C  +S         ++ + AI+                        CPD   +C  + TCC++ +G +GCCP     CC D+  CCP+G  C
Sbjct:   64 DAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRS--------GNNSVGAIQ------------------------CPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFC 171          
BLAST of Granulin b vs. UniProt/SwissProt
Match: sp|P23785|GRN_RAT (Progranulin OS=Rattus norvegicus OX=10116 GN=Grn PE=1 SV=3)

HSP 1 Score: 80.4925 bits (197), Expect = 5.857e-16
Identity = 55/163 (33.74%), Postives = 70/163 (42.94%), Query Frame = 2
Query:  194 FVYDITTDGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            F    T   V +F  V    C ++   C +  TCC    GK  CC   NA+CC D  HCCP+ T CD    +CI +          D     +  +P Y V             L+  CPDG       TCC L  G +GCCP++  VCC D   CCP G +C
Sbjct:  190 FPAQRTNRAVASFSVV----CPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCISK----------DYTTDLMTKLPGYPVNEV-------KCDLEVSCPDG------YTCCRLNTGAWGCCPFTKAVCCEDHIHCCPAGFQC 325          

HSP 2 Score: 74.7146 bits (182), Expect = 4.539e-14
Identity = 54/162 (33.33%), Postives = 75/162 (46.30%), Query Frame = 2
Query:  203 DITTDGVTTFKQVDEDGCKNSNKI-CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCI 685
            D TTD +T       +  K   ++ C +  TCC    G   CC +T AVCCED  HCCP G  C T+   C     + + W     K+ A  ++P   + ++ +            C D   C    TCC L++G +GCCP    VCC D + CCP G KC+
Sbjct:  262 DYTTDLMTKLPGYPVNEVKCDLEVSCPDGYTCCRLNTGAWGCCPFTKAVCCEDHIHCCPAGFQCHTETGTCELGVLQ-VPWM---KKVTASLSLPDPQILKNDVP-----------CDDFSSCPSNNTCCRLSSGDWGCCPMPEAVCCLDHQHCCPQGFKCM 408          

HSP 3 Score: 72.4034 bits (176), Expect = 3.289e-13
Identity = 50/145 (34.48%), Postives = 60/145 (41.38%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQS-KEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDG-GKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C  S   C +  TCC+   G   CC    A CCED  HCCP G +CD  + RCI  +   P+           +K  P     R+             VCPD   +C    TCC L  G YGCCP    +CC D   CCP    C
Sbjct:  125 CPGSQFECPDSATCCIMIDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCISPTGTHPL-----------LKKFPAQRTNRA-------VASFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVC 251          

HSP 4 Score: 68.9366 bits (167), Expect = 5.155e-12
Identity = 54/154 (35.06%), Postives = 70/154 (45.45%), Query Frame = 2
Query:  224 TTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            TT  Q  + GC + +  C   +TCC +  G   CCQ  +AVCCED  HCCP G TC+ K + C   +                      +V+ S    +   +G  NV C  G  C    +CC  + G + CCPY  GVCC D R CCP G  C
Sbjct:  431 TTLLQHGDIGC-DQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDAG---------------------SVQPSMDLTFGSKVG--NVECGAGHFCHDNQSCCKDSQGGWACCPYVKGVCCRDGRHCCPIGFHC 560          

HSP 5 Score: 60.077 bits (144), Expect = 4.065e-9
Identity = 42/145 (28.97%), Postives = 59/145 (40.69%), Query Frame = 2
Query:  248 DGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            DG       C +  +C +T  G   CC ++  V C+D  HCCP G  C    K C           +SD  + A+                 +  G +  CPD        TCC++ +G +GCCP     CC D+  CCP+G  C
Sbjct:   58 DGSCQIRDHCPDGYSCLLTVSGTSSCCPFSEGVSCDDGQHCCPRGFHCSADGKSCSQ---------ISDSLLGAV-----------------QCPGSQFECPDSA------TCCIMIDGSWGCCPMPQASCCEDRVHCCPHGASC 170          
BLAST of Granulin b vs. UniProt/SwissProt
Match: sp|P28798|GRN_MOUSE (Progranulin OS=Mus musculus OX=10090 GN=Grn PE=1 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 1.376e-14
Identity = 56/167 (33.53%), Postives = 69/167 (41.32%), Query Frame = 2
Query:  200 YDITTDGVTTFKQVDED----GCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHA-IKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +  + DG + F+  D       C  S   C +  TCC+   G   CC    A CCED  HCCP G +CD  + RC           VS    H  +K  P     R+       S+    VCPD   +C    TCC L  G YGCCP    +CC D   CCP    C
Sbjct:  103 FHCSADGKSCFQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRC-----------VSPTGTHTLLKKFPAQKTNRA------VSLPFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVC 252          

HSP 2 Score: 73.1738 bits (178), Expect = 1.723e-13
Identity = 46/143 (32.17%), Postives = 65/143 (45.45%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C ++   C +  TCC    GK  CC   NA+CC D  HCCP+ T CD    +C+ ++               +  +P Y V+            ++  CP+G       TCC L  G +GCCP++  VCC D   CCP G +C
Sbjct:  207 CPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNY----------TTDLLTKLPGYPVKEV-------KCDMEVSCPEG------YTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQC 326          

HSP 3 Score: 71.2478 bits (173), Expect = 8.091e-13
Identity = 54/153 (35.29%), Postives = 70/153 (45.75%), Query Frame = 2
Query:  224 TTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            TT  Q+ + GC + +  C   +TCC +  G   CCQ  +AVCCED  HCCP G TC+ K + C             +  +  I+  P   +   P     E       C +G  C    TCC  + G + CCPY  GVCC D R CCP G  C
Sbjct:  432 TTPLQIGDIGC-DQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTC-------------EKDVDFIQ--PPVLLTLGPKVGNVE-------CGEGHFCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGGFHC 561          

HSP 4 Score: 70.8626 bits (172), Expect = 1.062e-12
Identity = 54/163 (33.13%), Postives = 68/163 (41.72%), Query Frame = 2
Query:  203 DITTDGVTTFKQVDEDGCKNSNKI-CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCI 685
            + TTD +T          K   ++ C E  TCC    G   CC +  AVCCED  HCCP G  C T+   C                   I  +P      +PLR     I   +  C D  +C    TCC L +G +GCCP    VCC D + CCP G  C+
Sbjct:  263 NYTTDLLTKLPGYPVKEVKCDMEVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTC----------------EMGILQVPWMKKVIAPLRLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTCL 409          

HSP 5 Score: 60.8474 bits (146), Expect = 2.312e-9
Identity = 41/145 (28.28%), Postives = 57/145 (39.31%), Query Frame = 2
Query:  248 DGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            DG   ++  C    +C +T  G   CC ++  V C D  HCCP+G  C    K C   S  P+                             +  G +  CPD        TCC++ +G +GCCP     CC D+  CCP+G  C
Sbjct:   58 DGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSCFQMSDNPLGAV--------------------------QCPGSQFECPDSA------TCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASC 170          

HSP 6 Score: 55.0694 bits (131), Expect = 1.754e-7
Identity = 42/136 (30.88%), Postives = 53/136 (38.97%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C    TCC    G   CC    AVCC D  HCCP+G TC  +                 D  +  ++ IP    + +PL+           CP G       TCC    G + CC     VCC D++ CCP G  C
Sbjct:  370 CPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTCLAQGY-----------CQKGDTMVAGLEKIPAR--QTTPLQIGDIGCDQHTSCPVG------QTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTC 486          
BLAST of Granulin b vs. UniProt/SwissProt
Match: sp|P80059|PMD1_LOCMI (Pars intercerebralis major peptide D1 OS=Locusta migratoria OX=7004 PE=1 SV=1)

HSP 1 Score: 50.0618 bits (118), Expect = 2.361e-7
Identity = 25/52 (48.08%), Postives = 30/52 (57.69%), Query Frame = 2
Query:  263 SNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIH 418
            + K C   +TCC T  G+  CC Y   VCC D  HCCP GT CD  ++RCI 
Sbjct:    3 TEKTCPGTETCCTTPQGEEGCCPYKEGVCCLDGIHCCPSGTVCDEDHRRCIQ 54          
BLAST of Granulin b vs. TrEMBL
Match: A0A023GCS2 (Putative granulin (Fragment) OS=Amblyomma triste OX=251400 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 3.032e-21
Identity = 58/169 (34.32%), Postives = 83/169 (49.11%), Query Frame = 2
Query:  176 ALFLCIFVYDITTDGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            A+ + +  + I +    ++ Q  EDG      +C ++ TCC    G   CC Y +A CC+D  HCCP    CD  N  C+H S +   +        A+  +P  ++ R   R+    + L   CPDG  C    TCCLL++G YGCCPY    CC D  +CCP G +C
Sbjct:    5 AVIVLVAAFAIASGARVSYNQC-EDG-----NLCPDKTTCCQKVDGNWACCPYESAQCCQDGVHCCPSTYRCDVTNGTCVHASSQERLFGA------ALAPVPPVSI-RDRQRDDVSKLELVP-CPDGSYCNDGQTCCLLSSGGYGCCPYVHAECCSDHASCCPEGYRC 159          
BLAST of Granulin b vs. TrEMBL
Match: A0A226F5G2 (Granulins OS=Folsomia candida OX=158441 GN=Fcan01_03077 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.947e-20
Identity = 57/177 (32.20%), Postives = 85/177 (48.02%), Query Frame = 2
Query:  161 SLFLCALFLCIFVYDITTDGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCI-HQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGL-KNVCPDGGK-CTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
             +F+  L +CI +             V  D C +    C + +TCC    G   CC Y  A CC D  HCCP G+ CDT + RCI ++  EP  WT+        + + +  +    +   + +  + K +C  G + C    TCC L +G +GCCP+   +CCPDK  CCP+G+ C
Sbjct:    6 GVFVVLLHICILI-----------AFVSGDTCPDHKTRCSKTQTCCSDNRGGYGCCPYPGATCCNDGQHCCPHGSKCDTVHSRCIPNEVSEPEWWTMIYKSFTREEWLAQNLITEDGVDSGHNATMVDKKICGGGEQTCPDKYTCCALASGGWGCCPFDGAMCCPDKIHCCPHGKTC 171          

HSP 2 Score: 56.225 bits (134), Expect = 4.809e-6
Identity = 31/73 (42.47%), Postives = 39/73 (53.42%), Query Frame = 2
Query:  206 ITTDGVTTFKQ---VDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCI 415
            IT DGV +      VD+  C    + C ++ TCC    G   CC +  A+CC D  HCCP G TCD K KRC+
Sbjct:  107 ITEDGVDSGHNATMVDKKICGGGEQTCPDKYTCCALASGGWGCCPFDGAMCCPDKIHCCPHGKTCDDKGKRCV 179          
BLAST of Granulin b vs. TrEMBL
Match: A0A131XWJ6 (Putative granulin (Fragment) OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.116e-20
Identity = 52/140 (37.14%), Postives = 71/140 (50.71%), Query Frame = 2
Query:  263 SNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +  +C ++ TCC+   G+  CC Y  AVCC D  HCCPEG  C+  N  C       ++ + +  K+  +      + +  P     ES+     CPDG  C    TCCLL+ G YGCCPY   VCC D  +CCP G +C
Sbjct:   11 NGALCPDRTTCCLQNSGQYGCCPYQFAVCCSDHLHCCPEGYHCNMSNGTC-------LQISTTTKKVETLLTPMVLSPQLGPNAPAVESV----RCPDGNFCQDGQTCCLLSGGRYGCCPYPHAVCCSDHASCCPEGYRC 139          

