Ubiquitin carboxyl-terminal hydrolase

Overview
NameUbiquitin carboxyl-terminal hydrolase
Smed IDSMED30034487
Length (bp)1644
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin carboxyl-terminal hydrolase (SMED30034487) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase (SMED30034487) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin carboxyl-terminal hydrolase (SMED30034487) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase (SMED30034487) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034487

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30034487h1SMcG0006607 SmedASXL_008083SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30034487h1SMcG0006607 Contig54235newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034487h1SMcG0006607 Contig54235uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30034487h1SMcG0006607 dd_Smed_v4_2505_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034487h1SMcG0006607 dd_Smed_v4_2505_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034487h1SMcG0006607 dd_Smed_v4_2505_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034487h1SMcG0006607 dd_Smed_v4_2505_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034487h1SMcG0006607 dd_Smed_v4_2505_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP14 (ubiquitin specific peptidase 14 [Source:HGNC Symbol;Acc:HGNC:12612])

HSP 1 Score: 463.381 bits (1191), Expect = 8.544e-159
Identity = 239/499 (47.90%), Postives = 340/499 (68.14%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEK-WDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSS---KANESDSQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGK----NGNWNFVDQFLTGRFDVKTTNTESEED-IQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            MP+Y V +KW KEKF  +E +TD+PP  FKA +F+L+GV P RQKVM+ GGTLK+  W  IK+K+G+T++MMG+++ L      +K  F+EDMT+ Q+  A++LP GL N+GNTCY+NAT+QC+R++PE+  A+K  +   +A+   + A+++    R +F SM+     I PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+ +    + +  +   S       +   + +DQF    F+     TESEE+ +   +E  LQLSCFI+++VKYL TG++  L+  +TK S +L R+ALY +SSKISRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LDMYE CT EL+ KM   R K+K +EDKK   +  +   + S +       +++ P+ ++DDIGSNN G Y+LQA++THQGRSSSSGHYV WV++  D W+K+DDD V+ VT EDILRLSGGGDWH AYVLLYGP+ +E
Sbjct:    1 MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNGMTLLMMGSADALPEEPS-AKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFA-------EKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQ-----KEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVE 486          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP14 (ubiquitin specific peptidase 14 [Source:HGNC Symbol;Acc:HGNC:12612])

HSP 1 Score: 451.44 bits (1160), Expect = 3.454e-154
Identity = 235/498 (47.19%), Postives = 333/498 (66.87%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEKWDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSS---KANESDSQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGK----NGNWNFVDQFLTGRFDVKTTNTESEED-IQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            MP+Y V +KW KEKF  +E +TD+PP  FKA +F+L+GV P RQKVM+ GGTLK          G+T++MMG+++ L      +K  F+EDMT+ Q+  A++LP GL N+GNTCY+NAT+QC+R++PE+  A+K  +   +A+   + A+++    R +F SM+     I PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+ +    + +  +   S       +   + +DQF    F+     TESEE+ +   +E  LQLSCFI+++VKYL TG++  L+  +TK S +L R+ALY +SSKISRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LDMYE CT EL+ KM   R K+K +EDKK   +  +   + S +       +++ P+ ++DDIGSNN G Y+LQA++THQGRSSSSGHYV WV++  D W+K+DDD V+ VT EDILRLSGGGDWH AYVLLYGP+ +E
Sbjct:    1 MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLK----------GMTLLMMGSADALPEEPS-AKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFA-------EKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQ-----KEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVE 475          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP14 (ubiquitin specific peptidase 14 [Source:HGNC Symbol;Acc:HGNC:12612])

HSP 1 Score: 420.239 bits (1079), Expect = 2.433e-142
Identity = 225/499 (45.09%), Postives = 316/499 (63.33%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEK-WDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSS---KANESDSQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGK----NGNWNFVDQFLTGRFDVKTTNTESEED-IQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            MP+Y V +KW KEKF  +E +TD+PP  FKA +F+L+GV P RQKVM+ GGTLK+  W  IK+K+                                    ++LP GL N+GNTCY+NAT+QC+R++PE+  A+K  +   +A+   + A+++    R +F SM+     I PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+ +    + +  +   S       +   + +DQF    F+     TESEE+ +   +E  LQLSCFI+++VKYL TG++  L+  +TK S +L R+ALY +SSKISRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LDMYE CT EL+ KM   R K+K +EDKK   +  +   + S +       +++ P+ ++DDIGSNN G Y+LQA++THQGRSSSSGHYV WV++  D W+K+DDD V+ VT EDILRLSGGGDWH AYVLLYGP+ +E
Sbjct:    1 MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKN------------------------------------MELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFA-------EKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQ-----KEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVE 451          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP14 (ubiquitin specific peptidase 14 [Source:HGNC Symbol;Acc:HGNC:12612])

HSP 1 Score: 412.149 bits (1058), Expect = 2.704e-139
Identity = 221/498 (44.38%), Postives = 309/498 (62.05%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEKWDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSS---KANESDSQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGK----NGNWNFVDQFLTGRFDVKTTNTESEED-IQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            MP+Y V +KW KEKF  +E +TD+PP  FKA +F+L+GV P RQKVM+ GGTLK                                              ++LP GL N+GNTCY+NAT+QC+R++PE+  A+K  +   +A+   + A+++    R +F SM+     I PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+ +    + +  +   S       +   + +DQF    F+     TESEE+ +   +E  LQLSCFI+++VKYL TG++  L+  +TK S +L R+ALY +SSKISRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LDMYE CT EL+ KM   R K+K +EDKK   +  +   + S +       +++ P+ ++DDIGSNN G Y+LQA++THQGRSSSSGHYV WV++  D W+K+DDD V+ VT EDILRLSGGGDWH AYVLLYGP+ +E
Sbjct:    1 MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLK----------------------------------------------MELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFA-------EKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQ-----KEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVE 440          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP27X (ubiquitin specific peptidase 27 X-linked [Source:HGNC Symbol;Acc:HGNC:13486])

HSP 1 Score: 57.7658 bits (138), Expect = 2.920e-8
Identity = 48/184 (26.09%), Postives = 77/184 (41.85%), Query Frame = 2
Query:  983 YKRSSK---ISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            Y+ S+K   +++LP      F RF +  K+R   KI   I F + LDM  F                             SK++  + +++L  ++              NN   Y L A+V HQG +  SGHY  ++R   D W K DD  +T+ + +D+L   G       Y+L Y  +++E
Sbjct:  290 YQESTKQLTMNKLPVVACFHFKRFEHSAKQR--RKITTYISFPLELDMTPFMAS--------------------------SKESRMNGQLQLPTNS-------------GNNENKYSLFAVVNHQG-TLESGHYTSFIRHHKDQWFKCDDAVITKASIKDVLDSEG-------YLLFYHKQVLE 424          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: usp-14 (Ubiquitin carboxyl-terminal hydrolase 14 [Source:UniProtKB/Swiss-Prot;Acc:Q17361])

HSP 1 Score: 326.25 bits (835), Expect = 9.372e-106
Identity = 200/508 (39.37%), Postives = 287/508 (56.50%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTL-KEKWDGIKLKDGVTIMMMGTSEELLTVGEISKPKFI----EDMTDSQITKALKL-PQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSKANESDSQARFVLNLGRLIFSMETAEV-------PIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGRFDVKTTNT--ESEEDIQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGD-IWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIEKNP 1534
            MPI  VN+KWQKEK+  +E DT  PP  FKA +F+L+ V P+RQKV++ G TL  + W+GI +K+ +TIMMMG+      VGEI KP  +    +   D Q  +   L P GL N+GNTCY N+ +Q L+ + E+   +K + +    +   R   NL  L  S+   +        PI P   + +L +  PQF                 QQDANEC   I+ ++ +                +G +G WN    F   R   +TT    ES+E  +   E   QL+C++++DV++LQTGI+ G E  +T+ SE L+RDA ++++++ISRLP YL++   RF+YKE  + NAKILK ++F + LD Y+ C+ ELK K+   R   KL ED K E E   K  ++    K+    +   P  + DD GSNNSG Y+L+ I+TH+GRSS  GHYV W+R   D  W  +DD++VT V  E IL+ SGGGDWH AYVLLY  ++I++ P
Sbjct:    1 MPI--VNVKWQKEKYV-VEVDTSAPPMVFKAQLFALTQVVPERQKVVIMGRTLGDDDWEGITIKENMTIMMMGS------VGEIPKPPTVLEKKQANRDKQAEEISALYPCGLANLGNTCYFNSCVQMLKEVNEL--VLKPAEEMRIREHNDRLCHNLATLFNSLRDKDRALRSKGEPIKPFAAILTLSDSFPQFEK-------------FKQQDANECLVSIMSNVTRI---------------YGLSG-WNIESLF---RIQTETTMKCLESDEVSEKKVERNNQLTCYVNQDVRFLQTGIKAGFEEEMTRNSEELNRDAKWQKNTQISRLPKYLTVNINRFFYKESTKTNAKILKSVQFPMQLDTYDLCSQELKDKLVARRADIKLEEDAKLERELRKKVLDKEQGDKIFDDGV-ALPTAFEDDAGSNNSGFYDLKGIITHKGRSSQDGHYVAWMRSSEDGKWRLFDDEHVTVVDEEAILKTSGGGDWHSAYVLLYEARVIKQFP 464          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp14 (gene:FBgn0032216 transcript:FBtr0331669)

