Lim domain binding protein, putative

Overview
NameLim domain binding protein, putative
Smed IDSMED30034496
Length (bp)2782
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lim domain binding protein, putative (SMED30034496) t-SNE clustered cells

Violin plots show distribution of expression levels for Lim domain binding protein, putative (SMED30034496) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lim domain binding protein, putative (SMED30034496) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lim domain binding protein, putative (SMED30034496) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034496

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30034496h1SMcG0004868 SmedASXL_012468SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30034496h1SMcG0004868 SmedASXL_012468SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30034496h1SMcG0004868 dd_Smed_v4_3678_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034496h1SMcG0004868 dd_Smed_v4_3678_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lim domain binding protein, putative vs. Ensembl Human
Match: LDB2 (LIM domain binding 2 [Source:HGNC Symbol;Acc:HGNC:6533])

HSP 1 Score: 341.273 bits (874), Expect = 1.734e-108
Identity = 177/335 (52.84%), Postives = 229/335 (68.36%), Query Frame = 2
Query:  422 RGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQ-TSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            R + PYM   + R+ E N+RLQ RTED DN+WWD   TEFFE+DA LT++F  ++GPKRYTIGRTLIPRYF ++F+ G T+ YY L+  +ESYH ++I VD +   MV    + +  T +  EGRL+L+F FD+LMRI++W F IR +RE + RS+        Q+L + SKN+TR G+ NFT+N+ R+C ILEPMQELMSR K Y+LSP+DCLKT LFQKWQRMVAPP     +E  RQ T+KRRKRK S +++ ++S  +            N N  G  + T    T A + +     DVM+VGEPTLMGGEFGDEDER ITRLENTQYDA+
Sbjct:   19 RRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCTMVTQHGKPMF-TKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPP-----AEPTRQPTTKRRKRKNSTSSTSNSSAGN------------NANSTGSKKKT----TAANLSLSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAA 331          
BLAST of Lim domain binding protein, putative vs. Ensembl Human
Match: LDB2 (LIM domain binding 2 [Source:HGNC Symbol;Acc:HGNC:6533])

HSP 1 Score: 341.273 bits (874), Expect = 1.767e-108
Identity = 177/335 (52.84%), Postives = 231/335 (68.96%), Query Frame = 2
Query:  422 RGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQ-TSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            R + PYM   + R+ E N+RLQ RTED DN+WWD   TEFFE+DA LT++F  ++GPKRYTIGRTLIPRYF ++F+ G T+ YY L+  +ESYH ++I VD +   MV    + +  T +  EGRL+L+F FD+LMRI++W F IR +RE + RS+        Q+L + SKN+TR G+ NFT+N+ R+C ILEPMQELMSR K Y+LSP+DCLKT LFQKWQRMVAPP     +E  RQ T+KRRKRK S +++ ++S  +            N N  G  + T    T A + +   ++DVM+VGEPTLMGGEFGDEDER ITRLENTQYDA+
Sbjct:   19 RRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCTMVTQHGKPMF-TKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPP-----AEPTRQPTTKRRKRKNSTSSTSNSSAGN------------NANSTGSKKKT----TAANLSL--SSQDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAA 329          
BLAST of Lim domain binding protein, putative vs. Ensembl Human
Match: LDB1 (LIM domain binding 1 [Source:HGNC Symbol;Acc:HGNC:6532])

HSP 1 Score: 340.502 bits (872), Expect = 1.095e-107
Identity = 176/332 (53.01%), Postives = 223/332 (67.17%), Query Frame = 2
Query:  428 NNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            + PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +E++H+N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +    +Q SKRRKRK S  ++ S+                N N       +N K           ++DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   60 HTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPTR----QQPSKRRKRKMSGGSTMSSGGG-------------NTN------NSNSKKKSPASTFALSSQDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 367          
BLAST of Lim domain binding protein, putative vs. Ensembl Human
Match: LDB1 (LIM domain binding 1 [Source:HGNC Symbol;Acc:HGNC:6532])

HSP 1 Score: 339.347 bits (869), Expect = 1.174e-107
Identity = 174/332 (52.41%), Postives = 223/332 (67.17%), Query Frame = 2
Query:  428 NNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            + PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +E++H+N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +    +Q SKRRKRK S  ++ S+   ++    S                  +K   +   +     DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   24 HTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPTR----QQPSKRRKRKMSGGSTMSSGGGNTNNSNS-----------------KKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 333          
BLAST of Lim domain binding protein, putative vs. Ensembl Human
Match: LDB1 (LIM domain binding 1 [Source:HGNC Symbol;Acc:HGNC:6532])

HSP 1 Score: 339.732 bits (870), Expect = 2.657e-107
Identity = 175/332 (52.71%), Postives = 223/332 (67.17%), Query Frame = 2
Query:  428 NNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            + PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +E++H+N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +    +Q SKRRKRK S  ++ S+                N N       + +K   +   +     DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   60 HTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPTR----QQPSKRRKRKMSGGSTMSSGGG-------------NTNN----SNSKKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 369          
BLAST of Lim domain binding protein, putative vs. Ensembl Celegans
Match: ldb-1 (F58A3.1a; LIM Domain Binding protein [Source:UniProtKB/TrEMBL;Acc:G5EEL0])

HSP 1 Score: 145.591 bits (366), Expect = 3.780e-36
Identity = 113/378 (29.89%), Postives = 188/378 (49.74%), Query Frame = 2
Query:  440 MASIDCRLNEFNRRL-----QQRTEDCDNIWWDTLITEFFEEDAVLTVTFTDE-----GPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRS-VRESYHTN-TIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFN-FDELM--RIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFS----KNVTRCGIPNFTMNFFRICTILEPMQELMSRQK-AYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSES---------NRQTSKRRKRK------GXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPH 1468
            ++ ++ R+++ NRRL        +E+    WWD    EFF++D  L      E       +RY I R  IP++FRSIFDSG  E  Y LR   RE    N +   ++E+   +  + ++     +  EG+L ++F  FDE+M  RI++WT +++   EF+      +  N     +E      +N  R G    T N   +  IL+PMQ +MS  K A +++P++ +K TLFQ  Q       QQQ ++            + +++R+RK      GS   + +A+  ++       P++P  +     +      T    ++ +   DVM+VGEP++MG EFG+ DER+I+R+EN+QYD +   +     SLGQ P+
Sbjct:   59 VSPLEFRIHDMNRRLYIFSSTGVSENDQQQWWDAFSHEFFDDDCKLWFVIGSEPVAFASRERYIINRQFIPKFFRSIFDSGMRELQYVLRGPSRECTLANGSQAYENENVLQITRYDQSSQ-FEVNTEGKLYVEFAPFDEVMNYRIKAWTLELKRSNEFV------YNQNTADYRVEAQNPEQENKPRMGFFKSTFNLMTMLKILDPMQSIMSSAKSAPAITPREVMKRTLFQHHQVRQQNMRQQQLNQQMMIPAPEPEKPKPARKRQRKPAANPRGSKKATAAAAAAAAAATNGVPPTVPTASPANNQQFPPNPMTSQFQQMSY--PDVMVVGEPSMMGSEFGENDERTISRVENSQYDPNAMQMQ----SLGQGPN 423          
BLAST of Lim domain binding protein, putative vs. Ensembl Celegans
Match: ldb-1 (F58A3.1a; LIM Domain Binding protein [Source:UniProtKB/TrEMBL;Acc:G5EEL0])

HSP 1 Score: 145.591 bits (366), Expect = 3.780e-36
Identity = 113/378 (29.89%), Postives = 188/378 (49.74%), Query Frame = 2
Query:  440 MASIDCRLNEFNRRL-----QQRTEDCDNIWWDTLITEFFEEDAVLTVTFTDE-----GPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRS-VRESYHTN-TIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFN-FDELM--RIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFS----KNVTRCGIPNFTMNFFRICTILEPMQELMSRQK-AYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSES---------NRQTSKRRKRK------GXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPH 1468
            ++ ++ R+++ NRRL        +E+    WWD    EFF++D  L      E       +RY I R  IP++FRSIFDSG  E  Y LR   RE    N +   ++E+   +  + ++     +  EG+L ++F  FDE+M  RI++WT +++   EF+      +  N     +E      +N  R G    T N   +  IL+PMQ +MS  K A +++P++ +K TLFQ  Q       QQQ ++            + +++R+RK      GS   + +A+  ++       P++P  +     +      T    ++ +   DVM+VGEP++MG EFG+ DER+I+R+EN+QYD +   +     SLGQ P+
Sbjct:   59 VSPLEFRIHDMNRRLYIFSSTGVSENDQQQWWDAFSHEFFDDDCKLWFVIGSEPVAFASRERYIINRQFIPKFFRSIFDSGMRELQYVLRGPSRECTLANGSQAYENENVLQITRYDQSSQ-FEVNTEGKLYVEFAPFDEVMNYRIKAWTLELKRSNEFV------YNQNTADYRVEAQNPEQENKPRMGFFKSTFNLMTMLKILDPMQSIMSSAKSAPAITPREVMKRTLFQHHQVRQQNMRQQQLNQQMMIPAPEPEKPKPARKRQRKPAANPRGSKKATAAAAAAAAAATNGVPPTVPTASPANNQQFPPNPMTSQFQQMSY--PDVMVVGEPSMMGSEFGENDERTISRVENSQYDPNAMQMQ----SLGQGPN 423          
BLAST of Lim domain binding protein, putative vs. Ensembl Celegans
Match: ldb-1 (F58A3.1a; LIM Domain Binding protein [Source:UniProtKB/TrEMBL;Acc:G5EEL0])