HSP 2 Score: 56.9954 bits (136), Expect = 3.079e-6
Identity = 40/124 (32.26%), Postives = 57/124 (45.97%), Query Frame = 2
Query:  239 VDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHY 610
            V+   C + N  C + +TCC+   G+  CC Y +AVCC D + CCPEG  C      C+            +  +  +K +   T+  S L E      ++  CPDG  C    TCCLL+ G Y
Sbjct:   90 VESVRCPDGN-FCQDGQTCCLLSGGRYGCCPYPHAVCCSDHASCCPEGYRCKVSTHSCV----------AGNSTLPMLKKLD--TIGGSSLDEPAPVESVR--CPDGNFCQDGQTCCLLSGGRY 198          
BLAST of Granulin b vs. TrEMBL
Match: A0A443S242 (Uncharacterized protein OS=Leptotrombidium deliense OX=299467 GN=B4U80_08821 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 9.329e-20
Identity = 60/144 (41.67%), Postives = 77/144 (53.47%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C +S++   +  TCC  + G   CC   NAVCC D  HCCPEGT CD KN  C+H+ ++ +  ++S       K+I   TVE               +CPDG  +C    TCC L +G YGCCPY  GVCC D+  CCPNG  C
Sbjct:   22 CPDSSQCVDDDSTCCKLRSGHYGCCPLPNAVCCTDGFHCCPEGTKCDEKNGTCVHEMQQ-IRRSLS-------KSISLNTVENI-------------ICPDGKEQCLDSQTCCELQSGQYGCCPYEKGVCCSDEEHCCPNGFAC 144          

HSP 2 Score: 89.3521 bits (220), Expect = 8.490e-18
Identity = 55/159 (34.59%), Postives = 76/159 (47.80%), Query Frame = 2
Query:  227 TFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDG-GKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI 700
            +   V+   C +  + C + +TCC  + G+  CC Y   VCC D  HCCP G  CD ++ RCIHQ     E+  +         +PK       +   + S     +CPD   +C    TCC +  G +GCCP    VCC DK  CCP+G KC  G C+
Sbjct:   90 SLNTVENIICPDGKEQCLDSQTCCELQSGQYGCCPYEKGVCCSDEEHCCPNGFACDVRHSRCIHQ-----EFNTA--------IVPK-------MLARFNSTISSVICPDKTSQCPDGNTCCQMEGGEWGCCPLESAVCCEDKVHCCPHGTKCAEGGCV 228          
BLAST of Granulin b vs. TrEMBL
Match: A0A0B2W2D5 (Granulin (Fragment) OS=Toxocara canis OX=6265 GN=Grn PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.917e-19
Identity = 58/148 (39.19%), Postives = 70/148 (47.30%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSC 697
            C +    C +  TCC    G+  CC   +AVCCED  HCCPEGT CD ++  C  Q +  + W     K HA K   K  V   P           N+C DG KCT    CC   +G Y CCP   G+CC   + CCP G KC  G C
Sbjct:  136 CPDHRTKCDDDATCCALGQGRYGCCPMPDAVCCEDHLHCCPEGTECDVEHGMCHSQERGAIMWW---KKQHAAKIGQKAAVRTKP---------ASNICTDGTKCTATNKCCEAEDGSYSCCPLKNGLCCKGAQFCCPRGYKCDEGQC 271          

HSP 2 Score: 82.8037 bits (203), Expect = 1.349e-14
Identity = 57/167 (34.13%), Postives = 72/167 (43.11%), Query Frame = 2
Query:  194 FVYDITTDGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKN---VCPDG-GKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
             +  + +  +     V    C +    C +  TCC+   G   CC   NAVCCED  HCCPE T CD + +RC           VS D +             S +R   ++  +K    VCPD   KC    TCC L  G YGCCP    VCC D   CCP G +C
Sbjct:   38 LLVSLVSAVIVAVSIVKARVCPDGRSACDDTTTCCLADEGVYGCCPLPNAVCCEDYLHCCPEKTRCDVQAQRC-----------VSPDGL------------SSQIRRKQQARQIKAKFVVCPDHRTKCDDDATCCALGQGRYGCCPMPDAVCCEDHLHCCPEGTEC 181          

HSP 3 Score: 56.9954 bits (136), Expect = 9.267e-6
Identity = 44/143 (30.77%), Postives = 58/143 (40.56%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNG----HYGCCPYSFGVCCPDKRTCCPNGRKCIPG 691
            C     CC  + G   CC   N +CC+    CCP G  CD    +C    +E +              + K  +E SP  E  +   +  +C DG  C     CC   N     +Y CCP   GVCC  + TCCP G +C  G
Sbjct:  228 CTATNKCCEAEDGSYSCCPLKNGLCCKGAQFCCPRGYKCD--EGQCYRDDEETV--------------VSKLAIETSPASEDTDEDSV--LCADGSACPSTNKCCRSKNNDGSVYYSCCPLRKGVCC--EHTCCPRGYQCAEG 350          
BLAST of Granulin b vs. Ensembl Cavefish
Match: grnb (granulins-like [Source:NCBI gene;Acc:103046308])

HSP 1 Score: 81.2629 bits (199), Expect = 3.501e-17
Identity = 52/138 (37.68%), Postives = 69/138 (50.00%), Query Frame = 2
Query:  272 ICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDG-GKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +C +  TCC T  G   CC   NA CC D  HCC EGT CD ++ +C++++   ++W                 V R P+R+   S+    VCPD   +C    TCC L +G +GCCP    VCC DK  CCP G  C
Sbjct:   25 MCDDGNTCCQTPSGGYGCCPLPNAECCSDHLHCCHEGTLCDLEHSKCVNKTHT-LDW-----------------VMRVPIRQ--PSLPQAVVCPDQESECPDDTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTC 142          

HSP 2 Score: 80.8777 bits (198), Expect = 4.871e-17
Identity = 53/148 (35.81%), Postives = 64/148 (43.24%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV----CPDG-GKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C +    C +  TCC    G   CC   NAVCCED  HCCP+GTTCD  + +C+               +   +  P Y       R+    + L +     CPD    C    TCC L NG YGCCP    VCC D   CCP G  C
Sbjct:   97 CPDQESECPDDTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSML---------GSVPLRRKFPAYKRAEWKARKDSNGLDLADSNDVDCPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSC 235          

HSP 3 Score: 70.8626 bits (172), Expect = 1.123e-13
Identity = 52/164 (31.71%), Postives = 72/164 (43.90%), Query Frame = 2
Query:  212 TDGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQS-KEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI 700
            ++G+      D D C +    C +  TCC    G   CC    AVCC D  HCCP+GT+CD  + +C+  +  EP+   +S      ++   K TVE  P             C +   C    TCC   +G + CCP    VCC D   CCP G  C   +C+
Sbjct:  177 SNGLDLADSNDVD-CPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSNVLEPVTTNLSP----VVRV--KVTVESVP-------------CNESVACESGSTCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVCARSTCV 320          

HSP 4 Score: 69.707 bits (169), Expect = 2.732e-13
Identity = 50/144 (34.72%), Postives = 64/144 (44.44%), Query Frame = 2
Query:  260 NSNKICGEQKTCC-MTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYE-SIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            ++   C    TCC M K  K  CC    AVCC D  HCCP   TCDT    C+    E                IP +  + + + +  E + G+ +V C    +C    TCC LT G +GCCP+   VCC D   CCP G  C
Sbjct:  528 DAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLKGHLE----------------IPWFKKQEAKVTQGSEVAHGVADVQCDSTARCPTGSTCCRLTTGQWGCCPHVQAVCCDDHVHCCPAGYTC 655          

HSP 5 Score: 69.707 bits (169), Expect = 2.972e-13
Identity = 45/143 (31.47%), Postives = 62/143 (43.36%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIP 688
            +S   C    TCC    G+  CC +  AVCC+D  HCCP G TCD +   C+  S            +H +     +T  +  +           +C     CT   TCC L++  + CCP+   VCC D + CCP G  C P
Sbjct:  612 DSTARCPTGSTCCRLTTGQWGCCPHVQAVCCDDHVHCCPAGYTCDLQAGTCLRTS-----------TLHTVALTLVHTHTKEQV-----------MCDATSHCTESQTCCKLSDTEWACCPFKQAVCCKDMKHCCPVGYVCDP 732          

HSP 6 Score: 65.855 bits (159), Expect = 5.939e-12
Identity = 43/142 (30.28%), Postives = 57/142 (40.14%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTN-GHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +    C    TCC  K G   CC    AVCC+D  HCCP+G  CD  ++ C H     M W      + ++         ++        +  K+ C     C    TCC +     +GCCP    VCC D   CCPN   C
Sbjct:  432 DETSACPTGTTCCRQKSGAWACCPLPQAVCCDDHEHCCPQGYKCDIIHESCDHPFLPSMLWFKKQPALQSMTQQSNANA-KAIAESAVADVESKHKCDAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTC 572          

HSP 7 Score: 65.4698 bits (158), Expect = 7.155e-12
Identity = 51/190 (26.84%), Postives = 71/190 (37.37%), Query Frame = 2
Query:  137 EVFLMKCPSLFLCALFLCIFVYDITT--------DGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            E  +  CP   +CA   C+   D+ T          +    Q   + C +    C +  TCC  + G   CC    AVCCED  HCCP  T C+     C          T     +  ++  P  ++  +            + C +   C    TCC   +G + CCP    VCC D   CCP G KC
Sbjct:  302 EDHIHCCPQGTVCARSTCVASADLLTLVRWVEKKPTINRVPQPANEKC-DPTTTCPKGATCCKMESGTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTC----DSAFSGTAGQLSVPWVRKTPATSLPPA-----------NDQCDETSACPTGTTCCRQKSGAWACCPLPQAVCCDDHEHCCPQGYKC 475          

HSP 8 Score: 47.7506 bits (112), Expect = 6.352e-6
Identity = 31/94 (32.98%), Postives = 43/94 (45.74%), Query Frame = 2
Query:  155 CPSLFLCALFL--CIFVYDITTDGVTTFK-QVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSK 427
            CP+ + C L    C+    + T  +T       E    ++   C E +TCC     +  CC +  AVCC+DM HCCP G  CD K K C   + 
Sbjct:  649 CPAGYTCDLQAGTCLRTSTLHTVALTLVHTHTKEQVMCDATSHCTESQTCCKLSDTEWACCPFKQAVCCKDMKHCCPVGYVCDPKAKGCARATS 742          
BLAST of Granulin b vs. Ensembl Cavefish
Match: grnb (granulins-like [Source:NCBI gene;Acc:103046308])

HSP 1 Score: 81.2629 bits (199), Expect = 3.501e-17
Identity = 52/138 (37.68%), Postives = 69/138 (50.00%), Query Frame = 2
Query:  272 ICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDG-GKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +C +  TCC T  G   CC   NA CC D  HCC EGT CD ++ +C++++   ++W                 V R P+R+   S+    VCPD   +C    TCC L +G +GCCP    VCC DK  CCP G  C
Sbjct:   25 MCDDGNTCCQTPSGGYGCCPLPNAECCSDHLHCCHEGTLCDLEHSKCVNKTHT-LDW-----------------VMRVPIRQ--PSLPQAVVCPDQESECPDDTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTC 142          

HSP 2 Score: 80.8777 bits (198), Expect = 4.871e-17
Identity = 53/148 (35.81%), Postives = 64/148 (43.24%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV----CPDG-GKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C +    C +  TCC    G   CC   NAVCCED  HCCP+GTTCD  + +C+               +   +  P Y       R+    + L +     CPD    C    TCC L NG YGCCP    VCC D   CCP G  C
Sbjct:   97 CPDQESECPDDTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSML---------GSVPLRRKFPAYKRAEWKARKDSNGLDLADSNDVDCPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSC 235          

HSP 3 Score: 70.8626 bits (172), Expect = 1.123e-13
Identity = 52/164 (31.71%), Postives = 72/164 (43.90%), Query Frame = 2
Query:  212 TDGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQS-KEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI 700
            ++G+      D D C +    C +  TCC    G   CC    AVCC D  HCCP+GT+CD  + +C+  +  EP+   +S      ++   K TVE  P             C +   C    TCC   +G + CCP    VCC D   CCP G  C   +C+
Sbjct:  177 SNGLDLADSNDVD-CPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSNVLEPVTTNLSP----VVRV--KVTVESVP-------------CNESVACESGSTCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVCARSTCV 320          