HSP 1 Score: 472.241 bits (1214), Expect = 6.685e-163
Identity = 237/492 (48.17%), Postives = 332/492 (67.48%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEKWDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIK-MSSKANESDSQARFVLNLGRLIFSMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGRFDVKTTNTES-EEDIQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIEK 1528
            MP +KV +KW +E + DI  +TD+ P  FKA +F+L+GV PDRQKVM  GG LK+    +++KDG  ++++G+ E +  V   +  KFIEDM +++   A++LP GL N+GNTCY+NAT+QCL  +PE+  A+   S+   ++ S A  + +  + IF+       + PI+ L++LH   PQFA T       G      QQDANECWAEI++ LQ+ +  P N      P +  +  + +F+DQF  G F+VK ++ E  +E   +T E FLQLSCFI  DVKY+Q+G+++ ++  L K SE+L RDA Y R+  +SRLPAYL++QFVRF YK KE INAK+LKDIKF I  D +E CT EL+ K+ PMR K+K +EDKK E + + K+NE + E    K ++++  +W+ DD+GSNNSG Y LQA++TH+GRSSSSGHYV WVR  GD+W K+DDD V+ V  ++ILRLSGGGDWHCAYVLLY P+ +EK
Sbjct:    1 MPAFKVKVKWGRELYTDIVVNTDEEPILFKAQLFALTGVQPDRQKVMCKGGILKDDQWNLQIKDGAVVLLLGSKESVPEV-PATPVKFIEDMNEAEAATAMRLPAGLTNLGNTCYMNATVQCLNAVPELRTALSTFSNDGTDTMSTAFSISSAMKSIFAQMEKGTTVTPIVLLQALHRASPQFAQT-------GENGTYRQQDANECWAEILKMLQQKLR-PKNQE----PSNTVQKRHSSFIDQFFGGTFEVKMSSEEDPDEPSTVTSENFLQLSCFISMDVKYMQSGLKSKMKEQLVKKSETLGRDAKYIRTYLVSRLPAYLTVQFVRFQYKGKEGINAKVLKDIKFPIDFDAFELCTPELQNKLCPMRSKFKDLEDKKMEVD-VVKRNEPNEE----KKDVKYEQFWFDDDLGSNNSGYYTLQAVLTHKGRSSSSGHYVAWVRSSGDVWFKFDDDEVSAVATDEILRLSGGGDWHCAYVLLYAPRRLEK 474          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp14 (gene:FBgn0032216 transcript:FBtr0080061)

HSP 1 Score: 472.241 bits (1214), Expect = 6.685e-163
Identity = 237/492 (48.17%), Postives = 332/492 (67.48%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEKWDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIK-MSSKANESDSQARFVLNLGRLIFSMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGRFDVKTTNTES-EEDIQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIEK 1528
            MP +KV +KW +E + DI  +TD+ P  FKA +F+L+GV PDRQKVM  GG LK+    +++KDG  ++++G+ E +  V   +  KFIEDM +++   A++LP GL N+GNTCY+NAT+QCL  +PE+  A+   S+   ++ S A  + +  + IF+       + PI+ L++LH   PQFA T       G      QQDANECWAEI++ LQ+ +  P N      P +  +  + +F+DQF  G F+VK ++ E  +E   +T E FLQLSCFI  DVKY+Q+G+++ ++  L K SE+L RDA Y R+  +SRLPAYL++QFVRF YK KE INAK+LKDIKF I  D +E CT EL+ K+ PMR K+K +EDKK E + + K+NE + E    K ++++  +W+ DD+GSNNSG Y LQA++TH+GRSSSSGHYV WVR  GD+W K+DDD V+ V  ++ILRLSGGGDWHCAYVLLY P+ +EK
Sbjct:    1 MPAFKVKVKWGRELYTDIVVNTDEEPILFKAQLFALTGVQPDRQKVMCKGGILKDDQWNLQIKDGAVVLLLGSKESVPEV-PATPVKFIEDMNEAEAATAMRLPAGLTNLGNTCYMNATVQCLNAVPELRTALSTFSNDGTDTMSTAFSISSAMKSIFAQMEKGTTVTPIVLLQALHRASPQFAQT-------GENGTYRQQDANECWAEILKMLQQKLR-PKNQE----PSNTVQKRHSSFIDQFFGGTFEVKMSSEEDPDEPSTVTSENFLQLSCFISMDVKYMQSGLKSKMKEQLVKKSETLGRDAKYIRTYLVSRLPAYLTVQFVRFQYKGKEGINAKVLKDIKFPIDFDAFELCTPELQNKLCPMRSKFKDLEDKKMEVD-VVKRNEPNEE----KKDVKYEQFWFDDDLGSNNSGYYTLQAVLTHKGRSSSSGHYVAWVRSSGDVWFKFDDDEVSAVATDEILRLSGGGDWHCAYVLLYAPRRLEK 474          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp47 (gene:FBgn0016756 transcript:FBtr0306259)

HSP 1 Score: 53.1434 bits (126), Expect = 6.503e-7
Identity = 84/393 (21.37%), Postives = 148/393 (37.66%), Query Frame = 2
Query:  374 GLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSKANESDSQARFVLNLGRLIFSMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGRFD--VKTTNTESEE-------DIQLTQEPFLQLSCF--IDKDVK-YLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSG-------------IYELQAIVTHQGRSSSSGHYVGWVRQV-GDIWLKYDDDYVTQVTAEDILRLSGG 1474
            GL N   TCYLN+ +Q L   PE   A+      N+++++      L +L  +++T+  P A +                     E    T     D+ E W       Q  +     + F+ +   F      N +     G+ +  VK     +E+       DI L   PF   S +  I++ ++ ++Q    +G    L    E   +     +       P  L+L   RF +  +     K+   + F   L++  F      +  Q  +    + +   A++    + +  S+ V    S+ +H      +D G + S              +YEL AI+ H G S+S GHY  +++    + W  ++D  VT +T EDI R  GG
Sbjct:  379 GLVNQAMTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAK-NIPYQLQKLFLNLQTS--PKAAV---------------------ETTDLTRSFGWDSTEAWQ------QHDIQELCRVMFDALEHKFKNTKQANLISNLYEGKMNDYVKCLECNTEKTREDTFLDIPLPVRPFGSSSAYGSIEEALRAFVQPETLDGNNQYLC---EKCKKKCDAHKGLHFKSFPYILTLHLKRFDFDYQTMHRIKLNDRVTFPQTLNLNTFINRSGNSGEQNSQLNGTVDDCSTADSGSAMEDDNLSSGVVTTASSSQHENDLNDEDEGIDMSSSTSKSAKQGSGPYLYELFAIMIHSG-SASGGHYYAYIKDFDNNEWFCFNDQNVTSITQEDIQRSFGG 737          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp47 (gene:FBgn0016756 transcript:FBtr0077096)

HSP 1 Score: 53.1434 bits (126), Expect = 7.535e-7
Identity = 84/393 (21.37%), Postives = 148/393 (37.66%), Query Frame = 2
Query:  374 GLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSKANESDSQARFVLNLGRLIFSMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGRFD--VKTTNTESEE-------DIQLTQEPFLQLSCF--IDKDVK-YLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSG-------------IYELQAIVTHQGRSSSSGHYVGWVRQV-GDIWLKYDDDYVTQVTAEDILRLSGG 1474
            GL N   TCYLN+ +Q L   PE   A+      N+++++      L +L  +++T+                 P+ A   T      G       D+ E W       Q  +     + F+ +   F      N +     G+ +  VK     +E+       DI L   PF   S +  I++ ++ ++Q    +G    L    E   +     +       P  L+L   RF +  +     K+   + F   L++  F      +  Q  +    + +   A++    + +  S+ V    S+ +H      +D G + S              +YEL AI+ H G S+S GHY  +++    + W  ++D  VT +T EDI R  GG
Sbjct:  397 GLVNQAMTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAK-NIPYQLQKLFLNLQTS-----------------PKAAVETTDLTRSFG------WDSTEAWQ------QHDIQELCRVMFDALEHKFKNTKQANLISNLYEGKMNDYVKCLECNTEKTREDTFLDIPLPVRPFGSSSAYGSIEEALRAFVQPETLDGNNQYLC---EKCKKKCDAHKGLHFKSFPYILTLHLKRFDFDYQTMHRIKLNDRVTFPQTLNLNTFINRSGNSGEQNSQLNGTVDDCSTADSGSAMEDDNLSSGVVTTASSSQHENDLNDEDEGIDMSSSTSKSAKQGSGPYLYELFAIMIHSG-SASGGHYYAYIKDFDNNEWFCFNDQNVTSITQEDIQRSFGG 755          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp47 (gene:FBgn0016756 transcript:FBtr0077095)