HSP 1 Score: 145.206 bits (365), Expect = 4.725e-36
Identity = 113/378 (29.89%), Postives = 188/378 (49.74%), Query Frame = 2
Query:  440 MASIDCRLNEFNRRL-----QQRTEDCDNIWWDTLITEFFEEDAVLTVTFTDE-----GPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRS-VRESYHTN-TIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFN-FDELM--RIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFS----KNVTRCGIPNFTMNFFRICTILEPMQELMSRQK-AYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSES---------NRQTSKRRKRK------GXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPH 1468
            ++ ++ R+++ NRRL        +E+    WWD    EFF++D  L      E       +RY I R  IP++FRSIFDSG  E  Y LR   RE    N +   ++E+   +  + ++     +  EG+L ++F  FDE+M  RI++WT +++   EF+      +  N     +E      +N  R G    T N   +  IL+PMQ +MS  K A +++P++ +K TLFQ  Q       QQQ ++            + +++R+RK      GS   + +A+  ++       P++P  +     +      T    ++ +   DVM+VGEP++MG EFG+ DER+I+R+EN+QYD +   +     SLGQ P+
Sbjct:   45 VSPLEFRIHDMNRRLYIFSSTGVSENDQQQWWDAFSHEFFDDDCKLWFVIGSEPVAFASRERYIINRQFIPKFFRSIFDSGMRELQYVLRGPSRECTLANGSQAYENENVLQITRYDQSSQ-FEVNTEGKLYVEFAPFDEVMNYRIKAWTLELKRSNEFV------YNQNTADYRVEAQNPEQENKPRMGFFKSTFNLMTMLKILDPMQSIMSSAKSAPAITPREVMKRTLFQHHQVRQQNMRQQQLNQQMMIPAPEPEKPKPARKRQRKPAANPRGSKKATAAAAAAAAAATNGVPPTVPTASPANNQQFPPNPMTSQFQQMSY--PDVMVVGEPSMMGSEFGENDERTISRVENSQYDPNAMQMQ----SLGQGPN 409          
BLAST of Lim domain binding protein, putative vs. Ensembl Celegans
Match: ldb-1 (F58A3.1a; LIM Domain Binding protein [Source:UniProtKB/TrEMBL;Acc:G5EEL0])

HSP 1 Score: 144.821 bits (364), Expect = 1.144e-35
Identity = 113/378 (29.89%), Postives = 188/378 (49.74%), Query Frame = 2
Query:  440 MASIDCRLNEFNRRL-----QQRTEDCDNIWWDTLITEFFEEDAVLTVTFTDE-----GPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRS-VRESYHTN-TIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFN-FDELM--RIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFS----KNVTRCGIPNFTMNFFRICTILEPMQELMSRQK-AYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSES---------NRQTSKRRKRK------GXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPH 1468
            ++ ++ R+++ NRRL        +E+    WWD    EFF++D  L      E       +RY I R  IP++FRSIFDSG  E  Y LR   RE    N +   ++E+   +  + ++     +  EG+L ++F  FDE+M  RI++WT +++   EF+      +  N     +E      +N  R G    T N   +  IL+PMQ +MS  K A +++P++ +K TLFQ  Q       QQQ ++            + +++R+RK      GS   + +A+  ++       P++P  +     +      T    ++ +   DVM+VGEP++MG EFG+ DER+I+R+EN+QYD +   +     SLGQ P+
Sbjct:   96 VSPLEFRIHDMNRRLYIFSSTGVSENDQQQWWDAFSHEFFDDDCKLWFVIGSEPVAFASRERYIINRQFIPKFFRSIFDSGMRELQYVLRGPSRECTLANGSQAYENENVLQITRYDQSSQ-FEVNTEGKLYVEFAPFDEVMNYRIKAWTLELKRSNEFV------YNQNTADYRVEAQNPEQENKPRMGFFKSTFNLMTMLKILDPMQSIMSSAKSAPAITPREVMKRTLFQHHQVRQQNMRQQQLNQQMMIPAPEPEKPKPARKRQRKPAANPRGSKKATAAAAAAAAAATNGVPPTVPTASPANNQQFPPNPMTSQFQQMSY--PDVMVVGEPSMMGSEFGENDERTISRVENSQYDPNAMQMQ----SLGQGPN 460          
BLAST of Lim domain binding protein, putative vs. Ensembl Fly
Match: Chi (gene:FBgn0013764 transcript:FBtr0072191)

HSP 1 Score: 324.709 bits (831), Expect = 8.047e-100
Identity = 167/335 (49.85%), Postives = 223/335 (66.57%), Query Frame = 2
Query:  422 RGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLME-FSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            R +N Y +  + R+ E N+RLQQR E+ DN WWD+  TEFFE+DA LT+ F  ++GPKRYTIGRTLIPR+FRSI++ G ++ Y+ L+  +ES+H  +I +D +   ++    +    T +  + RL+L+F +D+ MRI+SW   I+ HRE I RS+ G     + ML++  +KN+TR GI N T+N+ R+C ILEPMQELMSR KAY+LSP+DCLKTTLFQKWQRMVAPPG   K +  R  +KRRKRKGSN+   + SN      Q   PS P+ +                      ++DVM+VGEPTLMGGEFG+EDER ITRLENTQYD +
Sbjct:  207 RRHNSYFSHTEHRVFELNKRLQQRNEESDNCWWDSFTTEFFEDDARLTILFCLEDGPKRYTIGRTLIPRFFRSIYEGGVSDLYFQLKHAKESFHNTSITLDCDQCTVITQHGKPFF-TKVCADARLILEFMYDDYMRIKSWHMTIKGHRELIPRSVIGTSLPPDPMLLDQITKNITRAGITNSTLNYLRLCVILEPMQELMSRHKAYALSPRDCLKTTLFQKWQRMVAPPG---KKDPQRPPNKRRKRKGSNSGGGNNSNTPPVTNQKRSPSGPSFS--------------------LSSQDVMVVGEPTLMGGEFGEEDERLITRLENTQYDGT 517          
BLAST of Lim domain binding protein, putative vs. Ensembl Fly
Match: Chi (gene:FBgn0013764 transcript:FBtr0072192)

HSP 1 Score: 323.939 bits (829), Expect = 2.523e-99
Identity = 167/335 (49.85%), Postives = 223/335 (66.57%), Query Frame = 2
Query:  422 RGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLME-FSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            R +N Y +  + R+ E N+RLQQR E+ DN WWD+  TEFFE+DA LT+ F  ++GPKRYTIGRTLIPR+FRSI++ G ++ Y+ L+  +ES+H  +I +D +   ++    +    T +  + RL+L+F +D+ MRI+SW   I+ HRE I RS+ G     + ML++  +KN+TR GI N T+N+ R+C ILEPMQELMSR KAY+LSP+DCLKTTLFQKWQRMVAPPG   K +  R  +KRRKRKGSN+   + SN      Q   PS P+ +                      ++DVM+VGEPTLMGGEFG+EDER ITRLENTQYD +
Sbjct:  226 RRHNSYFSHTEHRVFELNKRLQQRNEESDNCWWDSFTTEFFEDDARLTILFCLEDGPKRYTIGRTLIPRFFRSIYEGGVSDLYFQLKHAKESFHNTSITLDCDQCTVITQHGKPFF-TKVCADARLILEFMYDDYMRIKSWHMTIKGHRELIPRSVIGTSLPPDPMLLDQITKNITRAGITNSTLNYLRLCVILEPMQELMSRHKAYALSPRDCLKTTLFQKWQRMVAPPG---KKDPQRPPNKRRKRKGSNSGGGNNSNTPPVTNQKRSPSGPSFS--------------------LSSQDVMVVGEPTLMGGEFGEEDERLITRLENTQYDGT 536          
BLAST of Lim domain binding protein, putative vs. Ensembl Zebrafish
Match: ldb1b (LIM-domain binding 1b [Source:ZFIN;Acc:ZDB-GENE-990415-135])

HSP 1 Score: 335.88 bits (860), Expect = 1.134e-106
Identity = 177/336 (52.68%), Postives = 224/336 (66.67%), Query Frame = 2
Query:  428 NNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRK----GXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            + PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRS+F+ G TE YY L+  +ES+H N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +   N    KRRKRK     + +    ++N S+ +K+SP  S P  +Q                       DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   24 HTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSVFEGGATELYYVLKHPKESFHNNFVSLDCDQCTMVTQNGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPARQAPN----KRRKRKMSGGSNMSAGGGSNNNSNNKKKSPANSFPLSSQ---------------------VPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 333          
BLAST of Lim domain binding protein, putative vs. Ensembl Zebrafish
Match: ldb1b (LIM-domain binding 1b [Source:ZFIN;Acc:ZDB-GENE-990415-135])

HSP 1 Score: 336.65 bits (862), Expect = 1.381e-106
Identity = 177/336 (52.68%), Postives = 224/336 (66.67%), Query Frame = 2
Query:  428 NNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRK----GXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            + PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRS+F+ G TE YY L+  +ES+H N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +   N    KRRKRK     + +    ++N S+ +K+SP  S P  +Q                       DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   46 HTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSVFEGGATELYYVLKHPKESFHNNFVSLDCDQCTMVTQNGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPARQAPN----KRRKRKMSGGSNMSAGGGSNNNSNNKKKSPANSFPLSSQ---------------------VPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 355          
BLAST of Lim domain binding protein, putative vs. Ensembl Zebrafish
Match: ldb1b (LIM-domain binding 1b [Source:ZFIN;Acc:ZDB-GENE-990415-135])

HSP 1 Score: 336.65 bits (862), Expect = 1.948e-106
Identity = 177/336 (52.68%), Postives = 224/336 (66.67%), Query Frame = 2
Query:  428 NNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRK----GXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            + PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRS+F+ G TE YY L+  +ES+H N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +   N    KRRKRK     + +    ++N S+ +K+SP  S P  +Q                       DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   61 HTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSVFEGGATELYYVLKHPKESFHNNFVSLDCDQCTMVTQNGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPARQAPN----KRRKRKMSGGSNMSAGGGSNNNSNNKKKSPANSFPLSSQ---------------------VPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 370          
BLAST of Lim domain binding protein, putative vs. Ensembl Zebrafish
Match: ldb1a (LIM domain binding 1a [Source:NCBI gene;Acc:30579])

HSP 1 Score: 327.405 bits (838), Expect = 2.301e-103
Identity = 169/333 (50.75%), Postives = 221/333 (66.37%), Query Frame = 2
Query:  428 NNPYMASIDCRLNEFNRRLQQRTE-DCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            + PY    D R+ E N+RLQ  TE DCDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE +Y L+  +ES+H N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE + RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +   N++  ++     + ++    +N S+ +K+SP  S                           ++DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   24 HTPYGNQTDYRIFELNKRLQNWTEQDCDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELFYVLKHPKESFHNNFVSLDCDQCTMVTQNGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHREVVPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPARQAPNKRRKRKMSGGSTMSSGGGNNNNSNSKKKSPASSFA-----------------------LSSQDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 332          
BLAST of Lim domain binding protein, putative vs. Ensembl Zebrafish
Match: ldb2a (LIM domain binding 2a [Source:ZFIN;Acc:ZDB-GENE-990415-136])