HSP 4 Score: 69.707 bits (169), Expect = 2.732e-13
Identity = 50/144 (34.72%), Postives = 64/144 (44.44%), Query Frame = 2
Query:  260 NSNKICGEQKTCC-MTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYE-SIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            ++   C    TCC M K  K  CC    AVCC D  HCCP   TCDT    C+    E                IP +  + + + +  E + G+ +V C    +C    TCC LT G +GCCP+   VCC D   CCP G  C
Sbjct:  528 DAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLKGHLE----------------IPWFKKQEAKVTQGSEVAHGVADVQCDSTARCPTGSTCCRLTTGQWGCCPHVQAVCCDDHVHCCPAGYTC 655          

HSP 5 Score: 69.707 bits (169), Expect = 2.972e-13
Identity = 45/143 (31.47%), Postives = 62/143 (43.36%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIP 688
            +S   C    TCC    G+  CC +  AVCC+D  HCCP G TCD +   C+  S            +H +     +T  +  +           +C     CT   TCC L++  + CCP+   VCC D + CCP G  C P
Sbjct:  612 DSTARCPTGSTCCRLTTGQWGCCPHVQAVCCDDHVHCCPAGYTCDLQAGTCLRTS-----------TLHTVALTLVHTHTKEQV-----------MCDATSHCTESQTCCKLSDTEWACCPFKQAVCCKDMKHCCPVGYVCDP 732          

HSP 6 Score: 65.855 bits (159), Expect = 5.939e-12
Identity = 43/142 (30.28%), Postives = 57/142 (40.14%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTN-GHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +    C    TCC  K G   CC    AVCC+D  HCCP+G  CD  ++ C H     M W      + ++         ++        +  K+ C     C    TCC +     +GCCP    VCC D   CCPN   C
Sbjct:  432 DETSACPTGTTCCRQKSGAWACCPLPQAVCCDDHEHCCPQGYKCDIIHESCDHPFLPSMLWFKKQPALQSMTQQSNANA-KAIAESAVADVESKHKCDAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTC 572          

HSP 7 Score: 65.4698 bits (158), Expect = 7.155e-12
Identity = 51/190 (26.84%), Postives = 71/190 (37.37%), Query Frame = 2
Query:  137 EVFLMKCPSLFLCALFLCIFVYDITT--------DGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            E  +  CP   +CA   C+   D+ T          +    Q   + C +    C +  TCC  + G   CC    AVCCED  HCCP  T C+     C          T     +  ++  P  ++  +            + C +   C    TCC   +G + CCP    VCC D   CCP G KC
Sbjct:  302 EDHIHCCPQGTVCARSTCVASADLLTLVRWVEKKPTINRVPQPANEKC-DPTTTCPKGATCCKMESGTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTC----DSAFSGTAGQLSVPWVRKTPATSLPPA-----------NDQCDETSACPTGTTCCRQKSGAWACCPLPQAVCCDDHEHCCPQGYKC 475          

HSP 8 Score: 47.7506 bits (112), Expect = 6.352e-6
Identity = 31/94 (32.98%), Postives = 43/94 (45.74%), Query Frame = 2
Query:  155 CPSLFLCALFL--CIFVYDITTDGVTTFK-QVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSK 427
            CP+ + C L    C+    + T  +T       E    ++   C E +TCC     +  CC +  AVCC+DM HCCP G  CD K K C   + 
Sbjct:  649 CPAGYTCDLQAGTCLRTSTLHTVALTLVHTHTKEQVMCDATSHCTESQTCCKLSDTEWACCPFKQAVCCKDMKHCCPVGYVCDPKAKGCARATS 742          
BLAST of Granulin b vs. Ensembl Cavefish
Match: ENSAMXT00000034465.1 (pep primary_assembly:Astyanax_mexicanus-2.0:23:26782099:26792241:-1 gene:ENSAMXG00000014237.2 transcript:ENSAMXT00000034465.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 3.584e-15
Identity = 48/146 (32.88%), Postives = 64/146 (43.84%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIH-----QSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +S+  C +  TCC T  G+  CC Y    CC D  HCCP G  CD+ + RC+      +S  P    +  +K +  +  P   V   P  +     G+   C     C    TCC    G +GCCPY  G CC D + CC  G  C
Sbjct:  213 DSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALSIRSSSPQPAMLIQNKQYLQEDQPAPLVPLEPALDNQVQEGVIR-CNGRFYCPAEYTCCQAPTGEWGCCPYKLGQCCKDGKHCCEFGYNC 357          

HSP 2 Score: 73.9442 bits (180), Expect = 7.857e-15
Identity = 53/154 (34.42%), Postives = 70/154 (45.45%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIH-----QSKEPMEWTVSDDKIHAIKAI---PKYTV-----ERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +S+  C +  TCC T  G+  CC Y    CC D  HCCP G  CD+ + RC+      +S  P    +  +K  A++     P  TV     + SP+     S      CPDG       TCC    G + CCPY+ G CC D   CCP+G  C
Sbjct:  113 DSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALSIRSSSPQPAMLIQNKQKAVEETEEKPSATVVELSDDSSPMVHCDSSY----TCPDG------TTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHC 256          

HSP 3 Score: 67.781 bits (164), Expect = 1.098e-12
Identity = 52/171 (30.41%), Postives = 75/171 (43.86%), Query Frame = 2
Query:  191 IFVYDITTDGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKR-CIHQSKE------PMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            I V  +   G+ +      DG       C +  TCC+T  G   CC   NAVCC    +CCP+G  CD  + + C+ Q         P++  V + +     ++ + + + SP+     S      CPDG       TCC    G + CCPY+ G CC D   CCP+G  C
Sbjct:    2 IVVLVLLMAGLVSSDITCPDG-----HTCPDNNTCCLTDQGY-ACCPAPNAVCCPGQEYCCPQGYKCDPSSPQGCVKQGLPWYDIFMPLQKAVEETEEKPSTSVVELSDDSSPMVHCDSSY----TCPDG------TTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHC 156          

HSP 4 Score: 48.1358 bits (113), Expect = 3.745e-6
Identity = 26/50 (52.00%), Postives = 27/50 (54.00%), Query Frame = 2
Query:  545 VCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGS 694
             CPDG  C    TCCL   G Y CCP    VCCP +  CCP G KC P S
Sbjct:   18 TCPDGHTCPDNNTCCLTDQG-YACCPAPNAVCCPGQEYCCPQGYKCDPSS 66          
BLAST of Granulin b vs. Ensembl Cavefish
Match: ENSAMXT00000030959.1 (pep primary_assembly:Astyanax_mexicanus-2.0:23:26782099:26792241:-1 gene:ENSAMXG00000014237.2 transcript:ENSAMXT00000030959.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 3.584e-15
Identity = 48/146 (32.88%), Postives = 64/146 (43.84%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIH-----QSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +S+  C +  TCC T  G+  CC Y    CC D  HCCP G  CD+ + RC+      +S  P    +  +K +  +  P   V   P  +     G+   C     C    TCC    G +GCCPY  G CC D + CC  G  C
Sbjct:  213 DSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALSIRSSSPQPAMLIQNKQYLQEDQPAPLVPLEPALDNQVQEGVIR-CNGRFYCPAEYTCCQAPTGEWGCCPYKLGQCCKDGKHCCEFGYNC 357          

HSP 2 Score: 73.1738 bits (178), Expect = 1.231e-14
Identity = 52/150 (34.67%), Postives = 67/150 (44.67%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIH-----QSKEPMEWTVSDDKIHAIKAI---PKYT-VERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +S+  C +  TCC T  G+  CC Y    CC D  HCCP G  CD+ + RC+      +S  P    +  +K  A++     P  T VE S              CPDG       TCC    G + CCPY+ G CC D   CCP+G  C
Sbjct:  113 DSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALSIRSSSPQPAMLIQNKQKAVEETEEKPSATLVELSGDSSPMVHCDSSYTCPDG------TTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHC 256          

HSP 3 Score: 67.781 bits (164), Expect = 9.898e-13
Identity = 52/171 (30.41%), Postives = 75/171 (43.86%), Query Frame = 2
Query:  191 IFVYDITTDGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKR-CIHQSKE------PMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            I V  +   G+ +      DG       C +  TCC+T  G   CC   NAVCC    +CCP+G  CD  + + C+ Q         P++  V + +     ++ + + + SP+     S      CPDG       TCC    G + CCPY+ G CC D   CCP+G  C
Sbjct:    2 IVVLVLLMAGLVSSDITCPDG-----HTCPDNNTCCLTDQGY-ACCPAPNAVCCPGQEYCCPQGYKCDPSSPQGCVKQGLPWYDIFMPLQKAVEETEEKPSTSVVELSDDSSPMVHCDSSY----TCPDG------TTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHC 156          

HSP 4 Score: 47.7506 bits (112), Expect = 4.179e-6
Identity = 26/50 (52.00%), Postives = 27/50 (54.00%), Query Frame = 2
Query:  545 VCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGS 694
             CPDG  C    TCCL   G Y CCP    VCCP +  CCP G KC P S
Sbjct:   18 TCPDGHTCPDNNTCCLTDQG-YACCPAPNAVCCPGQEYCCPQGYKCDPSS 66          
BLAST of Granulin b vs. Ensembl Cavefish
Match: ENSAMXT00000057729.1 (pep primary_assembly:Astyanax_mexicanus-2.0:23:26782099:26792241:-1 gene:ENSAMXG00000014237.2 transcript:ENSAMXT00000057729.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 3.584e-15
Identity = 48/146 (32.88%), Postives = 64/146 (43.84%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIH-----QSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +S+  C +  TCC T  G+  CC Y    CC D  HCCP G  CD+ + RC+      +S  P    +  +K +  +  P   V   P  +     G+   C     C    TCC    G +GCCPY  G CC D + CC  G  C
Sbjct:  213 DSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALSIRSSSPQPAMLIQNKQYLQEDQPAPLVPLEPALDNQVQEGVIR-CNGRFYCPAEYTCCQAPTGEWGCCPYKLGQCCKDGKHCCEFGYNC 357          

HSP 2 Score: 73.1738 bits (178), Expect = 1.231e-14
Identity = 52/150 (34.67%), Postives = 67/150 (44.67%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIH-----QSKEPMEWTVSDDKIHAIKAI---PKYT-VERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +S+  C +  TCC T  G+  CC Y    CC D  HCCP G  CD+ + RC+      +S  P    +  +K  A++     P  T VE S              CPDG       TCC    G + CCPY+ G CC D   CCP+G  C
Sbjct:  113 DSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQGALSIRSSSPQPAMLIQNKQKAVEETEEKPSATLVELSGDSSPMVHCDSSYTCPDG------TTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHC 256          

HSP 3 Score: 67.781 bits (164), Expect = 9.898e-13
Identity = 52/171 (30.41%), Postives = 75/171 (43.86%), Query Frame = 2
Query:  191 IFVYDITTDGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKR-CIHQSKE------PMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            I V  +   G+ +      DG       C +  TCC+T  G   CC   NAVCC    +CCP+G  CD  + + C+ Q         P++  V + +     ++ + + + SP+     S      CPDG       TCC    G + CCPY+ G CC D   CCP+G  C
Sbjct:    2 IVVLVLLMAGLVSSDITCPDG-----HTCPDNNTCCLTDQGY-ACCPAPNAVCCPGQEYCCPQGYKCDPSSPQGCVKQGLPWYDIFMPLQKAVEETEEKPSTSVVELSDDSSPMVHCDSSY----TCPDG------TTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHC 156          