HSP 1 Score: 53.1434 bits (126), Expect = 7.535e-7
Identity = 84/393 (21.37%), Postives = 148/393 (37.66%), Query Frame = 2
Query:  374 GLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSKANESDSQARFVLNLGRLIFSMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGRFD--VKTTNTESEE-------DIQLTQEPFLQLSCF--IDKDVK-YLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSG-------------IYELQAIVTHQGRSSSSGHYVGWVRQV-GDIWLKYDDDYVTQVTAEDILRLSGG 1474
            GL N   TCYLN+ +Q L   PE   A+      N+++++      L +L  +++T+                 P+ A   T      G       D+ E W       Q  +     + F+ +   F      N +     G+ +  VK     +E+       DI L   PF   S +  I++ ++ ++Q    +G    L    E   +     +       P  L+L   RF +  +     K+   + F   L++  F      +  Q  +    + +   A++    + +  S+ V    S+ +H      +D G + S              +YEL AI+ H G S+S GHY  +++    + W  ++D  VT +T EDI R  GG
Sbjct:  397 GLVNQAMTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAK-NIPYQLQKLFLNLQTS-----------------PKAAVETTDLTRSFG------WDSTEAWQ------QHDIQELCRVMFDALEHKFKNTKQANLISNLYEGKMNDYVKCLECNTEKTREDTFLDIPLPVRPFGSSSAYGSIEEALRAFVQPETLDGNNQYLC---EKCKKKCDAHKGLHFKSFPYILTLHLKRFDFDYQTMHRIKLNDRVTFPQTLNLNTFINRSGNSGEQNSQLNGTVDDCSTADSGSAMEDDNLSSGVVTTASSSQHENDLNDEDEGIDMSSSTSKSAKQGSGPYLYELFAIMIHSG-SASGGHYYAYIKDFDNNEWFCFNDQNVTSITQEDIQRSFGG 755          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp14 (ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) [Source:ZFIN;Acc:ZDB-GENE-030131-7676])

HSP 1 Score: 485.337 bits (1248), Expect = 1.177e-167
Identity = 248/501 (49.50%), Postives = 352/501 (70.26%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKE-KWDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSKANES---DSQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVY-----IPSNINFNDIPDSFGKNGNWNFVDQFLTGRFD--VKTTNTESEEDIQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            MP++ VN+KW KEKF+ +E +T++PP  FKA +F+L+GV P+RQKVM+ GGTLK+ +W  IKLK+G+T++MMG+++ L     + +P F+EDMT+ Q+  A++LP GL N+GNTCY+NAT+QCLR++PE+  A++  S A  S   ++ ++++    R ++ SM+     I PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+ +       P   + +    +  K  +  F+DQ+    F+  +K T  E EE  + T E  LQLSCFI+++VKYL TG+R  L+  +TKFS SL R+ALY +SSKISRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LD+YE CT EL+ KM  +R K+K MEDKK E ++ S+ N++   +K  K    + P+ + DD+GSNNSG YELQA++THQGRSSSSGHYV WV++  D W+K+DDD V+ VT EDIL+LSGGGDWH AYVLLYGP+ +E
Sbjct:    1 MPVFTVNVKWGKEKFDAVELNTEEPPMVFKAQLFALTGVQPERQKVMVKGGTLKDDEWGNIKLKNGMTLLMMGSADAL-PEEPVVRPMFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCLRSVPELKGALRRYSGALRSSGANAPSQYITAALRDLYESMDKTSSSIPPIILLQFLHMAFPQFA-------EKGDQGQYLQQDANECWVQVMRVLQQKLEPQEPETPMETDGDSAAAASTKKKS--FIDQYFGVEFETSMKCTEAEDEEPTKGT-ESQLQLSCFINQEVKYLATGLRLRLQEDITKFSPSLQRNALYIKSSKISRLPAYLTVQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCTSELQEKMVSLRSKFKEMEDKKLEKQQQSEPNKKPGALKETK----YEPFSFPDDLGSNNSGYYELQAVLTHQGRSSSSGHYVAWVKRKEDEWVKFDDDKVSVVTPEDILKLSGGGDWHIAYVLLYGPRRLE 486          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp22 (ubiquitin specific peptidase 22 [Source:NCBI gene;Acc:692275])

HSP 1 Score: 52.373 bits (124), Expect = 9.500e-7
Identity = 50/185 (27.03%), Postives = 72/185 (38.92%), Query Frame = 2
Query:  983 YKRSSK---ISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGS-NNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            Y+ S+K   + RLP        RF +  K R   KI   + F + LDM  F     +++M                       N Q                 Y   + S NN   Y L A+V HQG +  SGHY  ++RQ  D W K DD  +T+ + +D+L   G       Y+L Y  + +E
Sbjct:  330 YQESTKQLTMKRLPIVACFHLKRFEHSAKLR--RKITTYVSFPLELDMTPFMASSKESRM-----------------------NGQ-----------------YQQPVDSLNNDNKYSLFAVVNHQG-TLESGHYTTFIRQHKDQWFKCDDAIITKASIKDVLDSEG-------YLLFYHKQFLE 464          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp22 (ubiquitin specific peptidase 22 [Source:NCBI gene;Acc:692275])

HSP 1 Score: 52.373 bits (124), Expect = 9.703e-7
Identity = 50/185 (27.03%), Postives = 72/185 (38.92%), Query Frame = 2
Query:  983 YKRSSK---ISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGS-NNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            Y+ S+K   + RLP        RF +  K R   KI   + F + LDM  F     +++M                       N Q                 Y   + S NN   Y L A+V HQG +  SGHY  ++RQ  D W K DD  +T+ + +D+L   G       Y+L Y  + +E
Sbjct:  370 YQESTKQLTMKRLPIVACFHLKRFEHSAKLR--RKITTYVSFPLELDMTPFMASSKESRM-----------------------NGQ-----------------YQQPVDSLNNDNKYSLFAVVNHQG-TLESGHYTTFIRQHKDQWFKCDDAIITKASIKDVLDSEG-------YLLFYHKQFLE 504          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp37 (ubiquitin specific peptidase 37 [Source:NCBI gene;Acc:768201])

HSP 1 Score: 51.2174 bits (121), Expect = 2.887e-6
Identity = 68/278 (24.46%), Postives = 120/278 (43.17%), Query Frame = 2
Query:  371 QGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSKANESDSQARFVLNLGRLIFSMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGR-----------FDVKTTNT-ESEEDIQLTQEPFLQLSCFIDKDVKYL-QTGIRNGLETSLT----KFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKM 1153
            QG  N+GNTCY+NA +Q L ++P     +       +     R  +N     F+   A+  I+P    K L     + A + T   E+  G   MQ DA+E  ++ +  L++ V    N ++ + P ++ +  +    D+  T R           F+V+ T T +S  ++ L +E F  LS  + +  K L    I++ L+        ++S           S K SRLP  L L   R+ Y  +  +N+K+ + +     L +   CTD  ++ +
Sbjct:  322 QGFSNLGNTCYMNAILQSLFSLPSFSNDL-----LKQGIPWKRVPINALLRRFAHLLAKKDISPPEVKKDLLRRV-KNAISSTA--ERFSG--YMQNDAHEFLSQCLDQLKEDVE-KINKSWKNEPSAWDEPQSTRLADEVDTSRIYTCPVTVNMEFEVQHTITCKSCGEVVLKREQFNDLSIDLPRRRKTLPMRSIQDSLDLFFRMEEIEYSCEKCSGKAATVSHKFSRLPRVLILHLKRYSYNTQLSLNSKLGQQVLIPKYLTLLSHCTDATRSPL 588          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp37 (ubiquitin specific peptidase 37 [Source:NCBI gene;Acc:768201])

HSP 1 Score: 51.2174 bits (121), Expect = 2.906e-6
Identity = 68/278 (24.46%), Postives = 120/278 (43.17%), Query Frame = 2
Query:  371 QGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSKANESDSQARFVLNLGRLIFSMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGR-----------FDVKTTNT-ESEEDIQLTQEPFLQLSCFIDKDVKYL-QTGIRNGLETSLT----KFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKM 1153
            QG  N+GNTCY+NA +Q L ++P     +       +     R  +N     F+   A+  I+P    K L     + A + T   E+  G   MQ DA+E  ++ +  L++ V    N ++ + P ++ +  +    D+  T R           F+V+ T T +S  ++ L +E F  LS  + +  K L    I++ L+        ++S           S K SRLP  L L   R+ Y  +  +N+K+ + +     L +   CTD  ++ +
Sbjct:  322 QGFSNLGNTCYMNAILQSLFSLPSFSNDL-----LKQGIPWKRVPINALLRRFAHLLAKKDISPPEVKKDLLRRV-KNAISSTA--ERFSG--YMQNDAHEFLSQCLDQLKEDVE-KINKSWKNEPSAWDEPQSTRLADEVDTSRIYTCPVTVNMEFEVQHTITCKSCGEVVLKREQFNDLSIDLPRRRKTLPMRSIQDSLDLFFRMEEIEYSCEKCSGKAATVSHKFSRLPRVLILHLKRYSYNTQLSLNSKLGQQVLIPKYLTLLSHCTDATRSPL 588          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: zmiz1 (zinc finger, MIZ-type containing 1 [Source:Xenbase;Acc:XB-GENE-1021737])