HSP 1 Score: 326.635 bits (836), Expect = 3.389e-102
Identity = 173/347 (49.86%), Postives = 227/347 (65.42%), Query Frame = 2
Query:  422 RGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQ------------QKSESNRQ-TSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            R ++PYM   + R+ E N+RLQ RTE+ D++WWD   TEFFEEDA LT++F  ++GPKRYTIGRTLIPRYF ++F+ G T+ YY L+  +ES+H + I VD +   MV    + +  T +  EGRL+L+F FD+LMRI++W F IR +RE I RS+         +L + SKN+TR G+ NFT+N+ R+C ILEPMQELMSR K Y+LSP+DCLKT LFQKWQRMVAPP                K E  RQ T+KRRKRK S +++ ++S  +S   +   P+  N +                      ++DVM+VGEPTLMGGEFGDEDER ITRLENTQYDA+
Sbjct:   73 RRHSPYMVQPEYRIYEMNKRLQSRTEESDSLWWDAFATEFFEEDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESFHNSCITVDCDQCTMVTQHGKPMF-TKVCTEGRLILEFAFDDLMRIKTWHFNIRQYRELIPRSILAMHAQDPGVLEQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPPAGHPQNFKTEIFPTNHKKEPTRQTTTKRRKRKNSASSASNSSLGNSAGGKKRSPA-NNFS--------------------LASQDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAT 397          
BLAST of Lim domain binding protein, putative vs. Ensembl Xenopus
Match: cldn8.1 (claudin 8, gene 1 [Source:Xenbase;Acc:XB-GENE-1013205])

HSP 1 Score: 340.502 bits (872), Expect = 3.292e-108
Identity = 178/335 (53.13%), Postives = 228/335 (68.06%), Query Frame = 2
Query:  422 RGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQ-TSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            R ++PYM   + R+ E N+RLQ RTED DN+WWD   TEFFE+DA LT++F  ++GPKRYTIGRTLIPRYF ++F+ G T+ YY L+  +ESYH ++I VD +   MV    + +  T +  EGRL+L+F FD+LMRI++W F IR +RE + RS+        Q+L + SKN+TR G+ NFT+N+ R+C ILEPMQELMSR K Y+LSP+DCLKT LFQKWQRMVAPP     +E  RQ T+KRRKRK S +N+ + S  ++         LP     G    +NQ            A DVM+VGEPTLMGGEFGDEDER ITRLENTQYDA+
Sbjct:   19 RRHSPYMVQPEYRIYEMNKRLQTRTEDSDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCTMVTQHGKPMF-TKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQDPQVLEQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPP-----AEPTRQTTTKRRKRKNSTSNTSNNSTGNNTISTYNKKKLP----AGSHNLSNQ------------APDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAA 331          
BLAST of Lim domain binding protein, putative vs. Ensembl Xenopus
Match: cldn8.1 (claudin 8, gene 1 [Source:Xenbase;Acc:XB-GENE-1013205])

HSP 1 Score: 340.887 bits (873), Expect = 3.597e-108
Identity = 178/335 (53.13%), Postives = 228/335 (68.06%), Query Frame = 2
Query:  422 RGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQ-TSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            R ++PYM   + R+ E N+RLQ RTED DN+WWD   TEFFE+DA LT++F  ++GPKRYTIGRTLIPRYF ++F+ G T+ YY L+  +ESYH ++I VD +   MV    + +  T +  EGRL+L+F FD+LMRI++W F IR +RE + RS+        Q+L + SKN+TR G+ NFT+N+ R+C ILEPMQELMSR K Y+LSP+DCLKT LFQKWQRMVAPP     +E  RQ T+KRRKRK S +N+ + S  ++         LP     G    +NQ            A DVM+VGEPTLMGGEFGDEDER ITRLENTQYDA+
Sbjct:   34 RRHSPYMVQPEYRIYEMNKRLQTRTEDSDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCTMVTQHGKPMF-TKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQDPQVLEQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPP-----AEPTRQTTTKRRKRKNSTSNTSNNSTGNNTISTYNKKKLP----AGSHNLSNQ------------APDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAA 346          
BLAST of Lim domain binding protein, putative vs. Ensembl Xenopus
Match: sae1 (SUMO1 activating enzyme subunit 1 [Source:Xenbase;Acc:XB-GENE-923356])

HSP 1 Score: 337.421 bits (864), Expect = 9.024e-107
Identity = 174/330 (52.73%), Postives = 219/330 (66.36%), Query Frame = 2
Query:  434 PYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +ES+H N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +   N    KRRKRK S  ++ S+   ++    S                  +K   +   +     DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   47 PYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKESFHNNFVSLDCDQCTMVTQHGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPARQAPN----KRRKRKMSGGSTMSSGGGNTNNSNS-----------------KKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 354          
BLAST of Lim domain binding protein, putative vs. Ensembl Xenopus
Match: sae1 (SUMO1 activating enzyme subunit 1 [Source:Xenbase;Acc:XB-GENE-923356])

HSP 1 Score: 337.421 bits (864), Expect = 1.242e-106
Identity = 174/330 (52.73%), Postives = 219/330 (66.36%), Query Frame = 2
Query:  434 PYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +ES+H N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +   N    KRRKRK S  ++ S+   ++    S                  +K   +   +     DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   53 PYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKESFHNNFVSLDCDQCTMVTQHGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPARQAPN----KRRKRKMSGGSTMSSGGGNTNNSNS-----------------KKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 360          
BLAST of Lim domain binding protein, putative vs. Ensembl Xenopus
Match: sae1 (SUMO1 activating enzyme subunit 1 [Source:Xenbase;Acc:XB-GENE-923356])

HSP 1 Score: 337.421 bits (864), Expect = 1.710e-106
Identity = 174/332 (52.41%), Postives = 220/332 (66.27%), Query Frame = 2
Query:  428 NNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            + PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +ES+H N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +   N    KRRKRK S  ++ S+   ++    S                  +K   +   +     DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   60 HTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKESFHNNFVSLDCDQCTMVTQHGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPARQAPN----KRRKRKMSGGSTMSSGGGNTNNSNS-----------------KKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 369          
BLAST of Lim domain binding protein, putative vs. Ensembl Mouse
Match: Ldb1 (LIM domain binding 1 [Source:MGI Symbol;Acc:MGI:894762])

HSP 1 Score: 340.502 bits (872), Expect = 2.106e-108
Identity = 176/332 (53.01%), Postives = 223/332 (67.17%), Query Frame = 2
Query:  428 NNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            + PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +E++H+N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +    +Q SKRRKRK S  ++ S+                N N       +N K           ++DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   24 HTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPAR----QQPSKRRKRKMSGGSTMSSGGG-------------NTN------NSNSKKKSPASTFALSSQDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 331          
BLAST of Lim domain binding protein, putative vs. Ensembl Mouse
Match: Ldb1 (LIM domain binding 1 [Source:MGI Symbol;Acc:MGI:894762])

HSP 1 Score: 339.732 bits (870), Expect = 5.286e-108
Identity = 174/332 (52.41%), Postives = 223/332 (67.17%), Query Frame = 2
Query:  428 NNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            + PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +E++H+N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +    +Q SKRRKRK S  ++ S+   ++    S                  +K   +   +     DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   24 HTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPAR----QQPSKRRKRKMSGGSTMSSGGGNTNNSNS-----------------KKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 333          
BLAST of Lim domain binding protein, putative vs. Ensembl Mouse
Match: Ldb1 (LIM domain binding 1 [Source:MGI Symbol;Acc:MGI:894762])

HSP 1 Score: 339.732 bits (870), Expect = 5.286e-108
Identity = 174/332 (52.41%), Postives = 223/332 (67.17%), Query Frame = 2
Query:  428 NNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            + PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +E++H+N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +    +Q SKRRKRK S  ++ S+   ++    S                  +K   +   +     DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   24 HTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPAR----QQPSKRRKRKMSGGSTMSSGGGNTNNSNS-----------------KKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 333          
BLAST of Lim domain binding protein, putative vs. Ensembl Mouse
Match: Ldb1 (LIM domain binding 1 [Source:MGI Symbol;Acc:MGI:894762])

HSP 1 Score: 339.732 bits (870), Expect = 1.525e-107
Identity = 175/332 (52.71%), Postives = 223/332 (67.17%), Query Frame = 2
Query:  428 NNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            + PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +E++H+N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +    +Q SKRRKRK S  ++ S+                N N       + +K   +   +     DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   60 HTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPAR----QQPSKRRKRKMSGGSTMSSGGG-------------NTNN----SNSKKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 369          
BLAST of Lim domain binding protein, putative vs. Ensembl Mouse
Match: Ldb1 (LIM domain binding 1 [Source:MGI Symbol;Acc:MGI:894762])

HSP 1 Score: 339.732 bits (870), Expect = 1.525e-107
Identity = 175/332 (52.71%), Postives = 223/332 (67.17%), Query Frame = 2
Query:  428 NNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            + PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +E++H+N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +    +Q SKRRKRK S  ++ S+                N N       + +K   +   +     DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   60 HTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPAR----QQPSKRRKRKMSGGSTMSSGGG-------------NTNN----SNSKKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 369          
BLAST of Lim domain binding protein, putative vs. UniProt/SwissProt
Match: sp|Q9W676|LDB2_CHICK (LIM domain-binding protein 2 OS=Gallus gallus OX=9031 GN=LDB2 PE=2 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 3.179e-108
Identity = 175/335 (52.24%), Postives = 230/335 (68.66%), Query Frame = 2
Query:  422 RGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQ-TSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            R + PYM   + R+ E N+RLQ R+ED DN+WWD   TEFFE+DA LT++F  ++GPKRYTIGRTLIPRYF ++F+ G T+ YY L+  +ESYH ++I VD +   MV    + +  T +  EGRL+L+F FD+LMRI++W F IR +RE + RS+        Q+L + SKN+TR G+ NFT+N+ R+C ILEPMQELMSR K Y+LSP+DCLKT LFQKWQRMVAPP     +E  RQ T+KRRKRK S +++ ++S  ++                  A +TN K   A   +   ++DVM+VGEPTLMGGEFGDEDER ITRLENTQYDA+
Sbjct:   19 RRHTPYMVQPEYRIYEMNKRLQARSEDSDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCTMVTQHGKPMF-TKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILPMHAQDPQVLEQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPP-----AEPTRQPTTKRRKRKNSTSSTSNSSAGNN------------------ANSTNSKKKSAAANLSLSSQDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAA 329          
BLAST of Lim domain binding protein, putative vs. UniProt/SwissProt
Match: sp|O43679|LDB2_HUMAN (LIM domain-binding protein 2 OS=Homo sapiens OX=9606 GN=LDB2 PE=1 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 8.329e-108
Identity = 177/335 (52.84%), Postives = 229/335 (68.36%), Query Frame = 2
Query:  422 RGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQ-TSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            R + PYM   + R+ E N+RLQ RTED DN+WWD   TEFFE+DA LT++F  ++GPKRYTIGRTLIPRYF ++F+ G T+ YY L+  +ESYH ++I VD +   MV    + +  T +  EGRL+L+F FD+LMRI++W F IR +RE + RS+        Q+L + SKN+TR G+ NFT+N+ R+C ILEPMQELMSR K Y+LSP+DCLKT LFQKWQRMVAPP     +E  RQ T+KRRKRK S +++ ++S  +            N N  G  + T    T A + +     DVM+VGEPTLMGGEFGDEDER ITRLENTQYDA+
Sbjct:   19 RRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCTMVTQHGKPMF-TKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPP-----AEPTRQPTTKRRKRKNSTSSTSNSSAGN------------NANSTGSKKKT----TAANLSLSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAA 331          
BLAST of Lim domain binding protein, putative vs. UniProt/SwissProt
Match: sp|P70662|LDB1_MOUSE (LIM domain-binding protein 1 OS=Mus musculus OX=10090 GN=Ldb1 PE=1 SV=2)