HSP 4 Score: 47.7506 bits (112), Expect = 4.179e-6
Identity = 26/50 (52.00%), Postives = 27/50 (54.00%), Query Frame = 2
Query:  545 VCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGS 694
             CPDG  C    TCCL   G Y CCP    VCCP +  CCP G KC P S
Sbjct:   18 TCPDGHTCPDNNTCCLTDQG-YACCPAPNAVCCPGQEYCCPQGYKCDPSS 66          
BLAST of Granulin b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009302.1 (pep scaffold:Pmarinus_7.0:GL483232:1183:11161:1 gene:ENSPMAG00000008413.1 transcript:ENSPMAT00000009302.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 9.873e-17
Identity = 50/136 (36.76%), Postives = 60/136 (44.12%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C +Q TCC T  G   CC    AVCC+D  HCCPEGTTC+     C  Q +  + W+    K  A   +       +  R           CPDG       TCC L  G +GCCP     CC D   CCP+G  C
Sbjct:  610 CPDQTTCCKTGTGDWGCCPLVKAVCCDDHEHCCPEGTTCNVPAGSC-DQGQLSLPWS---SKTPARTRLTALLPASAAARGGSVRCDSAYACPDG------TTCCQLPQGQWGCCPLPLATCCSDFVHCCPSGYTC 735          

HSP 2 Score: 75.485 bits (184), Expect = 6.981e-16
Identity = 48/136 (35.29%), Postives = 63/136 (46.32%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            CG+  TCC    G+  CC   +AVCC D  HCCP+ T CD K  +C+H  K  + W                 V + P ++    +     C     C+   TCC+L +G +GCCP    VCC DK  CCP G  C
Sbjct:   67 CGDDATCCPLASGQYGCCSLEDAVCCSDYLHCCPKNTMCDLKLGKCVH-GKLSIPW-----------------VSKYPSKQAASDV----QCDAFTSCSDQNTCCILPSGQWGCCPLPKAVCCDDKEHCCPEGTIC 180          

HSP 3 Score: 73.9442 bits (180), Expect = 2.344e-15
Identity = 58/183 (31.69%), Postives = 85/183 (46.45%), Query Frame = 2
Query:  143 FLMKCPSLFLCALFLCIFVY-DITTDGVTTF--KQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +L  CP   +C L L   V+  ++   V+ +  KQ   D   ++   C +Q TCC+   G+  CC    AVCC+D  HCCPEGT C+  ++ C H +   + W+     +       + T E + + +  + +G    CPDG       TCC    G + CCP    VCC D   CCP G  C
Sbjct:   95 YLHCCPKNTMCDLKLGKCVHGKLSIPWVSKYPSKQAASDVQCDAFTSCSDQNTCCILPSGQWGCCPLPKAVCCDDKEHCCPEGTICNVTSQTCNHAALS-LPWSTKTPAL-------RMTGEPNDV-QCDDLVG----CPDGN------TCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTC 258          

HSP 4 Score: 72.0182 bits (175), Expect = 9.746e-15
Identity = 47/141 (33.33%), Postives = 63/141 (44.68%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +    C +  TCC T  G   CC    AVCC+D  HCCP+GTTC+   + C  Q    + W+    K  A++   +  V                +C D   C    TCC + +G +GCCP    VCC D + CCP G  C
Sbjct:  293 DDQSSCPDGNTCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTCNLPAQTC-DQGTLSLPWST---KTPALRVAGEPNVV---------------ICDDQSSCPDGNTCCKMPSGDWGCCPLPKAVCCDDHQHCCPEGTTC 414          

HSP 5 Score: 70.4774 bits (171), Expect = 3.025e-14
Identity = 48/141 (34.04%), Postives = 62/141 (43.97%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +    C +  TCC    G   CC    AVCC+D  HCCPEGTTC+   +RC  +    + W+    K  A++   +  V                +C D   C    TCC L +G +GCCP    VCC D   CCP G  C
Sbjct:  371 DDQSSCPDGNTCCKMPSGDWGCCPLPKAVCCDDHQHCCPEGTTCNLPVERC-DKGTLSLPWST---KTPALRVAGEPNVV---------------ICDDQFSCPDGNTCCKLPSGDWGCCPLVKAVCCDDHEHCCPQGTTC 492          

HSP 6 Score: 68.5514 bits (166), Expect = 1.538e-13
Identity = 46/136 (33.82%), Postives = 60/136 (44.12%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C +  TCC    G   CC    AVCC+D  HCCP+GTTC+   + C  Q    + W+    K  A++   +  V                +C D   C    TCC + +G +GCCP    VCC D   CCP G  C
Sbjct:  454 CPDGNTCCKLPSGDWGCCPLVKAVCCDDHEHCCPQGTTCNLPAQTC-DQGTLSLPWST---KTPALRVAGEPNVV---------------ICDDQFSCPDGDTCCKMPSGDWGCCPLVKAVCCDDHEHCCPQGTTC 570          

HSP 7 Score: 67.3958 bits (163), Expect = 3.307e-13
Identity = 46/136 (33.82%), Postives = 58/136 (42.65%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C +  TCC T  G   CC    AVCC+D  HCCP+GTTC+   + C  Q    + W+    K  A++   +  V                +C D   C    TCC    G + CCP    VCC D   CCP G  C
Sbjct:  220 CPDGNTCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTCNLPAQTC-DQGTLSLPWST---KTPALRVAGEPNVV---------------ICDDQSSCPDGNTCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTC 336          

HSP 8 Score: 65.0846 bits (157), Expect = 2.072e-12
Identity = 52/143 (36.36%), Postives = 65/143 (45.45%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC-IP-GSC 697
            C +  TCC    G   CC    AVCC+D  HCCP+GTTC+   + C              DK     ++P ++ +   LR   E   +K  C D   C    TCC    G +GCCP    VCC D   CCP G  C +P GSC
Sbjct:  532 CPDGDTCCKMPSGDWGCCPLVKAVCCDDHEHCCPQGTTCNLPAQTC--------------DK--GALSLP-WSTKTPALRVAGEPNDVK--CDDQVSCPDQTTCCKTGTGDWGCCPLVKAVCCDDHEHCCPEGTTCNVPAGSC 655          

HSP 9 Score: 63.1586 bits (152), Expect = 8.752e-12
Identity = 41/115 (35.65%), Postives = 48/115 (41.74%), Query Frame = 2
Query:  338 NAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
             AVCC D  HCCP GT CD  +  C  + K  + W         ++  P +T      R           CPDG  C    TCC L +G YGCC     VCC D   CCP    C
Sbjct:    1 QAVCCSDGLHCCPSGTVCDLAHGMC-QKGKISVPW---------LEKTPTFTPRTWRWRLARSLAVRPPQCPDGTSCGDDATCCPLASGQYGCCSLEDAVCCSDYLHCCPKNTMC 105          
BLAST of Granulin b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001039.1 (pep scaffold:Pmarinus_7.0:GL484091:11570:24665:-1 gene:ENSPMAG00000000936.1 transcript:ENSPMAT00000001039.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 3.922e-9
Identity = 41/147 (27.89%), Postives = 60/147 (40.82%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI 700
               + C   +TCC ++ G   CC    A CC D  HCCP  T C    + C   S+             A+  +   + E+   ++ Y  +     C  G  C  + TCC    G +GCC      CC D   CCP+  +C+ G C+
Sbjct:   69 GGGQYCRRWQTCCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRCLVPYRLCSRSSE-------------ALSVLDYLSREQ---QDGYNVV----HCGGGQYCRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSMTRCLVGQCV 195          

HSP 2 Score: 53.5286 bits (127), Expect = 1.485e-8
Identity = 47/182 (25.82%), Postives = 70/182 (38.46%), Query Frame = 2
Query:  155 CPSLFLCALFLCI----FVYDITTDGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCI 685
            CPS+  C +  C+     +  +  +   +    D        + C   +TCC ++ G   CC    A CC D  HCCP G + D K + C++ +               I  + K      P       +G   V C  G  C  + TCC    G +GCC      CC D   CCP+  +C+
Sbjct:  335 CPSMTRCLVGQCVNSAALIPWLKKEAALSGPVGDNVVHCGGGQYCRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSGASGDLKGQ-CVNSAA-------------LIPWLKKEAALSGP-------VGDNLVHCGGGQYCRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSMTRCL 495          

HSP 3 Score: 51.9878 bits (123), Expect = 5.256e-8
Identity = 48/187 (25.67%), Postives = 71/187 (37.97%), Query Frame = 2
Query:  155 CPSLFLCALFLCI----FVYDITTDGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI 700
            CPS+  C +  C+     +  +  +   +    D        + C   +TCC ++ G   CC    A CC D  HCCP  T C     +C++ +               I  + K      P       +G   V C  G  C  + TCC    G +GCC      CC D   CCP+  +C+ G C+
Sbjct:  183 CPSMTRCLVGQCVNSAALIPWLKKEAALSGPVGDNVVHCGGGQYCRRWQTCCRSRCGMWGCCNGRRATCCSDGIHCCPSMTRCLV--GQCVNSAA-------------LIPWLKKEAALSGP-------VGDNLVHCGGGQYCRRWQTCCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRCLVGQCV 347          

HSP 4 Score: 48.9062 bits (115), Expect = 4.611e-7
Identity = 37/142 (26.06%), Postives = 50/142 (35.21%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCI 685
               + C   +TCC ++ G   CC    A CC D  HCCP  T C    + C   S+       S    HA+    +    R                        + TCC    G +GCC      CC D   CCP+  +C+
Sbjct:  451 GGGQYCRRWQTCCRSRRGMWGCCNGRRATCCSDGIHCCPSMTRCLVPYRLCSRSSEALSGVAGSSTLSHALPYDSRVYCRR------------------------WQTCCRSRCGMWGCCNGRRATCCSDGIHCCPSMTRCL 568          
BLAST of Granulin b vs. Ensembl Nematostella
Match: EDO27824 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T870])

HSP 1 Score: 70.0922 bits (170), Expect = 1.716e-14
Identity = 52/142 (36.62%), Postives = 63/142 (44.37%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRC-IHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            N    C + +TCC    G   CC   NAVCC D  HCCP G  CD  +  C + +   PM         HA       TV+R+ + E          C DG  C    TCCL+    YGCCP    VCC D + CCP+G  C
Sbjct:   10 NDGSHCYDYETCCELSTGSYGCCPLPNAVCCSDGKHCCPCGYHCDISSSTCDMAKDSTPMV------SYHA-------TVQRAGVGEIK--------CKDGSHCNTGETCCLVGPTKYGCCPLPSAVCCADMQHCCPSGYTC 130          

HSP 2 Score: 67.781 bits (164), Expect = 1.297e-13
Identity = 48/159 (30.19%), Postives = 65/159 (40.88%), Query Frame = 2
Query:  206 ITTDGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            ++         V E  CK+ +  C   +TCC+    K  CC   +AVCC DM HCCP G TC+ K+  C  + +  +        +H   A+ K  V       +    G    C     C  Y TCC  ++    CCP     CC D   CCP G  C
Sbjct:   70 VSYHATVQRAGVGEIKCKDGSH-CNTGETCCLVGPTKYGCCPLPSAVCCADMQHCCPSGYTCNDKSGHC-QRGRHVLPMFQKHPSVHPRPAVAKTPVIIDHTIRFVPRGGRGAGC----ACEPYHTCCGSSSAQQNCCPLPNASCCSDGLHCCPQGFIC 222          

HSP 3 Score: 46.9802 bits (110), Expect = 1.997e-6
Identity = 24/46 (52.17%), Postives = 26/46 (56.52%), Query Frame = 2
Query:  545 VCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
             C DG  C  Y TCC L+ G YGCCP    VCC D + CCP G  C
Sbjct:    8 TCNDGSHCYDYETCCELSTGSYGCCPLPNAVCCSDGKHCCPCGYHC 53          
BLAST of Granulin b vs. Ensembl Medaka
Match: grnb (granulin precursor [Source:NCBI gene;Acc:101166910])