HSP 1 Score: 483.026 bits (1242), Expect = 1.650e-166
Identity = 245/500 (49.00%), Postives = 350/500 (70.00%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEK-WDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSS---KANESDSQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQK---TVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGRFDVKTTNTESE-EDIQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIEKN 1531
            MP+Y VN+KW KEKF+++E +TD+PP  FKA +F+L+GV PDRQKVM+ GGTLK+  W  +K+K G+T++MMG++E L     + +P F+EDMT+ Q+  A++LP GL N+GNTCY+NAT+QC+R++PE+ +A+K  +   +A+   + A+++    R +F SM+     I PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+    +   S++  +    +     N +F+DQF    F+     TESE E++  ++E  LQLSCFI+++VKYL TG++  L+  +TKFS SL R+ALY ++S+ISRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LD+YE CT EL+ KM   R K+K +EDKK  +E+  K N+ S      +  + + PY +  D+GS NSG YELQA++THQGRSSSSGHYV WV++  D W+K+DDD V+ V+ EDILRLSGGGDWH AYVLLYGP+ IE +
Sbjct:    1 MPLYSVNVKWGKEKFDNVELNTDEPPMVFKAQLFALTGVQPDRQKVMVKGGTLKDDDWGTLKIKSGMTLLMMGSAEALPEEPAV-RPVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKEALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFA-------EKGDQGQYLQQDANECWVQVMRVLQQKLEAIEGDSDMETDSGAAATASKKN-SFIDQFFGIEFESTMKCTESEDEEVTKSKETQLQLSCFINQEVKYLFTGLKLRLQEEITKFSPSLQRNALYIKTSRISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDIYELCTPELQEKMVSYRSKFKQLEDKKG-SEQAPKANQMS------QREVRYEPYAFPGDVGSINSGYYELQAVLTHQGRSSSSGHYVSWVKRKHDEWIKFDDDKVSIVSPEDILRLSGGGDWHIAYVLLYGPRRIEAS 484          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: zmiz1 (zinc finger, MIZ-type containing 1 [Source:Xenbase;Acc:XB-GENE-1021737])

HSP 1 Score: 478.404 bits (1230), Expect = 1.090e-164
Identity = 245/502 (48.80%), Postives = 351/502 (69.92%), Query Frame = 2
Query:   59 MPIY--KVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEK-WDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSS---KANESDSQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQK---TVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGRFDVKTTNTESE-EDIQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIEKN 1531
            +P+Y  KVN+KW KEKF+++E +TD+PP  FKA +F+L+GV PDRQKVM+ GGTLK+  W  +K+K G+T++MMG++E L     + +P F+EDMT+ Q+  A++LP GL N+GNTCY+NAT+QC+R++PE+ +A+K  +   +A+   + A+++    R +F SM+     I PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+    +   S++  +    +     N +F+DQF    F+     TESE E++  ++E  LQLSCFI+++VKYL TG++  L+  +TKFS SL R+ALY ++S+ISRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LD+YE CT EL+ KM   R K+K +EDKK  +E+  K N+ S      +  + + PY +  D+GS NSG YELQA++THQGRSSSSGHYV WV++  D W+K+DDD V+ V+ EDILRLSGGGDWH AYVLLYGP+ IE +
Sbjct:    1 VPVYQTKVNVKWGKEKFDNVELNTDEPPMVFKAQLFALTGVQPDRQKVMVKGGTLKDDDWGTLKIKSGMTLLMMGSAEALPEEPAV-RPVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKEALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFA-------EKGDQGQYLQQDANECWVQVMRVLQQKLEAIEGDSDMETDSGAAATASKKN-SFIDQFFGIEFESTMKCTESEDEEVTKSKETQLQLSCFINQEVKYLFTGLKLRLQEEITKFSPSLQRNALYIKTSRISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDIYELCTPELQEKMVSYRSKFKQLEDKKG-SEQAPKANQMS------QREVRYEPYAFPGDVGSINSGYYELQAVLTHQGRSSSSGHYVSWVKRKHDEWIKFDDDKVSIVSPEDILRLSGGGDWHIAYVLLYGPRRIEAS 486          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: zmiz1 (zinc finger, MIZ-type containing 1 [Source:Xenbase;Acc:XB-GENE-1021737])

HSP 1 Score: 469.544 bits (1207), Expect = 2.056e-161
Identity = 245/498 (49.20%), Postives = 342/498 (68.67%), Query Frame = 2
Query:   59 MPIY--KVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEK-WDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSKANESDSQARFVLNLGRLIFSMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQK---TVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGRFDVKTTNTESE-EDIQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIEKN 1531
            +P+Y  KVN+KW KEKF+++E +TD+PP  FKA +F+L+GV PDRQKVM+ GGTLK+  W  +K+K G+T++MMG++E L     + +P F+EDMT+ Q+  A++LP GL N+GNTCY+NAT+QC+R++PE+ +A+K   K   S S     + L  L  SM+     I PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+    +   S++  +    +     N +F+DQF    F+     TESE E++  ++E  LQLSCFI+++VKYL TG++  L+  +TKFS SL R+ALY ++S+ISRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LD+YE CT EL+ KM   R K+K +EDKK         +EQ+      K  + + PY +  D+GS NSG YELQA++THQGRSSSSGHYV WV++  D W+K+DDD V+ V+ EDILRLSGGGDWH AYVLLYGP+ IE +
Sbjct:    1 VPVYQTKVNVKWGKEKFDNVELNTDEPPMVFKAQLFALTGVQPDRQKVMVKGGTLKDDDWGTLKIKSGMTLLMMGSAEALPEEPAV-RPVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKEALKRFLKYLISFS----FVALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFA-------EKGDQGQYLQQDANECWVQVMRVLQQKLEAIEGDSDMETDSGAAATASKKN-SFIDQFFGIEFESTMKCTESEDEEVTKSKETQLQLSCFINQEVKYLFTGLKLRLQEEITKFSPSLQRNALYIKTSRISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDIYELCTPELQEKMVSYRSKFKQLEDKKG--------SEQAP-----KREVRYEPYAFPGDVGSINSGYYELQAVLTHQGRSSSSGHYVSWVKRKHDEWIKFDDDKVSIVSPEDILRLSGGGDWHIAYVLLYGPRRIEAS 472          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: zmiz1 (zinc finger, MIZ-type containing 1 [Source:Xenbase;Acc:XB-GENE-1021737])

HSP 1 Score: 469.544 bits (1207), Expect = 2.596e-161
Identity = 240/498 (48.19%), Postives = 346/498 (69.48%), Query Frame = 2
Query:   65 IYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEK-WDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSS---KANESDSQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQK---TVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGRFDVKTTNTESE-EDIQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIEKN 1531
            I  +N+KW KEKF+++E +TD+PP  FKA +F+L+GV PDRQKVM+ GGTLK+  W  +K+K G+T++MMG++E L     + +P F+EDMT+ Q+  A++LP GL N+GNTCY+NAT+QC+R++PE+ +A+K  +   +A+   + A+++    R +F SM+     I PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+    +   S++  +    +     N +F+DQF    F+     TESE E++  ++E  LQLSCFI+++VKYL TG++  L+  +TKFS SL R+ALY ++S+ISRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LD+YE CT EL+ KM   R K+K +EDKK         +EQ+ +  + +  + + PY +  D+GS NSG YELQA++THQGRSSSSGHYV WV++  D W+K+DDD V+ V+ EDILRLSGGGDWH AYVLLYGP+ IE +
Sbjct:    8 IIFMNVKWGKEKFDNVELNTDEPPMVFKAQLFALTGVQPDRQKVMVKGGTLKDDDWGTLKIKSGMTLLMMGSAEALPEEPAV-RPVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKEALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFA-------EKGDQGQYLQQDANECWVQVMRVLQQKLEAIEGDSDMETDSGAAATASKKN-SFIDQFFGIEFESTMKCTESEDEEVTKSKETQLQLSCFINQEVKYLFTGLKLRLQEEITKFSPSLQRNALYIKTSRISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDIYELCTPELQEKMVSYRSKFKQLEDKKG--------SEQANQ--MSQREVRYEPYAFPGDVGSINSGYYELQAVLTHQGRSSSSGHYVSWVKRKHDEWIKFDDDKVSIVSPEDILRLSGGGDWHIAYVLLYGPRRIEAS 486          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: zmiz1 (zinc finger, MIZ-type containing 1 [Source:Xenbase;Acc:XB-GENE-1021737])