HSP 1 Score: 339.732 bits (870), Expect = 1.067e-106
Identity = 175/332 (52.71%), Postives = 223/332 (67.17%), Query Frame = 2
Query:  428 NNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            + PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +E++H+N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +    +Q SKRRKRK S  ++ S+                N N       + +K   +   +     DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   60 HTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPAR----QQPSKRRKRKMSGGSTMSSGGG-------------NTNN----SNSKKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 369          
BLAST of Lim domain binding protein, putative vs. UniProt/SwissProt
Match: sp|O55203|LDB2_MOUSE (LIM domain-binding protein 2 OS=Mus musculus OX=10090 GN=Ldb2 PE=1 SV=2)

HSP 1 Score: 338.191 bits (866), Expect = 1.203e-106
Identity = 175/335 (52.24%), Postives = 228/335 (68.06%), Query Frame = 2
Query:  422 RGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQ-TSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            R + PYM   + R+ E N+RLQ RTED DN+WWD   TEFFE+DA LT++F  ++GPKRYTIGRTLIPRYF ++F+ G T+ YY L+  +ESYH ++I VD +   MV    + +  T +  EGRL+L+F FD+LMRI++W F IR +RE + RS+        Q+L + SKN+TR G+ NFT+N+ R+C ILEPMQELMSR K Y+LSP+DCLKT LFQKWQRMVAPP     +E  RQ T+KRRKRK S +++ ++S  ++             N  G  + T      A + +     DVM+VGEPTLMGGEFGDEDER ITRLENTQYDA+
Sbjct:   19 RRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCAMVTQHGKPMF-TKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPP-----AEPTRQPTTKRRKRKNSTSSTSNSSAGNTT------------NSAGSKKKT----PAASLSLATQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAA 331          
BLAST of Lim domain binding protein, putative vs. UniProt/SwissProt
Match: sp|Q86U70|LDB1_HUMAN (LIM domain-binding protein 1 OS=Homo sapiens OX=9606 GN=LDB1 PE=1 SV=2)

HSP 1 Score: 339.732 bits (870), Expect = 1.276e-106
Identity = 175/332 (52.71%), Postives = 223/332 (67.17%), Query Frame = 2
Query:  428 NNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            + PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +E++H+N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +    +Q SKRRKRK S  ++ S+                N N       + +K   +   +     DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   60 HTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPTR----QQPSKRRKRKMSGGSTMSSGGG-------------NTNN----SNSKKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 369          
BLAST of Lim domain binding protein, putative vs. TrEMBL
Match: A0A4Z2D0S7 (LIM domain-binding protein isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_006093 PE=4 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 2.293e-110
Identity = 195/326 (59.82%), Postives = 235/326 (72.09%), Query Frame = 2
Query:  452 DCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTF-TDEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXX--XXXXXQSPVPSLP--NLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYD 1414
            + R+ E N+RLQQR++DCD++WW++  T+FFE+DA LT+ F T+EGPK YTIGRTLIPRYFRSIF+SGC E YY LR   E +H   + +DSESA M MT  R++P  T+ VEGRL LDF FD+LMRIRSW F IR HRE I+RSM   G      L + SKN+TR G+ N T+NFFR+C ILEPMQELMSRQKAYSL+P+DCLKTTLFQKWQRM+         E+ RQ SKRRKRKGS+A ++  +N   +SKRKQSP+P LP  ++ QPG                     DVMIVGEPTLMGG+FGDEDER ITRLENTQYD
Sbjct:  117 ELRIFEMNKRLQQRSDDCDSLWWESFATDFFEDDATLTLAFLTEEGPKSYTIGRTLIPRYFRSIFESGCGELYYNLRLNHEYFHHPILTLDSESATMTMTMIRSIP-VTVVVEGRLTLDFAFDDLMRIRSWIFLIRTHREMIMRSM--LGIQDPAFLDQLSKNITRYGMTNTTLNFFRLCVILEPMQELMSRQKAYSLTPRDCLKTTLFQKWQRMM-------PQEATRQPSKRRKRKGSSATAEGTNNTGRTSKRKQSPIP-LPSHHIAQPG---------------------DVMIVGEPTLMGGDFGDEDERLITRLENTQYD 410          
BLAST of Lim domain binding protein, putative vs. TrEMBL
Match: A0A5N4ATK1 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_06413 PE=4 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 2.640e-110
Identity = 186/336 (55.36%), Postives = 229/336 (68.15%), Query Frame = 2
Query:  422 RGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQE-QMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQ-PGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            R + PY    D R+ E N+RLQQRTE+ DN+WWD   TEFFE+DA LT+ F  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY +R  +ES+H  +I +D +   MV    + L  T +  EGRL+L+F FD+LMRI+SW F +R HRE I RS+ G    Q+  ML + SKN+TR GI N T+N+ R+C ILEPMQELMSR KAY+LSP+DCLKTTLFQKWQRMVAPPG   K ES R  +KRRKRKGSN+     +           P +PN  + PG   +               ++DVM+VGEP+LMGGEFGDEDER ITRLENTQYDA+
Sbjct:   12 RRHTPYFGQPDYRVYELNKRLQQRTEESDNLWWDAFATEFFEDDASLTLAFCLEDGPKRYTIGRTLIPRYFRSIFEGGVTELYYNMRHPKESFHNTSITLDCDQCTMVTHHGKPLF-TKVCTEGRLILEFTFDDLMRIKSWHFTVRTHRELIPRSVVGMHSQQDPSMLDQLSKNITRQGITNSTLNYLRLCVILEPMQELMSRHKAYALSPRDCLKTTLFQKWQRMVAPPG---KRESQRPANKRRKRKGSNSGGAPNN----------APPVPNKKRSPGPNFS-------------LASQDVMVVGEPSLMGGEFGDEDERLITRLENTQYDAA 320          
BLAST of Lim domain binding protein, putative vs. TrEMBL
Match: A0A4Z2CZR9 (LIM domain-binding protein isoform 4 OS=Schistosoma japonicum OX=6182 GN=EWB00_006093 PE=4 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 4.777e-110
Identity = 195/326 (59.82%), Postives = 235/326 (72.09%), Query Frame = 2
Query:  452 DCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTF-TDEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXX--XXXXXQSPVPSLP--NLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYD 1414
            + R+ E N+RLQQR++DCD++WW++  T+FFE+DA LT+ F T+EGPK YTIGRTLIPRYFRSIF+SGC E YY LR   E +H   + +DSESA M MT  R++P  T+ VEGRL LDF FD+LMRIRSW F IR HRE I+RSM   G      L + SKN+TR G+ N T+NFFR+C ILEPMQELMSRQKAYSL+P+DCLKTTLFQKWQRM+         E+ RQ SKRRKRKGS+A ++  +N   +SKRKQSP+P LP  ++ QPG                     DVMIVGEPTLMGG+FGDEDER ITRLENTQYD
Sbjct:   46 ELRIFEMNKRLQQRSDDCDSLWWESFATDFFEDDATLTLAFLTEEGPKSYTIGRTLIPRYFRSIFESGCGELYYNLRLNHEYFHHPILTLDSESATMTMTMIRSIP-VTVVVEGRLTLDFAFDDLMRIRSWIFLIRTHREMIMRSM--LGIQDPAFLDQLSKNITRYGMTNTTLNFFRLCVILEPMQELMSRQKAYSLTPRDCLKTTLFQKWQRMMP-------QEATRQPSKRRKRKGSSATAEGTNNTGRTSKRKQSPIP-LPSHHIAQPG---------------------DVMIVGEPTLMGGDFGDEDERLITRLENTQYD 339          
BLAST of Lim domain binding protein, putative vs. TrEMBL
Match: A0A4Z2D071 (LIM domain-binding protein isoform 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_006093 PE=4 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.033e-109
Identity = 195/326 (59.82%), Postives = 235/326 (72.09%), Query Frame = 2
Query:  452 DCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTF-TDEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXX--XXXXXQSPVPSLP--NLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYD 1414
            + R+ E N+RLQQR++DCD++WW++  T+FFE+DA LT+ F T+EGPK YTIGRTLIPRYFRSIF+SGC E YY LR   E +H   + +DSESA M MT  R++P  T+ VEGRL LDF FD+LMRIRSW F IR HRE I+RSM   G      L + SKN+TR G+ N T+NFFR+C ILEPMQELMSRQKAYSL+P+DCLKTTLFQKWQRM+         E+ RQ SKRRKRKGS+A ++  +N   +SKRKQSP+P LP  ++ QPG                     DVMIVGEPTLMGG+FGDEDER ITRLENTQYD
Sbjct:  117 ELRIFEMNKRLQQRSDDCDSLWWESFATDFFEDDATLTLAFLTEEGPKSYTIGRTLIPRYFRSIFESGCGELYYNLRLNHEYFHHPILTLDSESATMTMTMIRSIP-VTVVVEGRLTLDFAFDDLMRIRSWIFLIRTHREMIMRSM--LGIQDPAFLDQLSKNITRYGMTNTTLNFFRLCVILEPMQELMSRQKAYSLTPRDCLKTTLFQKWQRMM-------PQEATRQPSKRRKRKGSSATAEGTNNTGRTSKRKQSPIP-LPSHHIAQPG---------------------DVMIVGEPTLMGGDFGDEDERLITRLENTQYD 410          
BLAST of Lim domain binding protein, putative vs. TrEMBL
Match: A0A1Y1LSE5 (LID domain-containing protein OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 1.829e-109
Identity = 186/336 (55.36%), Postives = 229/336 (68.15%), Query Frame = 2
Query:  422 RGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQE-QMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQ-PGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            R + PY    D R+ E N+RLQQRTE+ DN+WWD   TEFFE+DA LT+ F  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY +R  +ES+H  +I +D +   MV    + L  T +  EGRL+L+F FD+LMRI+SW F +R HRE I RS+ G    Q+  ML + SKN+TR GI N T+N+ R+C ILEPMQELMSR KAY+LSP+DCLKTTLFQKWQRMVAPPG   K ES R  +KRRKRKGSN+     +           P +PN  + PG   +               ++DVM+VGEP+LMGGEFGDEDER ITRLENTQYDA+
Sbjct:   61 RRHTPYFGQPDYRVYELNKRLQQRTEESDNLWWDAFATEFFEDDASLTLAFCLEDGPKRYTIGRTLIPRYFRSIFEGGVTELYYNMRHPKESFHNTSITLDCDQCTMVTHHGKPLF-TKVCTEGRLILEFTFDDLMRIKSWHFTVRTHRELIPRSVVGMHSQQDPSMLDQLSKNITRQGITNSTLNYLRLCVILEPMQELMSRHKAYALSPRDCLKTTLFQKWQRMVAPPG---KRESQRPANKRRKRKGSNSGGAPNN----------APPVPNKKRSPGPNFS-------------LASQDVMVVGEPSLMGGEFGDEDERLITRLENTQYDAA 369          
BLAST of Lim domain binding protein, putative vs. Ensembl Cavefish
Match: ldb2a (LIM domain binding 2a [Source:ZFIN;Acc:ZDB-GENE-990415-136])