HSP 1 Score: 90.8929 bits (224), Expect = 1.826e-20
Identity = 54/144 (37.50%), Postives = 68/144 (47.22%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDG-GKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C +    C ++ TCC    G   CC +  AVCCED  HCCPEGTTCD  + +C   S +             ++ +P   V   P+     S+    VCP G   C    TCCLLT+G +GCCPY    CC D   CCP    C
Sbjct:   51 CPDQESECPDETTCCQLPDGSWGCCPFPKAVCCEDQRHCCPEGTTCDLVHSKCASPSLQ---------AFPMLQKVPAQRVGTLPVFAAAASV----VCPGGKSSCPNSFTCCLLTSGDFGCCPYPQATCCSDHLHCCPGNTTC 181          

HSP 2 Score: 78.1814 bits (191), Expect = 3.659e-16
Identity = 50/143 (34.97%), Postives = 62/143 (43.36%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C +   +C +  TCC    G   CC   NAVCC D  HCCPEGTTCD  +  C+  +    E  +       +   P  T    P+R           C DG       TCC  + G +GCCP    VCC D   CCP+G  C
Sbjct:  210 CPDQRSMCPDGTTCCQLNNGTFGCCPLPNAVCCSDHMHCCPEGTTCDLAHSTCVSAAGGTAEAVMV-----PVSGTPPKT---HPVRGLAVPCNASVACADGS------TCCRASRGQWGCCPLPEAVCCEDHLHCCPHGTVC 338          

HSP 3 Score: 76.2554 bits (186), Expect = 1.990e-15
Identity = 58/182 (31.87%), Postives = 73/182 (40.11%), Query Frame = 2
Query:  137 EVFLMKCPSLFLCALFLCIFVYDITTDGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            ++   KC S  L A  +   V       +  F       C      C    TCC+   G   CC Y  A CC D  HCCP  TTCD +   C  +S E        + I A+ A P+  +              +++CPDG       TCC L NG +GCCP    VCC D   CCP G  C
Sbjct:   97 DLVHSKCASPSLQAFPMLQKVPAQRVGTLPVFAAAASVVCPGGKSSCPNSFTCCLLTSGDFGCCPYPQATCCSDHLHCCPGNTTCDLERGVC--KSGE-----ARVEPIRAVSASPEDVL----------CPDQRSMCPDG------TTCCQLNNGTFGCCPLPNAVCCSDHMHCCPEGTTC 255          

HSP 4 Score: 71.633 bits (174), Expect = 6.055e-14
Identity = 50/153 (32.68%), Postives = 65/153 (42.48%), Query Frame = 2
Query:  230 FKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQS--KEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            F    E+G  + +  C  + TCC T+ G   CC    AVCC+D  HCCP  T C+ + + C   S    P+ W     ++ A                  E  G   VCP      G  TCC  ++G + CCP    VCC D   CCP G KC
Sbjct:  363 FPYRSENGRCDESASCPGEATCCRTRAGGWACCPLPQAVCCDDHIHCCPNATICNLEAETCDDPSGLSPPLPWLTKRPRLTAGME--------------EEKCGKDAVCP------GRTTCCKNSSGQWACCPLPQAVCCSDLDHCCPKGYKC 495          

HSP 5 Score: 66.2402 bits (160), Expect = 4.617e-12
Identity = 44/151 (29.14%), Postives = 66/151 (43.71%), Query Frame = 2
Query:  239 VDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNG-HYGCCPYSFGVCCPDKRTCCPNGRKCIP 688
            ++E+ C   + +C  + TCC    G+  CC    AVCC D+ HCCP+G  C+  ++ C       + W         + A+ + + +  P         ++N C     C    TCC +     +GCCP    VCC D   CCP G  C P
Sbjct:  446 MEEEKC-GKDAVCPGRTTCCKNSSGQWACCPLPQAVCCSDLDHCCPKGYKCNAFDRTCERPGGPSLPWR------QKLPALQQRSGQTGP---------VENKCDAQTSCPKDTTCCFMEQTLKWGCCPLPQAVCCGDGNHCCPRGHSCQP 580          

HSP 6 Score: 65.855 bits (159), Expect = 5.309e-12
Identity = 45/141 (31.91%), Postives = 56/141 (39.72%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            N++  C +  TCC    G+  CC    AVCCED  HCCP GT C+     C   S   +   +S+         P +       R           C +   C G  TCC    G + CCP    VCC D   CCPN   C
Sbjct:  295 NASVACADGSTCCRASRGQWGCCPLPEAVCCEDHLHCCPHGTVCNLVASTCDDPSGSALTPLLSN--------TPGFPYRSENGR-----------CDESASCPGEATCCRTRAGGWACCPLPQAVCCDDHIHCCPNATIC 416          

HSP 7 Score: 59.3066 bits (142), Expect = 8.726e-10
Identity = 47/167 (28.14%), Postives = 69/167 (41.32%), Query Frame = 2
Query:  191 IFVYDITTDGVTTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG---KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +  +      +T    V +  C N +  C    TCC  + G   CC    AVCC D  HCCP+  TC+ +   C  ++ + +  +        + A P+ T               ++V  DG    KC    TCC ++   +GCCP    VCC D + CCP G  C
Sbjct:  591 VVPWFTKVGALTEPSGVTDVKCDNKSS-CASGTTCCPLQTGGWGCCPLVKAVCCADHEHCCPQSYTCNMQTGTCEKKAGQGLPLS------RVVPAQPQDT---------------QDVPCDGTGEFKCPKQNTCCRISATAWGCCPSPGAVCCMDSKHCCPAGYSC 735          

HSP 8 Score: 58.151 bits (139), Expect = 2.408e-9
Identity = 45/143 (31.47%), Postives = 58/143 (40.56%), Query Frame = 2
Query:  260 NSNKICGEQKTCC-MTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNV-CPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            ++   C +  TCC M +  K  CC    AVCC D +HCCP G +C      C   S                  +P +T     +    E  G+ +V C +   C    TCC L  G +GCCP    VCC D   CCP    C
Sbjct:  534 DAQTSCPKDTTCCFMEQTLKWGCCPLPQAVCCGDGNHCCPRGHSCQPHRSSCSRGS----------------HVVPWFTK----VGALTEPSGVTDVKCDNKSSCASGTTCCPLQTGGWGCCPLVKAVCCADHEHCCPQSYTC 656          
BLAST of Granulin b vs. Ensembl Medaka
Match: grna (granulins [Source:NCBI gene;Acc:101162601])

HSP 1 Score: 75.0998 bits (183), Expect = 4.848e-15
Identity = 48/153 (31.37%), Postives = 67/153 (43.79%), Query Frame = 2
Query:  224 TTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
             +   V  D C N  K C + +TCC +      CC +  A CC D  HCCP+   CD     C + +   M W      +  + A  +   +   +   Y      N+CPD  +C    + CL     YGCCP + GV CPD + CCP G +C
Sbjct:   10 VSLALVAADMCPNGGK-CEKGQTCCQSPSKDYDCCPFDEAECCGDHIHCCPKDMLCDMTTSSCGNATLS-MRW------VERVSANLQMATKSFRMIRSYMGEDEDNICPDQSRCPAEFS-CLKALTRYGCCPLAQGVSCPDGKHCCPEGHQC 153          

HSP 2 Score: 74.7146 bits (182), Expect = 6.305e-15
Identity = 53/171 (30.99%), Postives = 73/171 (42.69%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQS---------------------KEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKN-------VCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            CK+    C ++ TCC  + GK  CC    AVCC+D  HCCPE TTCD +  +C+  S                     KE  E +    + +  K  P+ T   +P+  + E   +          C +   C    TCC    G +GCCP+   VCC D   CCP G+ C
Sbjct:  171 CKDGVSECPDETTCCENQEGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCLSSSDKALPMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTT-ANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 340          

HSP 3 Score: 73.9442 bits (180), Expect = 1.193e-14
Identity = 47/142 (33.10%), Postives = 66/142 (46.48%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            N    C +Q TCC T+ G   CC +  AVCCED  HCCP+G TC+   + C                +  ++ +P ++           S+ +++V  DG   C    TCC    G +GCCP+   VCC D   CCP G+ C
Sbjct:  297 NETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGG----------SVPMLEKVPSFS---------KVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 419          

HSP 4 Score: 73.1738 bits (178), Expect = 1.943e-14
Identity = 51/158 (32.28%), Postives = 74/158 (46.84%), Query Frame = 2
Query:  221 VTTFKQVD---EDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            V +F +V    ED   + +  C +Q TCC T+ G   CC +  AVCCED  HCCP+G TC+   + C                +  ++ +P ++           S+ +++V  DG   C    TCC    G +GCCP+   VCC D   CCP G+ C
Sbjct:  360 VPSFSKVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGG----------SVPMLEKVPSFS---------NVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 498          

HSP 5 Score: 72.7886 bits (177), Expect = 2.574e-14
Identity = 51/158 (32.28%), Postives = 73/158 (46.20%), Query Frame = 2
Query:  221 VTTFKQVD---EDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            V +F  V    ED   + +  C +Q TCC T+ G   CC +  AVCCED  HCCP+G TC+   + C                +  ++ +P ++           S+ +++V  DG   C    TCC    G +GCCP+   VCC D   CCP G+ C
Sbjct:  439 VPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGG----------SVPMLEKVPSFS---------NVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 577          

HSP 6 Score: 72.7886 bits (177), Expect = 2.574e-14
Identity = 51/158 (32.28%), Postives = 73/158 (46.20%), Query Frame = 2
Query:  221 VTTFKQVD---EDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            V +F  V    ED   + +  C +Q TCC T+ G   CC +  AVCCED  HCCP+G TC+   + C                +  ++ +P ++           S+ +++V  DG   C    TCC    G +GCCP+   VCC D   CCP G+ C
Sbjct:  518 VPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGG----------SVPMLEKVPSFS---------NVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 656          

HSP 7 Score: 72.4034 bits (176), Expect = 3.540e-14
Identity = 51/158 (32.28%), Postives = 72/158 (45.57%), Query Frame = 2
Query:  221 VTTFKQVD---EDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            V +F  V    ED   + +  C +Q TCC T+ G   CC +  AVCCED  HCCP+G TC+   + C                +  ++ +P ++           S+ +++V  DG   C    TCC   +G +GCCP    VCC D   CCP G  C
Sbjct:  597 VPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGG----------SVPMLEKVPSFS---------KVSVKMEDVPCDGSTSCPDQTTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTC 735          

HSP 8 Score: 70.8626 bits (172), Expect = 1.184e-13
Identity = 52/143 (36.36%), Postives = 68/143 (47.55%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIP-GSCI 700
            C E  +CC    G+  CC   NAVCC D  HCCPEG TCD  +K C       +E TV    +     +P    +  P++       + N C D   C    TCC  ++  +GCC     VCC D + CCP+G +C   GSCI
Sbjct:  891 CPEHMSCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGYTCDLASKSCHKLLTLQLE-TVPLTPVF----LPDDQSQHGPVKP------ILNRCDDVYSCNVDETCCRTSHTTWGCCLSPKAVCCRDMKHCCPDGYRCTKGGSCI 1022          

HSP 9 Score: 66.2402 bits (160), Expect = 4.510e-12
Identity = 51/162 (31.48%), Postives = 70/162 (43.21%), Query Frame = 2
Query:  215 DGVTTFKQ---VDEDGCK--NSNKICGEQKTCC-MTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            DG   F +    DE+G    +S+  C +  TCC M ++ K  CC    AVCC D  HCCP    C  ++  C+                     IP YT  + P  +  ++      C    +C  +++CC L  G +GCCP    VCC DK  CCP G  C
Sbjct:  786 DGQEDFDEEDKTDEEGIISCDSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKCKEEDTSCVKGEV----------------VIPWYT--KIPATDSIQADSSFVQCSAVHQCPEHMSCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGYTC 929          