HSP 1 Score: 468.003 bits (1203), Expect = 8.033e-161
Identity = 242/501 (48.30%), Postives = 345/501 (68.86%), Query Frame = 2
Query:   59 MPIY--KVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEKWDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSS---KANESDSQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQK---TVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGRFDVKTTNTESE-EDIQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIEKN 1531
            +P+Y  KVN+KW KEKF+++E +TD+PP  FKA +F+L+GV PDRQKVM+ GGTLK          G+T++MMG++E L     + +P F+EDMT+ Q+  A++LP GL N+GNTCY+NAT+QC+R++PE+ +A+K  +   +A+   + A+++    R +F SM+     I PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+    +   S++  +    +     N +F+DQF    F+     TESE E++  ++E  LQLSCFI+++VKYL TG++  L+  +TKFS SL R+ALY ++S+ISRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LD+YE CT EL+ KM   R K+K +EDKK  +E+  K N+ S      +  + + PY +  D+GS NSG YELQA++THQGRSSSSGHYV WV++  D W+K+DDD V+ V+ EDILRLSGGGDWH AYVLLYGP+ IE +
Sbjct:    1 VPVYQTKVNVKWGKEKFDNVELNTDEPPMVFKAQLFALTGVQPDRQKVMVKGGTLK----------GMTLLMMGSAEALPEEPAV-RPVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKEALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFA-------EKGDQGQYLQQDANECWVQVMRVLQQKLEAIEGDSDMETDSGAAATASKKN-SFIDQFFGIEFESTMKCTESEDEEVTKSKETQLQLSCFINQEVKYLFTGLKLRLQEEITKFSPSLQRNALYIKTSRISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDIYELCTPELQEKMVSYRSKFKQLEDKKG-SEQAPKANQMS------QREVRYEPYAFPGDVGSINSGYYELQAVLTHQGRSSSSGHYVSWVKRKHDEWIKFDDDKVSIVSPEDILRLSGGGDWHIAYVLLYGPRRIEAS 475          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp14 (ubiquitin specific peptidase 14 [Source:MGI Symbol;Acc:MGI:1928898])

HSP 1 Score: 464.537 bits (1194), Expect = 2.483e-159
Identity = 241/500 (48.20%), Postives = 340/500 (68.00%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEK-WDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSS---KANESDSQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGK----NGNWNFVDQFLTGRFDVKTTNTESEED-IQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAE-RISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            MP+Y V +KW KEKF  +E +TD+PP  FKA +F+L+GV P RQKVM+ GGTLK+  W  IK+K+G+T++MMG+++ L      +K  F+EDMT+ Q+  A++LP GL N+GNTCY+NAT+QC+R++PE+  A+K  +   +A+   + A+++    R +F SM+     I PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+ +    + +  +   S       +   + +DQ+    F+     TESEE+ +   +E  LQLSCFI+++VKYL TG++  L+  +TK S +L R+ALY +SSKISRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LD+YE CT EL+ KM   R K+K +EDKK   +   + KN    E+K +       P+ ++DDIGSNN G Y+LQA++THQGRSSSSGHYV WVR+  D W+K+DDD V+ VT EDILRLSGGGDWH AYVLLYGP+ +E
Sbjct:    1 MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKMKNGMTVLMMGSADALPEEPS-AKTVFVEDMTEEQLATAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFA-------EKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSGRETDSSSAPAVTPSKKKSLIDQYFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNANDKNSPPKEIKYE-------PFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVRRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVE 485          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp14 (ubiquitin specific peptidase 14 [Source:MGI Symbol;Acc:MGI:1928898])

HSP 1 Score: 420.239 bits (1079), Expect = 1.531e-142
Identity = 227/500 (45.40%), Postives = 316/500 (63.20%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEK-WDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSS---KANESDSQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGK----NGNWNFVDQFLTGRFDVKTTNTESEED-IQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAE-RISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            MP+Y V +KW KEKF  +E +TD+PP  FKA +F+L+GV P RQKVM+ GGTLK+  W  IK+K+                                    ++LP GL N+GNTCY+NAT+QC+R++PE+  A+K  +   +A+   + A+++    R +F SM+     I PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+ +    + +  +   S       +   + +DQ+    F+     TESEE+ +   +E  LQLSCFI+++VKYL TG++  L+  +TK S +L R+ALY +SSKISRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LD+YE CT EL+ KM   R K+K +EDKK   +   + KN    E+K +       P+ ++DDIGSNN G Y+LQA++THQGRSSSSGHYV WVR+  D W+K+DDD V+ VT EDILRLSGGGDWH AYVLLYGP+ +E
Sbjct:    1 MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKMKN------------------------------------MELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFA-------EKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSGRETDSSSAPAVTPSKKKSLIDQYFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNANDKNSPPKEIKYE-------PFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVRRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVE 450          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp27x (ubiquitin specific peptidase 27, X chromosome [Source:MGI Symbol;Acc:MGI:1859645])

HSP 1 Score: 59.3066 bits (142), Expect = 5.867e-9
Identity = 49/189 (25.93%), Postives = 78/189 (41.27%), Query Frame = 2
Query:  983 YKRSSK---ISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIEKNPNQ 1540
            Y+ S+K   + +LP      F RF +  K+R   KI   I F + LDM  F                             SK+   + +++L  ++             +NN   Y L A+V HQG +  SGHY  ++R   D W K DD  +T+ + +D+L   G       Y+L Y  +++E  P +
Sbjct:  290 YQESTKQLTMKKLPVVACFHFKRFEHSAKQR--RKITTYISFPLELDMTPFMAS--------------------------SKETRVNGQLQLPTNS-------------ANNENKYSLFAVVNHQG-TLESGHYTSFIRHHRDQWFKCDDAVITKASIKDVLDSEG-------YLLFYHKQVLEPEPEK 429          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp27x (ubiquitin specific peptidase 27, X chromosome [Source:MGI Symbol;Acc:MGI:1859645])

HSP 1 Score: 59.3066 bits (142), Expect = 5.867e-9
Identity = 49/189 (25.93%), Postives = 78/189 (41.27%), Query Frame = 2
Query:  983 YKRSSK---ISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIEKNPNQ 1540
            Y+ S+K   + +LP      F RF +  K+R   KI   I F + LDM  F                             SK+   + +++L  ++             +NN   Y L A+V HQG +  SGHY  ++R   D W K DD  +T+ + +D+L   G       Y+L Y  +++E  P +
Sbjct:  290 YQESTKQLTMKKLPVVACFHFKRFEHSAKQR--RKITTYISFPLELDMTPFMAS--------------------------SKETRVNGQLQLPTNS-------------ANNENKYSLFAVVNHQG-TLESGHYTSFIRHHRDQWFKCDDAVITKASIKDVLDSEG-------YLLFYHKQVLEPEPEK 429          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp27x (ubiquitin specific peptidase 27, X chromosome [Source:MGI Symbol;Acc:MGI:1859645])

HSP 1 Score: 59.3066 bits (142), Expect = 5.867e-9
Identity = 49/189 (25.93%), Postives = 78/189 (41.27%), Query Frame = 2
Query:  983 YKRSSK---ISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIEKNPNQ 1540
            Y+ S+K   + +LP      F RF +  K+R   KI   I F + LDM  F                             SK+   + +++L  ++             +NN   Y L A+V HQG +  SGHY  ++R   D W K DD  +T+ + +D+L   G       Y+L Y  +++E  P +
Sbjct:  290 YQESTKQLTMKKLPVVACFHFKRFEHSAKQR--RKITTYISFPLELDMTPFMAS--------------------------SKETRVNGQLQLPTNS-------------ANNENKYSLFAVVNHQG-TLESGHYTSFIRHHRDQWFKCDDAVITKASIKDVLDSEG-------YLLFYHKQVLEPEPEK 429          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q0IIF7|UBP14_BOVIN (Ubiquitin carboxyl-terminal hydrolase 14 OS=Bos taurus OX=9913 GN=USP14 PE=2 SV=3)

HSP 1 Score: 466.463 bits (1199), Expect = 2.404e-159
Identity = 238/499 (47.70%), Postives = 339/499 (67.94%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEK-WDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSS---KANESDSQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGK----NGNWNFVDQFLTGRFDVKTTNTESEED-IQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            MP+Y V +KW KEKF  +E +TD+PP  FKA +F+L+GV P RQKVM+ GGTLK+  W  IK+K+G+T++MMG+++ L      +K  F+EDMT+ Q+  A++LP GL N+GNTCY+NAT+QC+R++PE+  A+K  +   +A+   + A+++    R +F SM+     I PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+ +    +    +   S       +   + +DQF    F+     TESEE+ +   +E  LQLSCFI+++VKYL TG++  L+  +TK S +L R+ALY +SSKISRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LD+YE CT EL+ KM   R K+K +EDKK   +  +   + S +       +++ P+ ++DDIGSNN G Y+LQA++THQGRSSSSGHYV WV++  D W+K+DDD V+ VT EDILRLSGGGDWH AYVLLYGP+ +E
Sbjct:    1 MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKMKNGMTVLMMGSADALPEEPS-AKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFA-------EKGEQGQYLQQDANECWVQMMRVLQQKLEAIEDDTVKETDSSSASAVTPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKESQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPKTGDKDSSPQ-----KEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVE 486          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|P40826|UBP14_RABIT (Ubiquitin carboxyl-terminal hydrolase 14 OS=Oryctolagus cuniculus OX=9986 GN=USP14 PE=1 SV=3)