HSP 1 Score: 331.643 bits (849), Expect = 4.387e-105
Identity = 176/337 (52.23%), Postives = 226/337 (67.06%), Query Frame = 2
Query:  422 RGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTS-KRRKRKGXXXXXXXXXX--XXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            R + PY+   + R+ E N+RLQ RTE+ DN+WWD   TEFFEEDA LT++F  ++GPKRYTIGRTLIPRYF ++F+ G T+ YY L+  +ES+H + I VD +   MV    + +  T +  EGRL+L+F FD+LMRI++W F IR +RE I RS+        Q+L + SKN+TR G+ NFT+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP      E  RQT+ KRRKRK S +++ ++S    +  +K+SP  S    +Q                       DVM+VGEPTLMGGEFGDEDER ITRLENTQYDA+
Sbjct:   19 RRHAPYVVQPEYRIYELNKRLQSRTEESDNLWWDAFATEFFEEDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESFHNSCITVDCDQCTMVTQHGKPMF-TKVCTEGRLILEFAFDDLMRIKTWHFTIRQYRELIPRSVLAMHAQDPQVLEQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPP------EPTRQTTTKRRKRKNSASSASNSSLGNSAGSKKRSPANSFSLTSQ---------------------VPDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAT 327          
BLAST of Lim domain binding protein, putative vs. Ensembl Cavefish
Match: ldb1a (LIM domain binding 1a [Source:NCBI gene;Acc:30579])

HSP 1 Score: 328.561 bits (841), Expect = 2.276e-103
Identity = 172/335 (51.34%), Postives = 219/335 (65.37%), Query Frame = 2
Query:  428 NNPYMASIDCRLNEFNRRLQQRTE-DCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRK--GXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            + PY    D R+ E N+RLQ  TE DCDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE +Y L+  +ES+H+N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE + RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +   N    KRRKRK  G +  S      ++   +   P+                   +   +     DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   61 HTPYGNQTDYRIFELNKRLQNWTEQDCDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELFYVLKHPKESFHSNFVSLDCDQCTMVTQNGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHREVVPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPARQAPN----KRRKRKMSGGSTVSAGGGTNNNSNSKKKSPA-------------------SSFALSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 371          
BLAST of Lim domain binding protein, putative vs. Ensembl Cavefish
Match: ldb1b (LIM domain-binding protein 1 [Source:NCBI gene;Acc:103035624])

HSP 1 Score: 326.635 bits (836), Expect = 1.148e-102
Identity = 178/338 (52.66%), Postives = 225/338 (66.57%), Query Frame = 2
Query:  422 RGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRK----GXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            R + PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +ES+H N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE I RS+        QM+ + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +  +N    KRRKRK     + +     +N S+ +K+SP  S P  +Q                       DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   59 RRHTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKESFHNNFVSLDCDQCTMVTQNGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMVDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPARPAAN----KRRKRKISGGSTMSAGGGTNNNSNSKKKSPAGSFPLSSQ---------------------VPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 370          
BLAST of Lim domain binding protein, putative vs. Ensembl Cavefish
Match: ldb1b (LIM domain-binding protein 1 [Source:NCBI gene;Acc:103035624])

HSP 1 Score: 325.479 bits (833), Expect = 3.016e-102
Identity = 177/336 (52.68%), Postives = 224/336 (66.67%), Query Frame = 2
Query:  428 NNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRK----GXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            + PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +ES+H N + +D +   MV    + +  T + VEGRL L+F FD++MRI++W F IR HRE I RS+        QM+ + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +  +N    KRRKRK     + +     +N S+ +K+SP  S P  +Q                       DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   61 HTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKESFHNNFVSLDCDQCTMVTQNGKPMF-TQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMVDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPARPAAN----KRRKRKISGGSTMSAGGGTNNNSNSKKKSPAGSFPLSSQ---------------------VPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 370          
BLAST of Lim domain binding protein, putative vs. Ensembl Cavefish
Match: ldb2b (LIM domain-binding protein 2-like [Source:NCBI gene;Acc:103041667])

HSP 1 Score: 283.108 bits (723), Expect = 1.440e-86
Identity = 153/352 (43.47%), Postives = 201/352 (57.10%), Query Frame = 2
Query:  422 RGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPT--TITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPP-------------GQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAE---TTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            R + P     D R++E N+RLQ RTEDCD +WWD   TEFFEEDA LT++F  +EGPK YTIGR LIPR+F ++F+ G  E ++ L+  +ES++ +TI VD     MV    +   PT   +  EGRL+L F FD+LMRI++W F I ++ E I RS+          L + SKN++R G+ N T+N+ R+C ILEPMQELMSR K Y LSP+DCLKT LF +WQRM  PP                +K+E  + T+KRR+R+                           N  G A    T N K            +DVM+VGEP+LMGG+ G  DER ITRLEN QYD +
Sbjct:   21 RRHAPCAVQPDYRMHELNKRLQSRTEDCDILWWDAFCTEFFEEDATLTLSFCLEEGPKTYTIGRALIPRFFSTLFEGGVYELFFELKHTKESFNNSTITVDCHQCTMVTQHGK---PTFAKVCTEGRLILVFTFDDLMRIKTWHFTISHYSELIPRSVLAVHAQDPGALEQLSKNISRVGLSNLTLNYLRLCMILEPMQELMSRHKTYGLSPRDCLKTCLFHQWQRMTTPPVGPSPSFKTEIFQSNPKKAEPAKPTAKRRRRR---------------------------NSAGSASGNTTGNSKKRSPANSFSLPTQDVMMVGEPSLMGGDVGGVDERLITRLENEQYDPT 342          
BLAST of Lim domain binding protein, putative vs. Ensembl Sea Lamprey
Match: LDB2 (LIM domain binding 2 [Source:HGNC Symbol;Acc:HGNC:6533])

HSP 1 Score: 135.576 bits (340), Expect = 7.671e-37
Identity = 81/161 (50.31%), Postives = 98/161 (60.87%), Query Frame = 2
Query:  980 RICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQ-------------QKSESNR-QTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            ++C ILEPMQELMSR K Y++SP+DCLKT LFQKWQRMVAPPG               +  E  R QT KRRKR  S +++ ++S                    G    TN+K + A       ++DVM+VGEPTLMGGEFGDEDER ITRLENTQYDA+
Sbjct:    4 QLCVILEPMQELMSRHKTYNISPRDCLKTCLFQKWQRMVAPPGTALARPALTPSRGPVRPPEPTRPQTKKRRKRNNSASSTSNSSV-------------------GPNNGTNKKKSPAGSNFSLASQDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAA 145          
BLAST of Lim domain binding protein, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005039.1 (pep scaffold:Pmarinus_7.0:GL480470:8268:13407:1 gene:ENSPMAG00000004584.1 transcript:ENSPMAT00000005039.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 4.778e-19
Identity = 38/79 (48.10%), Postives = 51/79 (64.56%), Query Frame = 2
Query:  761 LPP----TTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRI 985
            LPP    + +  EGRL+L+F FD++MRIRSW F IR HRE I RS+         ML + SKN+TR G+ N T+N+ R+
Sbjct:    4 LPPRPRFSQVCTEGRLILEFAFDDMMRIRSWHFTIRQHRELIPRSLLAVHAQDPSMLEQLSKNITRNGLTNITLNYLRV 82          
BLAST of Lim domain binding protein, putative vs. Ensembl Nematostella
Match: LDB (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S437])

HSP 1 Score: 319.701 bits (818), Expect = 1.642e-101
Identity = 170/350 (48.57%), Postives = 223/350 (63.71%), Query Frame = 2
Query:  422 RGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQP-GCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAP 1465
            R + PY    D R+ E NRRLQQRTE+ DN+WWD+ +TEFFEEDA LT+ F  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L   +ESYH  TI +D E+  M+ +  + +  T +  EGRL+L+F FD++MRIR+W F I  HRE I R++         ML + SKNVTR G+ NFT+N+ R+C ILEPMQELMSR K Y+++P+DCLK+TLFQ+WQRM APP             + R+++ S+                   S PN + P     + ++K +          +DVM+VGEP+LMGGEFGDEDER ITRLENTQ+D++  N  G     G +P
Sbjct:    7 RRHTPYYTHPDVRIYELNRRLQQRTEESDNLWWDSFVTEFFEEDATLTLNFCLEDGPKRYTIGRTLIPRYFRSIFEGGVTELYYHLLQPKESYHNTTITLDCENTTMITSHIKPVY-TKVCTEGRLILEFTFDDMMRIRNWHFTIMQHREMIPRNV--VAMQDPGMLEQVSKNVTRQGMTNFTLNYLRLCVILEPMQELMSRHKTYNMNPRDCLKSTLFQRWQRMCAPPVTAYSVSPETPRPRTRRKRKSS-------------------STPNASTPTSSGNSHSKKKSPTASNFSLATQDVMVVGEPSLMGGEFGDEDERLITRLENTQFDST--NGVGEDAPFGSSP 332          
BLAST of Lim domain binding protein, putative vs. Ensembl Nematostella
Match: EDO27910 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7Y6])