HSP 10 Score: 65.4698 bits (158), Expect = 8.814e-12
Identity = 57/175 (32.57%), Postives = 74/175 (42.29%), Query Frame = 2
Query:  221 VTTFKQVD---EDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSK-EPM--EWTVSDDKIHAIKAIPKYTVE------RSPLREWYESIGLKN--------VCPDGGKCTGYLTCCLLTNGH-YGCCPYSFGVCCPDKRTCCPNGRKC 682
            V +F +V    ED   + +  C +Q TCC TK G   CC    AVCC+D  HCCP GTTCD     C+  S   PM  +   S     A   + K   E      +   R+  E    ++         C    +C  + TCC +     +GCCP    VCC D   CCP   KC
Sbjct:  676 VPSFSKVSVKMEDVPCDGSTSCPDQTTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTCDLSTLSCLKASGLVPMSKKLPASTRTSSATSQLMKTGQETEEGENKPDDRDGQEDFDEEDKTDEEGIISCDSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKC 850          

HSP 11 Score: 51.6026 bits (122), Expect = 3.110e-7
Identity = 42/158 (26.58%), Postives = 60/158 (37.97%), Query Frame = 2
Query:  227 TFKQVDEDGCKNSNKICGEQKTC-----CMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDG-GKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +F+ +     ++ + IC +Q  C     C+  + +  CC     V C D  HCCPEG  C   ++ C+              K  +IK +                     +C DG  +C    TCC    G + CCP    VCC DK  CCP    C
Sbjct:   94 SFRMIRSYMGEDEDNICPDQSRCPAEFSCLKALTRYGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSCV--------------KKESIKTV---------------------LCKDGVSECPDETTCCENQEGKWACCPMPKAVCCDDKIHCCPEETTC 216          
BLAST of Granulin b vs. Ensembl Medaka
Match: grna (granulins [Source:NCBI gene;Acc:101162601])

HSP 1 Score: 75.0998 bits (183), Expect = 5.150e-15
Identity = 48/153 (31.37%), Postives = 67/153 (43.79%), Query Frame = 2
Query:  224 TTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
             +   V  D C N  K C + +TCC +      CC +  A CC D  HCCP+   CD     C + +   M W      +  + A  +   +   +   Y      N+CPD  +C    + CL     YGCCP + GV CPD + CCP G +C
Sbjct:   10 VSLALVAADMCPNGGK-CEKGQTCCQSPSKDYDCCPFDEAECCGDHIHCCPKDMLCDMTTSSCGNATLS-MRW------VERVSANLQMATKSFRMIRSYMGEDEDNICPDQSRCPAEFS-CLKALTRYGCCPLAQGVSCPDGKHCCPEGHQC 153          

HSP 2 Score: 74.7146 bits (182), Expect = 6.098e-15
Identity = 53/171 (30.99%), Postives = 73/171 (42.69%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQS---------------------KEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKN-------VCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            CK+    C ++ TCC  + GK  CC    AVCC+D  HCCPE TTCD +  +C+  S                     KE  E +    + +  K  P+ T   +P+  + E   +          C +   C    TCC    G +GCCP+   VCC D   CCP G+ C
Sbjct:  171 CKDGVSECPDETTCCENQEGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCLSSSDKALPMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTT-ANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 340          

HSP 3 Score: 73.9442 bits (180), Expect = 1.221e-14
Identity = 47/142 (33.10%), Postives = 66/142 (46.48%), Query Frame = 2
Query:  260 NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            N    C +Q TCC T+ G   CC +  AVCCED  HCCP+G TC+   + C                +  ++ +P ++           S+ +++V  DG   C    TCC    G +GCCP+   VCC D   CCP G+ C
Sbjct:  297 NETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGG----------SVPMLEKVPSFS---------KVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 419          

HSP 4 Score: 73.1738 bits (178), Expect = 2.007e-14
Identity = 51/158 (32.28%), Postives = 74/158 (46.84%), Query Frame = 2
Query:  221 VTTFKQVD---EDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            V +F +V    ED   + +  C +Q TCC T+ G   CC +  AVCCED  HCCP+G TC+   + C                +  ++ +P ++           S+ +++V  DG   C    TCC    G +GCCP+   VCC D   CCP G+ C
Sbjct:  360 VPSFSKVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGG----------SVPMLEKVPSFS---------NVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 498          

HSP 5 Score: 73.1738 bits (178), Expect = 2.007e-14
Identity = 51/158 (32.28%), Postives = 74/158 (46.84%), Query Frame = 2
Query:  221 VTTFKQVD---EDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            V +F +V    ED   + +  C +Q TCC T+ G   CC +  AVCCED  HCCP+G TC+   + C                +  ++ +P ++           S+ +++V  DG   C    TCC    G +GCCP+   VCC D   CCP G+ C
Sbjct:  597 VPSFSKVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGG----------SVPMLEKVPSFS---------NVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 735          

HSP 6 Score: 72.7886 bits (177), Expect = 2.658e-14
Identity = 51/158 (32.28%), Postives = 73/158 (46.20%), Query Frame = 2
Query:  221 VTTFKQVD---EDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            V +F  V    ED   + +  C +Q TCC T+ G   CC +  AVCCED  HCCP+G TC+   + C                +  ++ +P ++           S+ +++V  DG   C    TCC    G +GCCP+   VCC D   CCP G+ C
Sbjct:  439 VPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGG----------SVPMLEKVPSFS---------NVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 577          

HSP 7 Score: 72.7886 bits (177), Expect = 2.658e-14
Identity = 51/158 (32.28%), Postives = 73/158 (46.20%), Query Frame = 2
Query:  221 VTTFKQVD---EDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            V +F  V    ED   + +  C +Q TCC T+ G   CC +  AVCCED  HCCP+G TC+   + C                +  ++ +P ++           S+ +++V  DG   C    TCC    G +GCCP+   VCC D   CCP G+ C
Sbjct:  518 VPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGG----------SVPMLEKVPSFS---------KVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 656          

HSP 8 Score: 72.4034 bits (176), Expect = 3.655e-14
Identity = 51/158 (32.28%), Postives = 72/158 (45.57%), Query Frame = 2
Query:  221 VTTFKQVD---EDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            V +F  V    ED   + +  C +Q TCC T+ G   CC +  AVCCED  HCCP+G TC+   + C                +  ++ +P ++           S+ +++V  DG   C    TCC   +G +GCCP    VCC D   CCP G  C
Sbjct:  676 VPSFSNVSVKMEDVPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGG----------SVPMLEKVPSFS---------KVSVKMEDVPCDGSTSCPDQTTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTC 814          

HSP 9 Score: 70.8626 bits (172), Expect = 1.293e-13
Identity = 52/143 (36.36%), Postives = 68/143 (47.55%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIP-GSCI 700
            C E  +CC    G+  CC   NAVCC D  HCCPEG TCD  +K C       +E TV    +     +P    +  P++       + N C D   C    TCC  ++  +GCC     VCC D + CCP+G +C   GSCI
Sbjct:  970 CPEHMSCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGYTCDLASKSCHKLLTLQLE-TVPLTPVF----LPDDQSQHGPVKP------ILNRCDDVYSCNVDETCCRTSHTTWGCCLSPKAVCCRDMKHCCPDGYRCTKGGSCI 1101          

HSP 10 Score: 66.2402 bits (160), Expect = 4.922e-12
Identity = 51/162 (31.48%), Postives = 70/162 (43.21%), Query Frame = 2
Query:  215 DGVTTFKQ---VDEDGCK--NSNKICGEQKTCC-MTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            DG   F +    DE+G    +S+  C +  TCC M ++ K  CC    AVCC D  HCCP    C  ++  C+                     IP YT  + P  +  ++      C    +C  +++CC L  G +GCCP    VCC DK  CCP G  C
Sbjct:  865 DGQEDFDEEDKTDEEGIISCDSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKCKEEDTSCVKGEV----------------VIPWYT--KIPATDSIQADSSFVQCSAVHQCPEHMSCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGYTC 1008          

HSP 11 Score: 65.4698 bits (158), Expect = 9.012e-12
Identity = 57/175 (32.57%), Postives = 74/175 (42.29%), Query Frame = 2
Query:  221 VTTFKQVD---EDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSK-EPM--EWTVSDDKIHAIKAIPKYTVE------RSPLREWYESIGLKN--------VCPDGGKCTGYLTCCLLTNGH-YGCCPYSFGVCCPDKRTCCPNGRKC 682
            V +F +V    ED   + +  C +Q TCC TK G   CC    AVCC+D  HCCP GTTCD     C+  S   PM  +   S     A   + K   E      +   R+  E    ++         C    +C  + TCC +     +GCCP    VCC D   CCP   KC
Sbjct:  755 VPSFSKVSVKMEDVPCDGSTSCPDQTTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTCDLSTLSCLKASGLVPMSKKLPASTRTSSATSQLMKTGQETEEGENKPDDRDGQEDFDEEDKTDEEGIISCDSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKC 929          

HSP 12 Score: 51.6026 bits (122), Expect = 3.322e-7
Identity = 42/158 (26.58%), Postives = 60/158 (37.97%), Query Frame = 2
Query:  227 TFKQVDEDGCKNSNKICGEQKTC-----CMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDG-GKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            +F+ +     ++ + IC +Q  C     C+  + +  CC     V C D  HCCPEG  C   ++ C+              K  +IK +                     +C DG  +C    TCC    G + CCP    VCC DK  CCP    C
Sbjct:   94 SFRMIRSYMGEDEDNICPDQSRCPAEFSCLKALTRYGCCPLAQGVSCPDGKHCCPEGHQCSLDSRSCV--------------KKESIKTV---------------------LCKDGVSECPDETTCCENQEGKWACCPMPKAVCCDDKIHCCPEETTC 216          
BLAST of Granulin b vs. Ensembl Medaka
Match: ENSORLT00000005071.2 (granulins [Source:NCBI gene;Acc:101168633])

HSP 1 Score: 61.2326 bits (147), Expect = 1.176e-10
Identity = 47/145 (32.41%), Postives = 59/145 (40.69%), Query Frame = 2
Query:  266 NKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEW-TVSDDKIHAIKAIPKYTVERSPLREWYESIGLKN-----VCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
             K+C +  TCC+T  G   CC    AVCC D +HCCP G  C+     C    K    W ++      A +  P   +  + + E     GL        C     C    TCC    G + CCPY  G CC D   CCP G  C
Sbjct:   29 GKLCPDLSTCCLTGHGF-SCCPLPEAVCCSDKAHCCPSGYRCNLATMMC---EKTDQPWVSLPMLTKEAAEEPPALDLSTNLVEELKNDNGLAQKSTGVQCDSFYMCPDRTTCCRHPKGAWFCCPYYPGRCCLDGFHCCPYGYDC 169          

HSP 2 Score: 58.5362 bits (140), Expect = 8.975e-10
Identity = 52/183 (28.42%), Postives = 69/183 (37.70%), Query Frame = 2
Query:  197 VYDITTDGVTTFKQVDEDGCK------NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQS-KEPMEWTVS-------------DDKIHAIKAIPKYT-VERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
              D++T+ V   K  +    K      +S  +C ++ TCC    G   CC Y    CC D  HCCP G  CD     CI    K P  +  +             ++ I   K++   T    +P          K  CP G       +CC    G + CCPY  G CC D R CC  G  C
Sbjct:   99 ALDLSTNLVEELKNDNGLAQKSTGVQCDSFYMCPDRTTCCRHPKGAWFCCPYYPGRCCLDGFHCCPYGYDCDLTYTHCIRDGFKYPFYYKQALTSVPAALISHPEENSIQLEKSLTALTEASDAPSEHGVIRCDSKFFCPAG------TSCCKGAEGQWTCCPYPLGKCCADGRHCCQYGYTC 275          
BLAST of Granulin b vs. Ensembl Medaka
Match: ENSORLT00000029765.1 (granulins [Source:NCBI gene;Acc:101168633])