HSP 1 Score: 465.307 bits (1196), Expect = 7.687e-159
Identity = 238/498 (47.79%), Postives = 339/498 (68.07%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEK-WDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSS---KANESDSQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDS---FGKNGNWNFVDQFLTGRFDVKTTNTESEED-IQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            MP+Y V +KW KEKF  +E +TD+PP  FKA +F+L+GV P RQ+VM+ GGTLK+  W  IK+K+G+TI+MMG+++ L      +K  F+EDMT+ Q+  A++LP GL N+GNTCY+NAT+QC+R++PE+  A+K  +   +A+   + A+++    R +F SM+     I PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+ +    + +  +   S      +   + +DQF    F+     TESEE+ +   +E  LQLSCFI+++VKYL TG++  L+  +TK S +L R+ALY +SSKISRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LD+YE CT EL+ KM   R K+K +EDKK   +  +   + S +       + + P+ ++DDIGSNN G Y+LQA++THQGRSSSSGHYV WV++  D W+K+DDD V+ VT EDILRLSGGGDWH AYVLLYGP+ +E
Sbjct:    1 MPLYSVTVKWGKEKFGGVELNTDEPPMVFKAQLFALTGVQPARQRVMVKGGTLKDDDWGNIKIKNGMTILMMGSADALPEEPS-AKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFA-------EKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSAAAVAPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDIEDKKVNQQPNASDKKSSPQ-----KEVRYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKHDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVE 485          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q9JMA1|UBP14_MOUSE (Ubiquitin carboxyl-terminal hydrolase 14 OS=Mus musculus OX=10090 GN=Usp14 PE=1 SV=3)

HSP 1 Score: 464.537 bits (1194), Expect = 1.737e-158
Identity = 241/500 (48.20%), Postives = 340/500 (68.00%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEK-WDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSS---KANESDSQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGK----NGNWNFVDQFLTGRFDVKTTNTESEED-IQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAE-RISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            MP+Y V +KW KEKF  +E +TD+PP  FKA +F+L+GV P RQKVM+ GGTLK+  W  IK+K+G+T++MMG+++ L      +K  F+EDMT+ Q+  A++LP GL N+GNTCY+NAT+QC+R++PE+  A+K  +   +A+   + A+++    R +F SM+     I PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+ +    + +  +   S       +   + +DQ+    F+     TESEE+ +   +E  LQLSCFI+++VKYL TG++  L+  +TK S +L R+ALY +SSKISRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LD+YE CT EL+ KM   R K+K +EDKK   +   + KN    E+K +       P+ ++DDIGSNN G Y+LQA++THQGRSSSSGHYV WVR+  D W+K+DDD V+ VT EDILRLSGGGDWH AYVLLYGP+ +E
Sbjct:    1 MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKMKNGMTVLMMGSADALPEEPS-AKTVFVEDMTEEQLATAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFA-------EKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSGRETDSSSAPAVTPSKKKSLIDQYFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNANDKNSPPKEIKYE-------PFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVRRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVE 485          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|P60051|UBP14_PANTR (Ubiquitin carboxyl-terminal hydrolase 14 OS=Pan troglodytes OX=9598 GN=USP14 PE=3 SV=2)

HSP 1 Score: 463.766 bits (1192), Expect = 2.597e-158
Identity = 239/499 (47.90%), Postives = 340/499 (68.14%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEK-WDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSS---KANESDSQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGK----NGNWNFVDQFLTGRFDVKTTNTESEED-IQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            MP+Y V +KW KEKF  +E +TD+PP  FKA +F+L+GV P RQKVM+ GGTLK+  W  IK+K+G+T++MMG+++ L      +K  F+EDMT+ Q+  A++LP GL N+GNTCY+NAT+QC+R++PE+  A+K  +   +A+   + A+++    R +F SM+     I PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+ +    + +  +   S       +   + +DQF    F+     TESEE+ +   +E  LQLSCFI+++VKYL TG++  L+  +TK S +L R+ALY +SSKISRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LDMYE CT EL+ KM   R K+K +EDKK   +  +   + S +       +++ P+ ++DDIGSNN G Y+LQA++THQGRSSSSGHYV WV++  D W+K+DDD V+ VT EDILRLSGGGDWH AYVLLYGP+ +E
Sbjct:    1 MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNGMTLLMMGSADALPEEPS-AKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFA-------EKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQ-----KEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVE 486          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|P54578|UBP14_HUMAN (Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=3)

HSP 1 Score: 463.381 bits (1191), Expect = 4.103e-158
Identity = 239/499 (47.90%), Postives = 340/499 (68.14%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEK-WDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSS---KANESDSQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGK----NGNWNFVDQFLTGRFDVKTTNTESEED-IQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            MP+Y V +KW KEKF  +E +TD+PP  FKA +F+L+GV P RQKVM+ GGTLK+  W  IK+K+G+T++MMG+++ L      +K  F+EDMT+ Q+  A++LP GL N+GNTCY+NAT+QC+R++PE+  A+K  +   +A+   + A+++    R +F SM+     I PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+ +    + +  +   S       +   + +DQF    F+     TESEE+ +   +E  LQLSCFI+++VKYL TG++  L+  +TK S +L R+ALY +SSKISRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LDMYE CT EL+ KM   R K+K +EDKK   +  +   + S +       +++ P+ ++DDIGSNN G Y+LQA++THQGRSSSSGHYV WV++  D W+K+DDD V+ VT EDILRLSGGGDWH AYVLLYGP+ +E
Sbjct:    1 MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNGMTLLMMGSADALPEEPS-AKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFA-------EKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQ-----KEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVE 486          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: K1QYH5 (Ubiquitin carboxyl-terminal hydrolase OS=Crassostrea gigas OX=29159 GN=CGI_10024151 PE=3 SV=1)

HSP 1 Score: 518.464 bits (1334), Expect = 3.048e-177
Identity = 266/498 (53.41%), Postives = 345/498 (69.28%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEK-WDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSK----ANESDSQARFVLNLGRLIFSMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGKNG---NWNFVDQFLTGRFDVKT-TNTESEEDIQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            MP+YKVN+KW KEKF+D+EC+TD+PP  FKA +F+LSGV PDRQK+M+ G  +K+  W  IK+KDG  +MMMG+++ L     + K  F+EDMTD Q+ KAL++P GL N+GNTCY+NAT+QCLR IPE+ +A++  S     A    +       L  L  SM+ +   I P++ ++ LH   PQFA       E GG     QQDANECW E++R LQ+ V         D+P    K G   +  F+DQ+L G F+V        EE    + E F QLSCFI+KDVKY+QTG++N LE  +TK S SLSRDA+YK+SSKI RLP YL++QFVRFYYKEKE INAKILKD+KF++ LD+Y+ CT EL+AK+QP RDK+K +EDKKAE E I  K +   E +  K   E  PY + DD+GSNNSG YELQA++TH+GRSSSSGHYV WV++ GD W  +DDD V+ VTAED+L+LSGGGDWH AYVLLYGP+++E
Sbjct:    1 MPVYKVNVKWGKEKFSDVECNTDEPPMVFKAQLFALSGVQPDRQKIMVKGAVVKDDDWGNIKMKDGAMLMMMGSADAL-PQAPVEKTMFVEDMTDQQLAKALEMPPGLMNLGNTCYMNATVQCLRAIPELREALRKYSGNLSVAGGISTADSITAALRDLYNSMDKSGAAIPPMIFIQVLHMAYPQFAEKS----EHGG---FAQQDANECWTEVVRCLQQEV---------DVPQELSKEGAKPSNRFIDQYLGGEFEVTMKCEEAEEEPESKSVEKFYQLSCFIEKDVKYMQTGLKNRLEEHITKNSPSLSRDAIYKKSSKIKRLPGYLAIQFVRFYYKEKEAINAKILKDVKFTMSLDVYDLCTPELQAKLQPARDKFKELEDKKAE-EMIQNKAQGKTEDQPAKPTKEE-PYGFPDDLGSNNSGFYELQAVLTHKGRSSSSGHYVAWVKKKGDEWYMFDDDNVSCVTAEDVLKLSGGGDWHSAYVLLYGPRVLE 479          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: V4ALX1 (Ubiquitin carboxyl-terminal hydrolase OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_227857 PE=3 SV=1)