HSP 1 Score: 204.527 bits (519), Expect = 1.292e-60
Identity = 103/197 (52.28%), Postives = 136/197 (69.04%), Query Frame = 2
Query:  422 RGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRI--CTILEP 1003
            R + PY    D R+ E NRRLQQRTE+ DN+WWD+ +TEFFEEDA LT+ F  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L   +ESYH  TI +D E+  M+ +  + +  T +  EGRL+L+F FD++MRIR+W F I  HRE I R++         ML + SKNVTR G+ NFT+N+ R+  C+++ P
Sbjct:    7 RRHTPYYTHPDVRIYELNRRLQQRTEESDNLWWDSFVTEFFEEDATLTLNFCLEDGPKRYTIGRTLIPRYFRSIFEGGVTELYYHLLQPKESYHNTTITLDCENTTMITSHIKPV-YTKVCTEGRLILEFTFDDMMRIRNWHFTIMQHREMIPRNVVAM--QDPGMLEQVSKNVTRQGMTNFTLNYLRVSTCSVIFP 200          
BLAST of Lim domain binding protein, putative vs. Ensembl Medaka
Match: ldb1b (LIM domain-binding protein 1 [Source:NCBI gene;Acc:101158085])

HSP 1 Score: 337.806 bits (865), Expect = 1.974e-107
Identity = 172/330 (52.12%), Postives = 219/330 (66.36%), Query Frame = 2
Query:  434 PYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +ES+H N + +D +   MV    + +  T + VEGRL L+F FDE+MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +   N++  ++     + +    A+  S+ +K+SP    P  +Q                       DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   20 PYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKESFHNNFVSLDCDQCTMVTQNGKPMF-TQVCVEGRLYLEFMFDEMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPSRQAPNKRRKRKISGGSTISGGGGANTNSNNKKKSPGSGFPLSSQ---------------------VPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 327          
BLAST of Lim domain binding protein, putative vs. Ensembl Medaka
Match: ldb1b (LIM domain-binding protein 1 [Source:NCBI gene;Acc:101158085])

HSP 1 Score: 337.421 bits (864), Expect = 3.194e-107
Identity = 172/330 (52.12%), Postives = 219/330 (66.36%), Query Frame = 2
Query:  434 PYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +ES+H N + +D +   MV    + +  T + VEGRL L+F FDE+MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +   N++  ++     + +    A+  S+ +K+SP    P  +Q                       DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   26 PYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKESFHNNFVSLDCDQCTMVTQNGKPMF-TQVCVEGRLYLEFMFDEMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPSRQAPNKRRKRKISGGSTISGGGGANTNSNNKKKSPGSGFPLSSQ---------------------VPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 333          
BLAST of Lim domain binding protein, putative vs. Ensembl Medaka
Match: ldb1b (LIM domain-binding protein 1 [Source:NCBI gene;Acc:101158085])

HSP 1 Score: 337.421 bits (864), Expect = 3.194e-107
Identity = 172/330 (52.12%), Postives = 219/330 (66.36%), Query Frame = 2
Query:  434 PYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +ES+H N + +D +   MV    + +  T + VEGRL L+F FDE+MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +   N++  ++     + +    A+  S+ +K+SP    P  +Q                       DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   26 PYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKESFHNNFVSLDCDQCTMVTQNGKPMF-TQVCVEGRLYLEFMFDEMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPSRQAPNKRRKRKISGGSTISGGGGANTNSNNKKKSPGSGFPLSSQ---------------------VPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 333          
BLAST of Lim domain binding protein, putative vs. Ensembl Medaka
Match: ldb1b (LIM domain-binding protein 1 [Source:NCBI gene;Acc:101158085])

HSP 1 Score: 337.421 bits (864), Expect = 1.000e-106
Identity = 172/330 (52.12%), Postives = 219/330 (66.36%), Query Frame = 2
Query:  434 PYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +ES+H N + +D +   MV    + +  T + VEGRL L+F FDE+MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +   N++  ++     + +    A+  S+ +K+SP    P  +Q                       DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:   63 PYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKESFHNNFVSLDCDQCTMVTQNGKPMF-TQVCVEGRLYLEFMFDEMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPSRQAPNKRRKRKISGGSTISGGGGANTNSNNKKKSPGSGFPLSSQ---------------------VPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 370          
BLAST of Lim domain binding protein, putative vs. Ensembl Medaka
Match: ldb1b (LIM domain-binding protein 1 [Source:NCBI gene;Acc:101158085])

HSP 1 Score: 338.191 bits (866), Expect = 2.900e-106
Identity = 172/332 (51.81%), Postives = 220/332 (66.27%), Query Frame = 2
Query:  428 NNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFT-DEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDAS 1420
            + PY    D R+ E N+RLQ  TE+CDN+WWD   TEFFE+DA+LT+TF  ++GPKRYTIGRTLIPRYFRSIF+ G TE YY L+  +ES+H N + +D +   MV    + +  T + VEGRL L+F FDE+MRI++W F IR HRE I RS+        QML + SKN+TRCG+ N T+N+ R+C ILEPMQELMSR K YSLSP+DCLKT LFQKWQRMVAPP +  +   N++  ++     + +    A+  S+ +K+SP    P  +Q                       DVM+VGEPTLMGGEFGDEDER ITRLENTQ+DA+
Sbjct:  122 HTPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKESFHNNFVSLDCDQCTMVTQNGKPMF-TQVCVEGRLYLEFMFDEMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPSRQAPNKRRKRKISGGSTISGGGGANTNSNNKKKSPGSGFPLSSQ---------------------VPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAA 431          
BLAST of Lim domain binding protein, putative vs. Planmine SMEST
Match: SMESG000005149.1 (SMESG000005149.1)

HSP 1 Score: 816.224 bits (2107), Expect = 0.000e+0
Identity = 499/572 (87.24%), Postives = 503/572 (87.94%), Query Frame = 2
Query:  119 MNLRMPSIMSGNVNGPSLSASVMNSNSGPMMDSGVPMLHPNQYALAGMMPHGNPHLHDREIMIG--MPVGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFTDEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPHLPNMSGPHMAMSLS---------------------------GSVNNNMPPIXXXXXXXXXXXXXXDSRITNCSQYSTGGNTPGKKIPLXXXXXXXXXXXXXVKNGPPRPTSQGANQMPDK 1747
            MNLRMPSIMSG                 PMMDSGVPMLHPNQYALAGMMPHGNPHLHDREIMIG  MPVGAMGPNPHGGMPHLGPHMMHPHHPHHNHPNLPMGRGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFTDEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGSNANSDSASNRSSKRKQSPVPSLPNLNQPG                     DVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPHLPNMSGPHMAMSLS                            + +++MPPISSNLNGSLNNLLKSDSRITNCSQYSTGGNTPGKKIPLSQEQISEEQSSRSVKNGPPRPTSQGANQMPDK
Sbjct:    1 MNLRMPSIMSG-----------------PMMDSGVPMLHPNQYALAGMMPHGNPHLHDREIMIGSGMPVGAMGPNPHGGMPHLGPHMMHPHHPHHNHPNLPMGRGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFTDEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGSNANSDSASNRSSKRKQSPVPSLPNLNQPG---------------------DVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPHLPNMSGPHMAMSLSGSVNNSNNNQYSMSGADQISNFNSNTPDTKSSDMPPISSNLNGSLNNLLKSDSRITNCSQYSTGGNTPGKKIPLSQEQISEEQSSRSVKNGPPRPTSQGANQMPDK 534          
BLAST of Lim domain binding protein, putative vs. Planmine SMEST
Match: SMESG000005149.1 (SMESG000005149.1)

HSP 1 Score: 815.453 bits (2105), Expect = 0.000e+0
Identity = 497/568 (87.50%), Postives = 501/568 (88.20%), Query Frame = 2
Query:  119 MNLRMPSIMSGNVNGPSLSASVMNSNSGPMMDSGVPMLHPNQYALAGMMPHGNPHLHDREIMIGMPVGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFTDEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPHLPNMSGPHMAMSLS---------------------------GSVNNNMPPIXXXXXXXXXXXXXXDSRITNCSQYSTGGNTPGKKIPLXXXXXXXXXXXXXVKNGPPRPTSQGANQMP 1741
            MNLRMPSIMSG                 PMMDSGVPMLHPNQYALAGMMPHGNPHLHDREIMIGMPVGAMGPNPHGGMPHLGPHMMHPHHPHHNHPNLPMGRGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFTDEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGSNANSDSASNRSSKRKQSPVPSLPNLNQPG                     DVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPHLPNMSGPHMAMSLS                            + +++MPPISSNLNGSLNNLLKSDSRITNCSQYSTGGNTPGKKIPLSQEQISEEQSSRSVKNGPPRPTSQGANQMP
Sbjct:    1 MNLRMPSIMSG-----------------PMMDSGVPMLHPNQYALAGMMPHGNPHLHDREIMIGMPVGAMGPNPHGGMPHLGPHMMHPHHPHHNHPNLPMGRGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFTDEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGSNANSDSASNRSSKRKQSPVPSLPNLNQPG---------------------DVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPHLPNMSGPHMAMSLSGSVNNSNNNQYSMSGADQISNFNSNTPDTKSSDMPPISSNLNGSLNNLLKSDSRITNCSQYSTGGNTPGKKIPLSQEQISEEQSSRSVKNGPPRPTSQGANQMP 530          

HSP 2 Score: 116.316 bits (290), Expect = 1.398e-26
Identity = 54/56 (96.43%), Postives = 54/56 (96.43%), Query Frame = 1
Query: 2074 QYIAYQDGIFGFTTDNLLEFSDKNGDILNDHQRPISEPLPMISGPANTDNKICADT 2241
            Q  AYQDGIFGFTTDNLLEFSDKNGDILNDHQRPISEPLPMISGPANTDNKICADT
Sbjct:  528 QMPAYQDGIFGFTTDNLLEFSDKNGDILNDHQRPISEPLPMISGPANTDNKICADT 583          
BLAST of Lim domain binding protein, putative vs. Planmine SMEST
Match: SMESG000005149.1 (SMESG000005149.1)