HSP 1 Score: 60.8474 bits (146), Expect = 1.224e-10
Identity = 47/145 (32.41%), Postives = 59/145 (40.69%), Query Frame = 2
Query:  266 NKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEW-TVSDDKIHAIKAIPKYTVERSPLREWYESIGLKN-----VCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
             K+C +  TCC+T  G   CC    AVCC D +HCCP G  C+     C    K    W ++      A +  P   +  + + E     GL        C     C    TCC    G + CCPY  G CC D   CCP G  C
Sbjct:   27 GKLCPDLSTCCLTGHGF-SCCPLPEAVCCSDKAHCCPSGYRCNLATMMC---EKTDQPWVSLPMLTKEAAEEPPALDLSTNLVEELKNDNGLAQKSTGVQCDSFYMCPDRTTCCRHPKGAWFCCPYYPGRCCLDGFHCCPYGYDC 167          

HSP 2 Score: 58.5362 bits (140), Expect = 9.034e-10
Identity = 52/183 (28.42%), Postives = 69/183 (37.70%), Query Frame = 2
Query:  197 VYDITTDGVTTFKQVDEDGCK------NSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQS-KEPMEWTVS-------------DDKIHAIKAIPKYT-VERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
              D++T+ V   K  +    K      +S  +C ++ TCC    G   CC Y    CC D  HCCP G  CD     CI    K P  +  +             ++ I   K++   T    +P          K  CP G       +CC    G + CCPY  G CC D R CC  G  C
Sbjct:   97 ALDLSTNLVEELKNDNGLAQKSTGVQCDSFYMCPDRTTCCRHPKGAWFCCPYYPGRCCLDGFHCCPYGYDCDLTYTHCIRDGFKYPFYYKQALTSVPAALISHPEENSIQLEKSLTALTEASDAPSEHGVIRCDSKFFCPAG------TSCCKGAEGQWTCCPYPLGKCCADGRHCCQYGYTC 273          
BLAST of Granulin b vs. Planmine SMEST
Match: SMESG000002628.1 (SMESG000002628.1)

HSP 1 Score: 274.248 bits (700), Expect = 1.096e-94
Identity = 134/134 (100.00%), Postives = 134/134 (100.00%), Query Frame = 2
Query:  299 MTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI 700
            MTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI
Sbjct:    1 MTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI 134          
BLAST of Granulin b vs. Planmine SMEST
Match: SMESG000018770.1 (SMESG000018770.1)

HSP 1 Score: 112.849 bits (281), Expect = 1.313e-28
Identity = 65/179 (36.31%), Postives = 88/179 (49.16%), Query Frame = 2
Query:  179 LFLCIFVYDITTDGVTTFKQVDEDG--------CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDK--IHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            + L I V    TDG+ +F +  +D         C N+   C E +TCC+TK     CC+Y NA+CC D  HCCP G+TCD   KRC    + PMEW V ++   +  +   P  T+           +     CP+   KC    TCC+  +G+Y CCP+   VCC DK  CCP   KC
Sbjct:    1 MILTIIVDYALTDGIFSFNKASQDQVSEKNENVCPNNRTKCKETQTCCVTKHNSYHCCRYPNAICCPDKYHCCPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKC 179          

HSP 2 Score: 98.2117 bits (243), Expect = 1.958e-23
Identity = 59/153 (38.56%), Postives = 81/153 (52.94%), Query Frame = 2
Query:  227 TFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGK-CTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            T +  D+  C N+   C + KTCC+TK G   CC + NAVCC D  +CCPE T CD KNK+C+  S        +  K   +K+   YT              L+  CP+  K C G   CC ++ GH+GCC ++ G+CCPD +TCCP+   C
Sbjct:  125 TLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKCDLKNKKCLDSS-----AVFNSYKNPGLKSANLYT-----FYSLLNVDKLEKKCPNSEKQCPGQKKCCPMSGGHFGCCKFNKGICCPDMKTCCPHNTDC 267          

HSP 3 Score: 96.6709 bits (239), Expect = 8.945e-23
Identity = 55/141 (39.01%), Postives = 72/141 (51.06%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSC 697
            C   +TCC    G   CC + NA CC D + CCP    CD + K C  ++KE  + +++  K                L  +Y  IGLK +CPD  KC     CC + +  YGCC Y  GVCC DK+TCCPNG +C+ G C
Sbjct:  307 CQSFETCCSVGDGLYGCCPFKNATCCSDNASCCPHNKVCDLEKKVC--KNKETSQPSITKSK---------------SLLHFYSEIGLKVICPDQTKCENDSVCCQMDDNQYGCCSYKNGVCCADKQTCCPNGTQCVSGGC 430          

HSP 4 Score: 85.1149 bits (209), Expect = 8.795e-19
Identity = 54/147 (36.73%), Postives = 71/147 (48.30%), Query Frame = 2
Query:  245 EDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            E  C NS K C  QK CC    G   CC++   +CC DM  CCP  T CD+  K C+ +S +  E             IP    E  P  +    I L N+CPD   +C  + TCC + +G YGCCP+    CC D  +CCP+ + C
Sbjct:  219 EKKCPNSEKQCPGQKKCCPMSGGHFGCCKFNKGICCPDMKTCCPHNTDCDSAKKACVSKSSDLTE-------------IPN---ELQPEAQ----IKLNNICPDKHVECQSFETCCSVGDGLYGCCPFKNATCCSDNASCCPHNKVC 345          
BLAST of Granulin b vs. Planmine SMEST
Match: SMESG000018770.1 (SMESG000018770.1)

HSP 1 Score: 112.464 bits (280), Expect = 1.514e-28
Identity = 65/179 (36.31%), Postives = 88/179 (49.16%), Query Frame = 2
Query:  179 LFLCIFVYDITTDGVTTFKQVDEDG--------CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDK--IHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            + L I V    TDG+ +F +  +D         C N+   C E +TCC+TK     CC+Y NA+CC D  HCCP G+TCD   KRC    + PMEW V ++   +  +   P  T+           +     CP+   KC    TCC+  +G+Y CCP+   VCC DK  CCP   KC
Sbjct:   10 MILTIIVDYALTDGIFSFNKASQDQVSEKNENVCPNNRTKCKETQTCCVTKHNSYHCCRYPNAICCPDKYHCCPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKC 188          

HSP 2 Score: 98.5969 bits (244), Expect = 1.906e-23
Identity = 59/153 (38.56%), Postives = 81/153 (52.94%), Query Frame = 2
Query:  227 TFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGK-CTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            T +  D+  C N+   C + KTCC+TK G   CC + NAVCC D  +CCPE T CD KNK+C+  S        +  K   +K+   YT              L+  CP+  K C G   CC ++ GH+GCC ++ G+CCPD +TCCP+   C
Sbjct:  134 TLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKCDLKNKKCLDSS-----AVFNSYKNPGLKSANLYT-----FYSLLNVDKLEKKCPNSEKQCPGQKKCCPMSGGHFGCCKFNKGICCPDMKTCCPHNTDC 276          

HSP 3 Score: 96.6709 bits (239), Expect = 8.673e-23
Identity = 55/141 (39.01%), Postives = 72/141 (51.06%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSC 697
            C   +TCC    G   CC + NA CC D + CCP    CD + K C  ++KE  + +++  K                L  +Y  IGLK +CPD  KC     CC + +  YGCC Y  GVCC DK+TCCPNG +C+ G C
Sbjct:  316 CQSFETCCSVGDGLYGCCPFKNATCCSDNASCCPHNKVCDLEKKVC--KNKETSQPSITKSK---------------SLLHFYSEIGLKVICPDQTKCENDSVCCQMDDNQYGCCSYKNGVCCADKQTCCPNGTQCVSGGC 439          

HSP 4 Score: 85.1149 bits (209), Expect = 8.434e-19
Identity = 54/147 (36.73%), Postives = 71/147 (48.30%), Query Frame = 2
Query:  245 EDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            E  C NS K C  QK CC    G   CC++   +CC DM  CCP  T CD+  K C+ +S +  E             IP    E  P  +    I L N+CPD   +C  + TCC + +G YGCCP+    CC D  +CCP+ + C
Sbjct:  228 EKKCPNSEKQCPGQKKCCPMSGGHFGCCKFNKGICCPDMKTCCPHNTDCDSAKKACVSKSSDLTE-------------IPN---ELQPEAQ----IKLNNICPDKHVECQSFETCCSVGDGLYGCCPFKNATCCSDNASCCPHNKVC 354          
BLAST of Granulin b vs. Planmine SMEST
Match: SMESG000018770.1 (SMESG000018770.1)

HSP 1 Score: 112.464 bits (280), Expect = 1.675e-28
Identity = 65/179 (36.31%), Postives = 88/179 (49.16%), Query Frame = 2
Query:  179 LFLCIFVYDITTDGVTTFKQVDEDG--------CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDK--IHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            + L I V    TDG+ +F +  +D         C N+   C E +TCC+TK     CC+Y NA+CC D  HCCP G+TCD   KRC    + PMEW V ++   +  +   P  T+           +     CP+   KC    TCC+  +G+Y CCP+   VCC DK  CCP   KC
Sbjct:    7 MILTIIVDYALTDGIFSFNKASQDQVSEKNENVCPNNRTKCKETQTCCVTKHNSYHCCRYPNAICCPDKYHCCPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKC 185          

HSP 2 Score: 98.2117 bits (243), Expect = 2.209e-23
Identity = 59/153 (38.56%), Postives = 81/153 (52.94%), Query Frame = 2
Query:  227 TFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGK-CTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            T +  D+  C N+   C + KTCC+TK G   CC + NAVCC D  +CCPE T CD KNK+C+  S        +  K   +K+   YT              L+  CP+  K C G   CC ++ GH+GCC ++ G+CCPD +TCCP+   C
Sbjct:  131 TLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKCDLKNKKCLDSS-----AVFNSYKNPGLKSANLYT-----FYSLLNVDKLEKKCPNSEKQCPGQKKCCPMSGGHFGCCKFNKGICCPDMKTCCPHNTDC 273          

HSP 3 Score: 96.2857 bits (238), Expect = 1.016e-22
Identity = 55/141 (39.01%), Postives = 72/141 (51.06%), Query Frame = 2
Query:  275 CGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSC 697
            C   +TCC    G   CC + NA CC D + CCP    CD + K C  ++KE  + +++  K                L  +Y  IGLK +CPD  KC     CC + +  YGCC Y  GVCC DK+TCCPNG +C+ G C
Sbjct:  313 CQSFETCCSVGDGLYGCCPFKNATCCSDNASCCPHNKVCDLEKKVC--KNKETSQPSITKSK---------------SLLHFYSEIGLKVICPDQTKCENDSVCCQMDDNQYGCCSYKNGVCCADKQTCCPNGTQCVSGGC 436          

HSP 4 Score: 85.1149 bits (209), Expect = 9.543e-19
Identity = 54/147 (36.73%), Postives = 71/147 (48.30%), Query Frame = 2
Query:  245 EDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            E  C NS K C  QK CC    G   CC++   +CC DM  CCP  T CD+  K C+ +S +  E             IP    E  P  +    I L N+CPD   +C  + TCC + +G YGCCP+    CC D  +CCP+ + C
Sbjct:  225 EKKCPNSEKQCPGQKKCCPMSGGHFGCCKFNKGICCPDMKTCCPHNTDCDSAKKACVSKSSDLTE-------------IPN---ELQPEAQ----IKLNNICPDKHVECQSFETCCSVGDGLYGCCPFKNATCCSDNASCCPHNKVC 351          
BLAST of Granulin b vs. Planmine SMEST
Match: SMESG000018760.1 (SMESG000018760.1)

HSP 1 Score: 105.145 bits (261), Expect = 1.913e-25
Identity = 64/163 (39.26%), Postives = 83/163 (50.92%), Query Frame = 2
Query:  224 TTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESI---------GLKNVCPDG-GKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            T  K + +  C N+   C + +TCC+TK G   CC++ NAVCC D  HCCPEG+TCD K  +C+  +K  +E           K IP   VE  P     E+           + N+CP+   KCT   TCC   +  Y CC Y+  VCCPDK  CCPNG  C
Sbjct:   95 TDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMR---------KLIPALKVEDEPKTNILEAKVNEKDENKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSC 248          