HSP 1 Score: 508.064 bits (1307), Expect = 3.642e-173
Identity = 260/499 (52.10%), Postives = 352/499 (70.54%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKE-KWDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSKA-------NESDSQARFVLNLGRLIFSMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGRFDVKTTNTESEEDIQLT-QEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAE-AERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            MP YKV++KW KEKFND+EC+TD+ PE FKA +F+LSGV PDRQKVMM G  LK+  W  +KLKDG T++MMGT++ L    +  K  F+EDM+++Q+  AL++P GL N+GNTCY+NAT+QCL++IPE+  A+K  S           +DS       L  L  S++ +   I PI+ L+ LH   P+FA       E+GG     QQDANECW EI+RSLQ+ +      N N +  +    G   F+DQF+ G F+      E++++I+    E F QLSCFI+K+VKY+ TG+R+ L+ ++TK S +L RDALY +SSKI+RLPAYL++QFVRFYYKEKE INAKILKD+KF++ LD+Y+ CT EL+AK+ PMR+++K  EDK  E A+++ +K   S E  ++K   +  PY + DDIGSNNSG YEL A++TH+GRSSSSGHYVGWVR+ GD WL +DDD V+ V ++DIL+LSGGGDWHCAYVLLYGP+++E
Sbjct:    1 MPTYKVSVKWGKEKFNDVECNTDELPEVFKAQLFALSGVQPDRQKVMMKGAVLKDDSWGNLKLKDGATLLMMGTADALPEAPK-EKTVFMEDMSEAQLANALEMPSGLTNLGNTCYMNATVQCLKSIPELNDALKRYSGGLTVGGAIAPADS---ITAALRDLYQSLDRSGTAIPPIIFLQILHMAFPRFAEKG----EEGG---YQQQDANECWTEIVRSLQQKLPAIGPSNSNTVNTASSSQG---FIDQFMGGEFETVMKCNEADDEIETKGSEKFYQLSCFIEKEVKYMHTGLRSRLQETITKLSPTLGRDALYTKSSKINRLPAYLAIQFVRFYYKEKESINAKILKDVKFTMSLDVYDLCTPELQAKLVPMRNRFKEQEDKYLEQAQQLKQKG--SGEKPVEKKK-KAEPYSFPDDIGSNNSGYYELSAVLTHKGRSSSSGHYVGWVRKKGDEWLMFDDDRVSPVMSDDILKLSGGGDWHCAYVLLYGPRILE 482          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A4Z2DHW8 (Ubiquitin carboxyl-terminal hydrolase OS=Schistosoma japonicum OX=6182 GN=EWB00_000809 PE=3 SV=1)

HSP 1 Score: 503.442 bits (1295), Expect = 3.959e-171
Identity = 261/514 (50.78%), Postives = 351/514 (68.29%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTL-KEKWDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDM-TDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMS---SKANESDSQARFVLNLGRLIFSMETAEVPIAPILPLKSLHEMCPQFAT----TQTVPPEQGGGTVLM----QQDANECWAEIIRSLQKTVYIPSNINF------NDIPDSFGKNGNWNFVDQFLTGRFDVKTTNTESEEDIQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIEKNPNQD 1543
            MPIYKVNIKWQK KF D+EC+TD+ PE FKA +FSL+G+ P+RQK+MMPGG L  + ++GIKLKDG+ IM++G+ +E+     IS+  ++ED    S     +KLP GL N+GNTCY+NA +Q L +IPE+  A+++      + +S S      +L  L  S+   E P+ P+L L  LH +CPQFAT    +    P  G  +++     QQDA+ECW E+IR+LQ+      NIN+        +P  F     WN +D+FLTG+   K + TES+E    + E F +LSCF+ +DVKYL TGIRNGL  +LTK S SL+RDA+YKR S ISRLPAYL +  VRF+YKE ++INAKILKD+KF + LDM+EFCT EL+ K+ PMR+K +L E+K+  A  +  K +        K ++ + PY++SDD GSNNSG YELQ +++HQGR+S+SGHYV WV++ G IW K+DDD V+QVTAEDILRLSGGGDWHCAY+LLYGP+ IEK   +D
Sbjct:    1 MPIYKVNIKWQKNKFADVECNTDESPEVFKASLFSLTGIPPERQKIMMPGGILGNDNFNGIKLKDGMNIMLVGSVDEV----AISETPYLEDSKVVSPTEDTVKLPPGLVNLGNTCYINAAVQLLYSIPELRLALQICRFPETSLDSPSLDGLCESLKFLFASLSKTEKPVTPVLFLTCLHSVCPQFATRASSSDASKPAHGALSMITRGFEQQDASECWIELIRALQRC-----NINWEAYKSTTGLPQCFLTTSQWNPIDRFLTGQLSCKLSCTESDEPETHSVETFTELSCFMHQDVKYLLTGIRNGLTGNLTKHSSSLNRDAVYKRMSLISRLPAYLCIHLVRFFYKEDKQINAKILKDVKFPLNLDMHEFCTPELQQKLLPMREKQRLKEEKEV-ANAVKIKPDSVQPDPFQKPDL-YEPYYFSDDPGSNNSGYYELQGVLSHQGRTSTSGHYVAWVKKQG-IWFKFDDDRVSQVTAEDILRLSGGGDWHCAYILLYGPRFIEKELCKD 502          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: D6WPP3 (Ubiquitin carboxyl-terminal hydrolase OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC009042 PE=3 SV=1)

HSP 1 Score: 501.13 bits (1289), Expect = 1.834e-170
Identity = 253/496 (51.01%), Postives = 353/496 (71.17%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEK-WDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSKANESDSQ----ARFVLNLGRLIFSMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGRFDVKTTNTESE-EDIQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQS-AEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            MP YKV +KW KE + DIE +TD+ P  FKA +F+L+GV P+RQKVM+ G TLK+  WD  KLKDGVT+++MG+ EE +    + K  F+EDM +S++  AL+LP GL N+GNTCY+NAT+QCL+++PE+ +A++ + + + +D++    A+ +    R ++S       + PI+ L+ LH   P+FA       E GG T   QQDANECW E+IR LQ+   +P+  N  +  + F      + VDQF  G F+V+   TE+E E +   +E FLQLSCFI +DV+Y+ +G+R+ ++  +TK S +L RDA+Y ++SKISRLPAYL++QFVRFYYKEKE INAKILKD+KF I  D ++ CT EL+ K+ PMR K+K +ED  A+ E  SK+ ++S  + K ++++ ++ PYW+ DD+GSNNSG Y LQA++TH+GRSSSSGHYVGWVRQ GD W+K DDD V+ VT EDIL+LSGGGDWHCAYVLLYGP+L+E
Sbjct:    1 MPQYKVKVKWGKESYPDIEVNTDESPMLFKAQLFALTGVQPERQKVMIKGVTLKDADWDNFKLKDGVTVLLMGSKEEDVPKEPVEKTVFVEDMNESELATALELPAGLTNLGNTCYMNATVQCLKSVPELREALQ-AYQGDVTDARGVIPAQSITAALRDLYSSMDKGNNVPPIVLLQMLHLAFPRFAEKN----EHGGFT---QQDANECWTELIRMLQQK--LPAKQNGGNAAEKFK-----SLVDQFFGGTFEVELKCTETEDEPVTKNKETFLQLSCFISQDVRYMHSGLRSKMQEQITKKSSTLDRDAVYIKTSKISRLPAYLTIQFVRFYYKEKESINAKILKDVKFPIDFDAFDLCTPELQEKLAPMRAKFKELED--AQVEAASKEKQKSIGDGKANEADKKYAPYWFEDDLGSNNSGYYTLQAVLTHRGRSSSSGHYVGWVRQSGDKWIKCDDDNVSPVTTEDILKLSGGGDWHCAYVLLYGPRLLE 479          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A0X3P022 (Ubiquitin carboxyl-terminal hydrolase 14 OS=Schistocephalus solidus OX=70667 GN=UBP14 PE=3 SV=1)

HSP 1 Score: 496.893 bits (1278), Expect = 3.094e-168
Identity = 258/514 (50.19%), Postives = 349/514 (67.90%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKE-KWDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCL------RTIPEVYKAIKMSSKANESDSQARFVLNLGRLIFSMETAEVPIAPILPLKSLHEMCPQFATTQ----------TVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNI-NFNDIPDSFGKNGNWNFVDQFLTGRFDVKTTNTESEEDIQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISK----KNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIEKNP 1534
            MP+YK+N+KW+K+KF D+ECDT++PP +FKA++FSL+GV P+RQ VMMPGG L +  +DGIKL+DGVTIM+MGT+EE+      S    IE     +  + L++P G+ N+GNTCY+N T+Q L      R    V +  ++    NE +S+A  V ++  L  SME AE  + P+  LK+LH   PQFATT           T+     G  V  QQDANECW E++R LQK     S + N   +P SFG +G WN +D++LTG+     T TE EE  Q + + F QLSCFIDK+VKYL TGIRNGLE +LTK S+ L R+A+YK+ S++SRLP YL +QFVRFYYKEKE INAKILKDIKF + LD+YEFC  +L+ K+ P R+K ++ ED++A + +  K     N+ +    +D  ++ + PYW+ DD GSNN+G YELQ ++THQGRSS+SGHYV W+++ G  W K DDD V++V  EDI++LSGGGDWHCAY+LLYGP+ I+  P
Sbjct:    1 MPVYKLNVKWKKQKFTDVECDTNEPPGSFKAVLFSLTGVPPERQNVMMPGGILGDANYDGIKLRDGVTIMLMGTAEEIPPSLLSSSQAPIEPAEIHE--RKLRMPIGIVNLGNTCYMNGTLQLLFLLPELRDALSVVEPSRLPPSMNE-NSKA-LVTSMRFLFQSMEKAEKAVIPVFFLKALHSNFPQFATTASNAAVGQLDPTLSAAGLGMPVYQQQDANECWTEVVRILQKVTVDSSALQNKPGLPQSFGTSGGWNPIDRYLTGQLTSTLTCTEGEEPAQQSVDTFTQLSCFIDKEVKYLHTGIRNGLEGTLTKNSDVLGREAVYKKISRVSRLPGYLCVQFVRFYYKEKEHINAKILKDIKFPLNLDLYEFCAKDLQEKLLPAREKVRIEEDEEALSAKAKKLPNSVNDDNVPNPIDNPDL-YEPYWFEDDPGSNNTGFYELQGVLTHQGRSSTSGHYVSWIKKKGK-WFKLDDDTVSEVGTEDIMKLSGGGDWHCAYLLLYGPRRIKIRP 508          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp14 (ubiquitin specific peptidase 14 [Source:NCBI gene;Acc:111191232])