HSP 1 Score: 811.601 bits (2095), Expect = 0.000e+0
Identity = 497/570 (87.19%), Postives = 501/570 (87.89%), Query Frame = 2
Query:  119 MNLRMPSIMSGNVNGPSLSASVMNSNSGPMMDSGVPMLHPNQYALAGMMPHGNPHLHDREIMIG--MPVGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFTDEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPHLPNMSGPHMAMSLS---------------------------GSVNNNMPPIXXXXXXXXXXXXXXDSRITNCSQYSTGGNTPGKKIPLXXXXXXXXXXXXXVKNGPPRPTSQGANQMP 1741
            MNLRMPSIMSG                 PMMDSGVPMLHPNQYALAGMMPHGNPHLHDREIMIG  MPVGAMGPNPHGGMPHLGPHMMHPHHPHHNHPNLPMGRGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFTDEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGSNANSDSASNRSSKRKQSPVPSLPNLNQPG                     DVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPHLPNMSGPHMAMSLS                            + +++MPPISSNLNGSLNNLLKSDSRITNCSQYSTGGNTPGKKIPLSQEQISEEQSSRSVKNGPPRPTSQGANQMP
Sbjct:    1 MNLRMPSIMSG-----------------PMMDSGVPMLHPNQYALAGMMPHGNPHLHDREIMIGSGMPVGAMGPNPHGGMPHLGPHMMHPHHPHHNHPNLPMGRGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFTDEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGSNANSDSASNRSSKRKQSPVPSLPNLNQPG---------------------DVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPHLPNMSGPHMAMSLSGSVNNSNNNQYSMSGADQISNFNSNTPDTKSSDMPPISSNLNGSLNNLLKSDSRITNCSQYSTGGNTPGKKIPLSQEQISEEQSSRSVKNGPPRPTSQGANQMP 532          

HSP 2 Score: 78.1814 bits (191), Expect = 1.509e-14
Identity = 40/56 (71.43%), Postives = 40/56 (71.43%), Query Frame = 1
Query: 2074 QYIAYQDGIFGFTTDNLLEFSDKNGDILNDHQRPISEPLPMISGPANTDNKICADT 2241
            Q  AYQD              DKNGDILNDHQRPISEPLPMISGPANTDNKICADT
Sbjct:  530 QMPAYQD--------------DKNGDILNDHQRPISEPLPMISGPANTDNKICADT 571          
BLAST of Lim domain binding protein, putative vs. Planmine SMEST
Match: SMESG000005149.1 (SMESG000005149.1)

HSP 1 Score: 810.831 bits (2093), Expect = 0.000e+0
Identity = 497/570 (87.19%), Postives = 501/570 (87.89%), Query Frame = 2
Query:  119 MNLRMPSIMSGNVNGPSLSASVMNSNSGPMMDSGVPMLHPNQYALAGMMPHGNPHLHDREIMIG--MPVGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFTDEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPHLPNMSGPHMAMSLS---------------------------GSVNNNMPPIXXXXXXXXXXXXXXDSRITNCSQYSTGGNTPGKKIPLXXXXXXXXXXXXXVKNGPPRPTSQGANQMP 1741
            MNLRMPSIMSG                 PMMDSGVPMLHPNQYALAGMMPHGNPHLHDREIMIG  MPVGAMGPNPHGGMPHLGPHMMHPHHPHHNHPNLPMGRGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFTDEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGSNANSDSASNRSSKRKQSPVPSLPNLNQPG                     DVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPHLPNMSGPHMAMSLS                            + +++MPPISSNLNGSLNNLLKSDSRITNCSQYSTGGNTPGKKIPLSQEQISEEQSSRSVKNGPPRPTSQGANQMP
Sbjct:    1 MNLRMPSIMSG-----------------PMMDSGVPMLHPNQYALAGMMPHGNPHLHDREIMIGSGMPVGAMGPNPHGGMPHLGPHMMHPHHPHHNHPNLPMGRGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFTDEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGSNANSDSASNRSSKRKQSPVPSLPNLNQPG---------------------DVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPHLPNMSGPHMAMSLSGSVNNSNNNQYSMSGADQISNFNSNTPDTKSSDMPPISSNLNGSLNNLLKSDSRITNCSQYSTGGNTPGKKIPLSQEQISEEQSSRSVKNGPPRPTSQGANQMP 532          

HSP 2 Score: 115.931 bits (289), Expect = 1.454e-26
Identity = 54/56 (96.43%), Postives = 54/56 (96.43%), Query Frame = 1
Query: 2074 QYIAYQDGIFGFTTDNLLEFSDKNGDILNDHQRPISEPLPMISGPANTDNKICADT 2241
            Q  AYQDGIFGFTTDNLLEFSDKNGDILNDHQRPISEPLPMISGPANTDNKICADT
Sbjct:  530 QMPAYQDGIFGFTTDNLLEFSDKNGDILNDHQRPISEPLPMISGPANTDNKICADT 585          
BLAST of Lim domain binding protein, putative vs. Planmine SMEST
Match: SMESG000005149.1 (SMESG000005149.1)

HSP 1 Score: 810.446 bits (2092), Expect = 0.000e+0
Identity = 488/542 (90.04%), Postives = 492/542 (90.77%), Query Frame = 2
Query:  197 SGPMMDSGVPMLHPNQYALAGMMPHGNPHLHDREIMIGMPVGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFTDEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGXXXXXXXXXXXXXXXXQSPVPSLPNLNQPGCAETTNQK*TVAIIRI*FVAEDVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPHLPNMSGPHMAMSLS---------------------------GSVNNNMPPIXXXXXXXXXXXXXXDSRITNCSQYSTGGNTPGKKIPLXXXXXXXXXXXXXVKNGPPRPTSQGANQMP 1741
            SGPMMDSGVPMLHPNQYALAGMMPHGNPHLHDREIMIGMPVGAMGPNPHGGMPHLGPHMMHPHHPHHNHPNLPMGRGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFTDEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGSNANSDSASNRSSKRKQSPVPSLPNLNQPG                     DVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPHLPNMSGPHMAMSLS                            + +++MPPISSNLNGSLNNLLKSDSRITNCSQYSTGGNTPGKKIPLSQEQISEEQSSRSVKNGPPRPTSQGANQMP
Sbjct:    6 SGPMMDSGVPMLHPNQYALAGMMPHGNPHLHDREIMIGMPVGAMGPNPHGGMPHLGPHMMHPHHPHHNHPNLPMGRGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTVTFTDEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVVDSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHREFILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELMSRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGSNANSDSASNRSSKRKQSPVPSLPNLNQPG---------------------DVMIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPHLPNMSGPHMAMSLSGSVNNSNNNQYSMSGADQISNFNSNTPDTKSSDMPPISSNLNGSLNNLLKSDSRITNCSQYSTGGNTPGKKIPLSQEQISEEQSSRSVKNGPPRPTSQGANQMP 526          