HSP 2 Score: 94.7449 bits (234), Expect = 6.961e-22
Identity = 59/157 (37.58%), Postives = 81/157 (51.59%), Query Frame = 2
Query:  224 TTFKQVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYES-IGLKN--VCPDGG-KCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            T  K + +  C N+   C + +TCC+TK G   CC++ NAVCC D  HCCPEG+TCD K  +C+  +K  +E           K IP   VE        E+ +  K+  +CP+   KC    TCC+  + +Y CCP+   VCC DK  CCP    C
Sbjct:  281 TDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMG---------KLIPALKVENELKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEATTC 428          

HSP 3 Score: 92.4337 bits (228), Expect = 4.080e-21
Identity = 57/147 (38.78%), Postives = 74/147 (50.34%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRC---IHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDG-GKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C N    C E++TCC TK     CC+Y NAVCC D  HCCP GT+CD+ +K+C   I  +K P++ T                +E   + E    I     CP+   KC    TCC+  +G Y CC ++  VCCPDK  CCP G  C
Sbjct:   17 CPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNRNIEATKSPIQTTPE-------------PMEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTC 150          

HSP 4 Score: 92.4337 bits (228), Expect = 4.080e-21
Identity = 57/147 (38.78%), Postives = 74/147 (50.34%), Query Frame = 2
Query:  254 CKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRC---IHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDG-GKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            C N    C E++TCC TK     CC+Y NAVCC D  HCCP GT+CD+ +K+C   I  +K P++ T                +E   + E    I     CP+   KC    TCC+  +G Y CC ++  VCCPDK  CCP G  C
Sbjct:  203 CPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNRNIEATKSPIQTTPE-------------PMEMPVIEETDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTC 336          

HSP 5 Score: 82.8037 bits (203), Expect = 7.124e-18
Identity = 57/151 (37.75%), Postives = 73/151 (48.34%), Query Frame = 2
Query:  236 QVDEDGCKNSNKICGEQKTCCMTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIH--QSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            + DE  C N+   C + KTCC+TK     CC + NAVCC D   CCPE TTCD KNK+C     S   +   ++ + IH       +  E +  +     +G K       K   Y   C +TNG  G C +S G CC D RTCCP   KC
Sbjct:  377 EKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSIHEIAHEMAQELIHD-----SFKYETNFFKIISLLLGFKQ---KASKSDFY---CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKC 516          

HSP 6 Score: 61.6178 bits (148), Expect = 1.164e-10
Identity = 39/125 (31.20%), Postives = 59/125 (47.20%), Query Frame = 2
Query:  311 GKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTVSDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDG-GKCTGYLTCCLLTNGHYGCCPYSFGVCCPDKRTCCPNGRKC 682
            G+   C+++   CC D+  CCP+ T CD KN +C   S    ++     K              SP      ++    VCPD   +C  + TCC +++  YGCC     VCC D+ +CCP+ +KC
Sbjct:  490 GRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTLNS---TDFDTEKSK-------------HSPNTNRLSTV----VCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKC 594          
The following BLAST results are available for this feature:
BLAST of Granulin b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRN2.244e-1733.15granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN3.265e-1733.15granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN6.527e-1736.36granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN3.992e-1632.61granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN4.996e-1032.77granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
back to top
BLAST of Granulin b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pgrn-12.187e-2238.71ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:... [more]
pgrn-13.069e-2238.71ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Granulin b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Granulin b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grnb2.525e-1837.24granulin b [Source:ZFIN;Acc:ZDB-GENE-030131-7393][more]
grna4.492e-1737.06granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grna1.871e-1632.90granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grna8.877e-1635.17granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grna9.283e-1635.17granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
back to top
BLAST of Granulin b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
trappc115.318e-1536.11trafficking protein particle complex 11 [Source:Xe... [more]
trappc116.874e-1536.11trafficking protein particle complex 11 [Source:Xe... [more]
trappc111.257e-1234.01trafficking protein particle complex 11 [Source:Xe... [more]
trappc111.430e-1233.56trafficking protein particle complex 11 [Source:Xe... [more]
back to top
BLAST of Granulin b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Grn2.100e-1533.53granulin [Source:MGI Symbol;Acc:MGI:95832][more]
Grn2.309e-1435.71granulin [Source:MGI Symbol;Acc:MGI:95832][more]
Grn2.296e-1128.28granulin [Source:MGI Symbol;Acc:MGI:95832][more]
Grn4.713e-830.88granulin [Source:MGI Symbol;Acc:MGI:95832][more]
back to top
BLAST of Granulin b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P28797|GRN_CAVPO4.500e-1732.08Progranulin OS=Cavia porcellus OX=10141 GN=GRN PE=... [more]
sp|P28799|GRN_HUMAN1.568e-1633.15Progranulin OS=Homo sapiens OX=9606 GN=GRN PE=1 SV... [more]
sp|P23785|GRN_RAT5.857e-1633.74Progranulin OS=Rattus norvegicus OX=10116 GN=Grn P... [more]
sp|P28798|GRN_MOUSE1.376e-1433.53Progranulin OS=Mus musculus OX=10090 GN=Grn PE=1 S... [more]
sp|P80059|PMD1_LOCMI2.361e-748.08Pars intercerebralis major peptide D1 OS=Locusta m... [more]
back to top
BLAST of Granulin b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A023GCS23.032e-2134.32Putative granulin (Fragment) OS=Amblyomma triste O... [more]
A0A226F5G23.947e-2032.20Granulins OS=Folsomia candida OX=158441 GN=Fcan01_... [more]
A0A131XWJ64.116e-2037.14Putative granulin (Fragment) OS=Ixodes ricinus OX=... [more]
A0A443S2429.329e-2041.67Uncharacterized protein OS=Leptotrombidium deliens... [more]
A0A0B2W2D52.917e-1939.19Granulin (Fragment) OS=Toxocara canis OX=6265 GN=G... [more]
back to top
BLAST of Granulin b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grnb3.501e-1737.68granulins-like [Source:NCBI gene;Acc:103046308][more]
grnb3.501e-1737.68granulins-like [Source:NCBI gene;Acc:103046308][more]
ENSAMXT00000034465.13.584e-1532.88pep primary_assembly:Astyanax_mexicanus-2.0:23:267... [more]
ENSAMXT00000030959.13.584e-1532.88pep primary_assembly:Astyanax_mexicanus-2.0:23:267... [more]
ENSAMXT00000057729.13.584e-1532.88pep primary_assembly:Astyanax_mexicanus-2.0:23:267... [more]
back to top
BLAST of Granulin b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009302.19.873e-1736.76pep scaffold:Pmarinus_7.0:GL483232:1183:11161:1 ge... [more]
ENSPMAT00000001039.13.922e-927.89pep scaffold:Pmarinus_7.0:GL484091:11570:24665:-1 ... [more]
back to top
BLAST of Granulin b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Granulin b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO278241.716e-1436.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Granulin b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grnb1.826e-2037.50granulin precursor [Source:NCBI gene;Acc:101166910... [more]
grna4.848e-1531.37granulins [Source:NCBI gene;Acc:101162601][more]
grna5.150e-1531.37granulins [Source:NCBI gene;Acc:101162601][more]
ENSORLT00000005071.21.176e-1032.41granulins [Source:NCBI gene;Acc:101168633][more]
ENSORLT00000029765.11.224e-1032.41granulins [Source:NCBI gene;Acc:101168633][more]
back to top
BLAST of Granulin b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002628.11.096e-94100.00SMESG000002628.1[more]
SMESG000018770.11.313e-2836.31SMESG000018770.1[more]
SMESG000018770.11.514e-2836.31SMESG000018770.1[more]
SMESG000018770.11.675e-2836.31SMESG000018770.1[more]
SMESG000018760.11.913e-2539.26SMESG000018760.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034503 ID=SMED30034503|Name=Granulin b|organism=Schmidtea mediterranea sexual|type=transcript|length=757bp
CAAAATACATTGATTATTTTGGCATCCGGATTGATACAGTTTAATCATAA
ACAAATGATGTTTAATCATAAACAAAATATTGTTTATTCTAATAATGGAG
TCTTTGTATAAATTAGTGAAAATAATATAATAATCAGAAGTTTTCCTAAT
GAAGTGTCCTAGTCTGTTTTTGTGTGCATTATTTTTATGTATTTTTGTCT
ATGATATAACTACTGATGGCGTTACGACATTCAAACAAGTAGATGAAGAT
GGGTGTAAAAATAGCAATAAGATATGTGGAGAACAAAAAACCTGTTGTAT
GACTAAAATTGGTAAACCCAAATGTTGCCAATATACTAATGCAGTCTGCT
GTGAGGATATGTCACATTGTTGTCCTGAAGGCACGACATGTGATACAAAA
AATAAAAGATGTATTCATCAATCTAAAGAACCAATGGAGTGGACTGTATC
GGACGACAAGATTCATGCAATAAAAGCAATTCCAAAATATACAGTGGAGA
GATCACCATTGAGAGAATGGTATGAGAGTATTGGATTGAAAAATGTTTGC
CCAGATGGAGGTAAATGTACAGGCTATCTGACTTGTTGCTTATTGACAAA
TGGACACTATGGATGTTGTCCATACAGTTTTGGAGTTTGTTGTCCCGACA
AACGAACATGTTGCCCAAATGGTCGAAAATGCATTCCTGGATCTTGCATT
TAATTTGAACTATATTAACGATTATTTCTTGATCAAATTGGCTTCATGAA
ATGTGAT
back to top

protein sequence of SMED30034503-orf-1

>SMED30034503-orf-1 ID=SMED30034503-orf-1|Name=SMED30034503-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=185bp
MKCPSLFLCALFLCIFVYDITTDGVTTFKQVDEDGCKNSNKICGEQKTCC
MTKIGKPKCCQYTNAVCCEDMSHCCPEGTTCDTKNKRCIHQSKEPMEWTV
SDDKIHAIKAIPKYTVERSPLREWYESIGLKNVCPDGGKCTGYLTCCLLT
NGHYGCCPYSFGVCCPDKRTCCPNGRKCIPGSCI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR037277Granulin_sf
IPR039036Granulin_fam
IPR000118Granulin
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0005125cytokine activity
GO:0005515protein binding
GO:0008083growth factor activity
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
GO:0005764lysosome
GO:0005768endosome
GO:0005783endoplasmic reticulum
GO:0035578azurophil granule lumen
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0043312neutrophil degranulation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000118GranulinSMARTSM00277GRAN_2coord: 134..183
e-value: 7.4E-5
score: 31.5
coord: 36..88
e-value: 1.4E-13
score: 61.2
IPR000118GranulinPFAMPF00396Granulincoord: 145..180
e-value: 2.5E-10
score: 40.5
coord: 48..89
e-value: 3.0E-13
score: 49.8
IPR000118GranulinPROSITEPS00799GRANULINScoord: 68..81
IPR037277Granulin superfamilyGENE3DG3DSA:3.10.20.500coord: 132..184
e-value: 2.3E-11
score: 45.6
IPR037277Granulin superfamilyGENE3DG3DSA:3.10.20.500coord: 33..91
e-value: 1.1E-12
score: 50.0
IPR039036Granulin familyPANTHERPTHR12274GRANULINcoord: 25..100
IPR039036Granulin familyPANTHERPTHR12274GRANULINcoord: 132..178
NoneNo IPR availablePANTHERPTHR12274:SF3GRANULINScoord: 132..178
NoneNo IPR availablePANTHERPTHR12274:SF3GRANULINScoord: 25..100
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.845
NoneNo IPR availableSUPERFAMILYSSF57277Granulin repeatcoord: 133..159