HSP 2 Score: 115.931 bits (289), Expect = 1.387e-26
Identity = 54/56 (96.43%), Postives = 54/56 (96.43%), Query Frame = 1
Query: 2074 QYIAYQDGIFGFTTDNLLEFSDKNGDILNDHQRPISEPLPMISGPANTDNKICADT 2241
            Q  AYQDGIFGFTTDNLLEFSDKNGDILNDHQRPISEPLPMISGPANTDNKICADT
Sbjct:  524 QMPAYQDGIFGFTTDNLLEFSDKNGDILNDHQRPISEPLPMISGPANTDNKICADT 579          
The following BLAST results are available for this feature:
BLAST of Lim domain binding protein, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LDB21.734e-10852.84LIM domain binding 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
LDB21.767e-10852.84LIM domain binding 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
LDB11.095e-10753.01LIM domain binding 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
LDB11.174e-10752.41LIM domain binding 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
LDB12.657e-10752.71LIM domain binding 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Lim domain binding protein, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ldb-13.780e-3629.89F58A3.1a; LIM Domain Binding protein [Source:UniP... [more]
ldb-13.780e-3629.89F58A3.1a; LIM Domain Binding protein [Source:UniP... [more]
ldb-14.725e-3629.89F58A3.1a; LIM Domain Binding protein [Source:UniP... [more]
ldb-11.144e-3529.89F58A3.1a; LIM Domain Binding protein [Source:UniP... [more]
back to top
BLAST of Lim domain binding protein, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Chi8.047e-10049.85gene:FBgn0013764 transcript:FBtr0072191[more]
Chi2.523e-9949.85gene:FBgn0013764 transcript:FBtr0072192[more]
back to top
BLAST of Lim domain binding protein, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ldb1b1.134e-10652.68LIM-domain binding 1b [Source:ZFIN;Acc:ZDB-GENE-99... [more]
ldb1b1.381e-10652.68LIM-domain binding 1b [Source:ZFIN;Acc:ZDB-GENE-99... [more]
ldb1b1.948e-10652.68LIM-domain binding 1b [Source:ZFIN;Acc:ZDB-GENE-99... [more]
ldb1a2.301e-10350.75LIM domain binding 1a [Source:NCBI gene;Acc:30579][more]
ldb2a3.389e-10249.86LIM domain binding 2a [Source:ZFIN;Acc:ZDB-GENE-99... [more]
back to top
BLAST of Lim domain binding protein, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cldn8.13.292e-10853.13claudin 8, gene 1 [Source:Xenbase;Acc:XB-GENE-1013... [more]
cldn8.13.597e-10853.13claudin 8, gene 1 [Source:Xenbase;Acc:XB-GENE-1013... [more]
sae19.024e-10752.73SUMO1 activating enzyme subunit 1 [Source:Xenbase;... [more]
sae11.242e-10652.73SUMO1 activating enzyme subunit 1 [Source:Xenbase;... [more]
sae11.710e-10652.41SUMO1 activating enzyme subunit 1 [Source:Xenbase;... [more]
back to top
BLAST of Lim domain binding protein, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ldb12.106e-10853.01LIM domain binding 1 [Source:MGI Symbol;Acc:MGI:89... [more]
Ldb15.286e-10852.41LIM domain binding 1 [Source:MGI Symbol;Acc:MGI:89... [more]
Ldb15.286e-10852.41LIM domain binding 1 [Source:MGI Symbol;Acc:MGI:89... [more]
Ldb11.525e-10752.71LIM domain binding 1 [Source:MGI Symbol;Acc:MGI:89... [more]
Ldb11.525e-10752.71LIM domain binding 1 [Source:MGI Symbol;Acc:MGI:89... [more]
back to top
BLAST of Lim domain binding protein, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W676|LDB2_CHICK3.179e-10852.24LIM domain-binding protein 2 OS=Gallus gallus OX=9... [more]
sp|O43679|LDB2_HUMAN8.329e-10852.84LIM domain-binding protein 2 OS=Homo sapiens OX=96... [more]
sp|P70662|LDB1_MOUSE1.067e-10652.71LIM domain-binding protein 1 OS=Mus musculus OX=10... [more]
sp|O55203|LDB2_MOUSE1.203e-10652.24LIM domain-binding protein 2 OS=Mus musculus OX=10... [more]
sp|Q86U70|LDB1_HUMAN1.276e-10652.71LIM domain-binding protein 1 OS=Homo sapiens OX=96... [more]
back to top
BLAST of Lim domain binding protein, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2D0S72.293e-11059.82LIM domain-binding protein isoform 2 OS=Schistosom... [more]
A0A5N4ATK12.640e-11055.36Uncharacterized protein OS=Photinus pyralis OX=705... [more]
A0A4Z2CZR94.777e-11059.82LIM domain-binding protein isoform 4 OS=Schistosom... [more]
A0A4Z2D0711.033e-10959.82LIM domain-binding protein isoform 3 OS=Schistosom... [more]
A0A1Y1LSE51.829e-10955.36LID domain-containing protein OS=Photinus pyralis ... [more]
back to top
BLAST of Lim domain binding protein, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ldb2a4.387e-10552.23LIM domain binding 2a [Source:ZFIN;Acc:ZDB-GENE-99... [more]
ldb1a2.276e-10351.34LIM domain binding 1a [Source:NCBI gene;Acc:30579][more]
ldb1b1.148e-10252.66LIM domain-binding protein 1 [Source:NCBI gene;Acc... [more]
ldb1b3.016e-10252.68LIM domain-binding protein 1 [Source:NCBI gene;Acc... [more]
ldb2b1.440e-8643.47LIM domain-binding protein 2-like [Source:NCBI gen... [more]
back to top
BLAST of Lim domain binding protein, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
LDB27.671e-3750.31LIM domain binding 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
ENSPMAT00000005039.14.778e-1948.10pep scaffold:Pmarinus_7.0:GL480470:8268:13407:1 ge... [more]
back to top
BLAST of Lim domain binding protein, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lim domain binding protein, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
LDB1.642e-10148.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279101.292e-6052.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lim domain binding protein, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ldb1b1.974e-10752.12LIM domain-binding protein 1 [Source:NCBI gene;Acc... [more]
ldb1b3.194e-10752.12LIM domain-binding protein 1 [Source:NCBI gene;Acc... [more]
ldb1b3.194e-10752.12LIM domain-binding protein 1 [Source:NCBI gene;Acc... [more]
ldb1b1.000e-10652.12LIM domain-binding protein 1 [Source:NCBI gene;Acc... [more]
ldb1b2.900e-10651.81LIM domain-binding protein 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Lim domain binding protein, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005149.10.000e+087.24SMESG000005149.1[more]
SMESG000005149.11.398e-2687.50SMESG000005149.1[more]
SMESG000005149.11.509e-1487.19SMESG000005149.1[more]
SMESG000005149.11.454e-2687.19SMESG000005149.1[more]
SMESG000005149.11.387e-2690.04SMESG000005149.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034496 ID=SMED30034496|Name=Lim domain binding protein, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=2782bp
CTGCCATTTTCGTATGAGTTTATAAATAAATCACTTTTATACTTGTTTAT
GTAAATAATTAGTTCTTCGGACGTCTAATTATCATTATATAACAGTAGCA
CTGTAATAAACCCGTATAATGAATCTCAGAATGCCATCTATTATGTCCGG
TAATGTTAATGGTCCATCTTTATCGGCCTCAGTTATGAATAGTAACTCAG
GTCCAATGATGGATTCTGGGGTTCCAATGTTACACCCTAATCAGTATGCT
TTAGCTGGAATGATGCCACATGGAAATCCTCATTTACACGATCGAGAGAT
CATGATAGGAATGCCTGTTGGAGCAATGGGACCAAATCCACATGGTGGAA
TGCCTCATTTGGGACCTCACATGATGCACCCACACCATCCACACCATAAT
CATCCAAATTTACCAATGGGTCGAGGGAACAATCCATATATGGCATCTAT
TGATTGTAGGTTAAATGAATTCAATAGACGTCTTCAACAAAGAACTGAAG
ATTGTGATAATATTTGGTGGGATACATTGATTACTGAGTTTTTTGAAGAA
GACGCTGTTTTAACCGTAACTTTTACCGACGAAGGGCCGAAAAGATATAC
TATAGGTCGCACTTTGATTCCCCGTTATTTCCGCAGTATTTTTGATAGTG
GTTGTACTGAATATTATTATTTCTTACGTTCGGTACGAGAAAGCTATCAC
ACTAATACTATTGTGGTTGATAGCGAATCAGCTCAAATGGTAATGACATT
CCCTAGAACTTTGCCTCCGACAACAATCACAGTAGAAGGCCGTTTACTTC
TCGATTTCAATTTTGACGAATTAATGCGGATCAGAAGTTGGACTTTTCAG
ATCAGAAATCATCGTGAATTTATTTTAAGATCAATGCCTGGATTTGGTTG
CAATCAAGAACAAATGCTTATGGAGTTTTCAAAAAACGTTACACGATGTG
GAATTCCTAATTTTACAATGAATTTCTTTCGAATTTGTACAATTCTCGAA
CCAATGCAGGAATTAATGTCCAGACAAAAAGCATATAGCCTCAGTCCGAA
AGATTGTTTAAAAACTACTTTATTCCAAAAATGGCAACGCATGGTAGCTC
CACCAGGTCAGCAGCAAAAATCAGAATCTAATCGTCAAACTAGCAAACGC
AGAAAAAGAAAAGGATCAAATGCGAATTCAGATTCAGCTTCTAATCGTAG
TTCGAAGCGGAAACAAAGTCCTGTTCCATCTCTGCCTAATCTGAATCAAC
CTGGATGTGCCGAAACAACAAATCAGAAATGAACTGTAGCTATTATTCGA
ATCTGATTCGTTGCTGAGGATGTTATGATTGTGGGCGAACCAACTTTAAT
GGGTGGCGAATTCGGCGATGAAGACGAGCGCTCAATTACTCGATTAGAAA
ATACACAATATGATGCTTCTGGAAACAATATTTCCGGACCGATAATGTCT
TTAGGTCAAGCTCCACATTTACCGAACATGAGTGGTCCACACATGGCAAT
GTCTTTGTCCGGCTCAGTAAACAATAATATGCCTCCCATATCTTCCAATC
TCAATGGTTCCTTAAATAACCTCCTCAAATCAGATTCTCGAATTACTAAT
TGTTCTCAATATTCGACCGGTGGAAATACACCAGGTAAAAAGATACCGTT
ATCACAGGAGCAGATTTCTGAAGAACAATCTTCCCGATCAGTAAAAAATG
GACCTCCTCGACCAACATCACAAGGCGCAAATCAAATGCCAGACAAATAA
ACTCCAAGTCCAGAGAAGCTAATTTTATTAGTTAATAAATGCAGATATTT
ACCCGAATAGATTATATTTATTTAATAATATTCATTAAATTGCATCATAT
TATAAACTTCTTAAATGTGGGATGTTAATAATTGTGTAAATACTCCCAAT
TGATTTGTGCAGGTGTGCACATTCTGCTACGGTTATCTATCTCTATATAC
ATTCCATTAGTATTTAAATGATAATTCAATGGAGATTGTCATGTTTTACT
ATATCAGATCAATGAAACAGAGCCTAAATTTAATCACCACACTGCTTATG
AACGACTGTTTGTTTATCTGGTACAATATATAGCTTATCAAGACGGTATA
TTTGGATTCACAACAGACAATTTACTGGAATTTTCAGATAAAAATGGTGA
TATATTGAATGATCACCAAAGACCGATAAGCGAACCTCTACCAATGATTT
CTGGTCCTGCAAATACAGACAACAAAATATGCGCTGATACTTAAATTTGA
TTAAGCTACTTTTGTACGTGGCTGTGTTCATAATTTGTAAAATATATATA
ATTAATTACATTTATAAATACTCTATCGTTATTGTGGTTTGGTTTTTTGT
TGAGGTAAACAATGATTATTTGTATAATTTGTAAATGATCAAACTTTAGG
AATAATAATAATTTTTATTAAACCATTTTATCATGATTATTTATGCGATT
AAATGTTCCATGATTTTTGAATAAATATTGAAATCGTTTTGAAATTTTGT
ATGAATTAAAATCTTGCGAATTCAAATGTTTATTTATTGATGATGATTTA
TACACTTGTTTTTGTATTTTTCAATATCTTGTTAAAAACTGTATTATTTA
TTTTTACTTGAATGTTATTTTCGAATACTAAAGTGAATGTTATTTAGTCT
TTTTCATAGGAGGAATTTGTTGATATGCGGTCTATTGTTGTACATTCAAA
TATGGATGTATTGATAGCTTGATTTGTTATCTCTGAGACTCCTTAAGGAT
TTATGGACTTAAATAAAAATGAGAGATCGGAA
back to top

protein sequence of SMED30034496-orf-1

>SMED30034496-orf-1 ID=SMED30034496-orf-1|Name=SMED30034496-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=142bp
MIVGEPTLMGGEFGDEDERSITRLENTQYDASGNNISGPIMSLGQAPHLP
NMSGPHMAMSLSGSVNNNMPPISSNLNGSLNNLLKSDSRITNCSQYSTGG
NTPGKKIPLSQEQISEEQSSRSVKNGPPRPTSQGANQMPDK*
back to top

protein sequence of SMED30034496-orf-2

>SMED30034496-orf-2 ID=SMED30034496-orf-2|Name=SMED30034496-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=388bp
MNLRMPSIMSGNVNGPSLSASVMNSNSGPMMDSGVPMLHPNQYALAGMMP
HGNPHLHDREIMIGMPVGAMGPNPHGGMPHLGPHMMHPHHPHHNHPNLPM
GRGNNPYMASIDCRLNEFNRRLQQRTEDCDNIWWDTLITEFFEEDAVLTV
TFTDEGPKRYTIGRTLIPRYFRSIFDSGCTEYYYFLRSVRESYHTNTIVV
DSESAQMVMTFPRTLPPTTITVEGRLLLDFNFDELMRIRSWTFQIRNHRE
FILRSMPGFGCNQEQMLMEFSKNVTRCGIPNFTMNFFRICTILEPMQELM
SRQKAYSLSPKDCLKTTLFQKWQRMVAPPGQQQKSESNRQTSKRRKRKGS
NANSDSASNRSSKRKQSPVPSLPNLNQPGCAETTNQK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003712transcription cofactor activity
GO:0050660flavin adenine dinucleotide binding
GO:0071949FAD binding
GO:0000989transcription factor activity, transcription factor binding
GO:0030274LIM domain binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR029005LIM-bd/SEUSS
IPR030167LDB1
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029005LIM-domain binding protein/SEUSSPFAMPF01803LIM_bindcoord: 271..315
e-value: 5.1E-11
score: 42.6
coord: 114..255
e-value: 3.0E-33
score: 115.4
IPR029005LIM-domain binding protein/SEUSSPANTHERPTHR10378LIM DOMAIN-BINDING PROTEINcoord: 81..373
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 325..387
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 352..387
IPR030167LIM domain-binding protein 1PANTHERPTHR10378:SF7LIM DOMAIN-BINDING PROTEIN 1coord: 81..373