HSP 1 Score: 480.33 bits (1235), Expect = 1.273e-165
Identity = 247/507 (48.72%), Postives = 350/507 (69.03%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKE-KWDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSKANESD---SQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFG----KNGNWNFVDQFLTGRFDVKTTNTESEEDIQLT-QEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPK---LIEKNPNQ 1540
            MP++ VN+KW KEKF+ +E +T++PP  FKA +F+L+GV P+RQKVM+ GGTLK+ +W  IKLK+G+T++MMG++E L     + +P F+EDMT+ Q+  A++LP GL N+GNTCY+NAT+QCLR++PE+  A++  S A  S    + ++++    R ++ SM+     I PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+ +         +  D  G         NF+DQF    FD     TESEE+      E  LQLSCFI+++VKYL TG+R  L+  +TKFS SL R+ALY +SSKISRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LD+YE C+ EL+ KM  +R K+K MED+  E ++  K  ++    K     +++ P+ +S+D+GSNNSG Y+LQA++THQGRSSSSGHYVGWV++  D W+K+DDD V+ VT EDIL+LSGGGDWH AYVL+YGP+   ++E+ P Q
Sbjct:    1 MPVFTVNVKWGKEKFDAVELNTEEPPMVFKAQLFALTGVQPERQKVMIKGGTLKDDEWGNIKLKNGMTLLMMGSAEALPEEPAV-RPMFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCLRSVPELKDALRRYSGALRSSGASAPSQYITAALRDLYESMDKTSASIPPIILLQFLHMAFPQFA-------EKGEQGQYLQQDANECWVQVMRVLQQKLEPVEPEAPMETGDGEGGAAASTTKKNFIDQFFGLEFDTTMKCTESEEEEPTKGSESQLQLSCFINQEVKYLATGLRLRLQEEITKFSPSLQRNALYMKSSKISRLPAYLTVQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCSSELQEKMVSVRSKFKEMEDRNLEKQQQQKNVKKIEAPK----EVKYEPFSFSNDLGSNNSGYYDLQAVLTHQGRSSSSGHYVGWVKRKEDEWVKFDDDKVSVVTPEDILKLSGGGDWHIAYVLVYGPRRLEVLEEKPQQ 495          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp14 (ubiquitin specific peptidase 14 [Source:NCBI gene;Acc:111191232])

HSP 1 Score: 426.017 bits (1094), Expect = 3.535e-145
Identity = 230/506 (45.45%), Postives = 317/506 (62.65%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEKWDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSKANESD---SQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFG----KNGNWNFVDQFLTGRFDVKTTNTESEEDIQLT-QEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPK---LIEKNPNQ 1540
            MP++ VN+KW KEKF+ +E +T++PP  FKA +F+L+GV P+RQKVM+ GGTLK                                              ++LP GL N+GNTCY+NAT+QCLR++PE+  A++  S A  S    + ++++    R ++ SM+     I PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+ +         +  D  G         NF+DQF    FD     TESEE+      E  LQLSCFI+++VKYL TG+R  L+  +TKFS SL R+ALY +SSKISRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LD+YE C+ EL+ KM  +R K+K MED+  E ++  +K E   EVK +       P+ +S+D+GSNNSG Y+LQA++THQGRSSSSGHYVGWV++  D W+K+DDD V+ VT EDIL+LSGGGDWH AYVL+YGP+   ++E+ P Q
Sbjct:    1 MPVFTVNVKWGKEKFDAVELNTEEPPMVFKAQLFALTGVQPERQKVMIKGGTLK----------------------------------------------MELPCGLTNLGNTCYMNATVQCLRSVPELKDALRRYSGALRSSGASAPSQYITAALRDLYESMDKTSASIPPIILLQFLHMAFPQFA-------EKGEQGQYLQQDANECWVQVMRVLQQKLEPVEPEAPMETGDGEGGAAASTTKKNFIDQFFGLEFDTTMKCTESEEEEPTKGSESQLQLSCFINQEVKYLATGLRLRLQEEITKFSPSLQRNALYMKSSKISRLPAYLTVQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCSSELQEKMVSVRSKFKEMEDRNLEKQQ-QQKIEAPKEVKYE-------PFSFSNDLGSNNSGYYDLQAVLTHQGRSSSSGHYVGWVKRKEDEWVKFDDDKVSVVTPEDILKLSGGGDWHIAYVLVYGPRRLEVLEEKPQQ 445          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: ENSAMXT00000041443.1 (ubiquitin carboxyl-terminal hydrolase 22-like [Source:NCBI gene;Acc:103037145])

HSP 1 Score: 53.1434 bits (126), Expect = 4.293e-7
Identity = 49/184 (26.63%), Postives = 74/184 (40.22%), Query Frame = 2
Query:  983 YKRSSK---ISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            Y+ S+K   + +LP        RF +  K R   KI   + F + LDM  F                  M   K    R++ + +QS ++                    NN   Y L A+V HQG +  SGHY  ++RQ  D W K DD  +T+ + +D+L   G       Y+L Y  + +E
Sbjct:  324 YQESTKQLTMKKLPIVACFHLKRFEHSAKLR--RKITTYVSFPLELDMTPF------------------MASSKES--RVNGQYQQSVDLL-------------------NNDNKYSLFAVVNHQG-TLESGHYTSFIRQHKDQWFKCDDAIITKASIKDVLDSEG-------YLLFYHKQFLE 458          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp22 (ubiquitin carboxyl-terminal hydrolase 22 [Source:NCBI gene;Acc:103037418])

HSP 1 Score: 51.6026 bits (122), Expect = 1.373e-6
Identity = 49/184 (26.63%), Postives = 72/184 (39.13%), Query Frame = 2
Query:  983 YKRSSK---ISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            Y+ S+K   + RLP        RF +  K R   KI   + F + LDM  F                  M   K    R++ + +Q  +                     NN   Y L A+V HQG +  SGHY  ++RQ  D W K DD  +T+ + +D+L   G       Y+L Y  + +E
Sbjct:  370 YQESTKQLTMKRLPIVACFHLKRFEHSAKLR--RKITTYVSFPLELDMTPF------------------MASSKES--RMNGQYQQPVDTL-------------------NNDNKYALFAVVNHQG-TLESGHYTTFIRQHKDQWFKCDDAIITKASIKDVLDSEG-------YLLFYHKQFLE 504          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: ENSAMXT00000044537.1 (ubiquitin carboxyl-terminal hydrolase 37-like [Source:NCBI gene;Acc:111193438])

HSP 1 Score: 50.8322 bits (120), Expect = 3.323e-6
Identity = 23/65 (35.38%), Postives = 36/65 (55.38%), Query Frame = 2
Query: 1313 GIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLY 1507
            G+Y L +IV+H G S + GHY+  + Q G+ WL +DD  V     + +L+ +       AY+L Y
Sbjct:  519 GLYRLHSIVSHLGCSVNKGHYISNIVQDGESWLSFDDTRVHHALGKTVLKCTATT----AYLLFY 579          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp14 (ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) [Source:ZFIN;Acc:ZDB-GENE-030131-7676])

HSP 1 Score: 227.639 bits (579), Expect = 9.398e-71
Identity = 124/297 (41.75%), Postives = 181/297 (60.94%), Query Frame = 2
Query:   65 IYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEK-WDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSKANESDS----QARFVLNLGRLIFSMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDS----FGKNGNWNFVDQFLTGRFDVKTTNTES-EEDIQLTQEPFLQLSCFIDKDVKYLQTGIR 925
            I  V +KW KEK++D+E +TD+ P  FKA +F+L+GV PDRQKVM+ G TLK+  W   KLKDG+T+++MGT+E L T   I KP F+EDM++ Q+  AL+LP GL N+GNTCY+NAT+QCLR++PE+  A+   S    S             +  L  +M+     I P++ L+ LH   PQFA       E+G     +QQDANECW +I+R LQ+ +    N    ++  +      ++   NF+D++    F+ +    ES EE++   +E  +QLSCFI++DVKYL TG+R
Sbjct:    3 IRAVKVKWGKEKYDDVELNTDEVPIVFKAQLFALTGVHPDRQKVMLKGATLKDDDWGNFKLKDGITLLLMGTAEALPT-EPIEKPVFMEDMSEEQLASALELPPGLTNLGNTCYMNATVQCLRSVPELRDALLRYSDNMHSGGIVLLAQSITAGIRDLFVAMDHTSASIPPVILLQLLHMAFPQFA-------EKGEHGQYLQQDANECWVQIMRMLQQKLPPLQNSPSAEVRTAQHFHLHRSRVKNFIDEYFGIEFETEMKCAESEEEEVTKGRETQMQLSCFINQDVKYLSTGLR 291          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp22 (ubiquitin specific peptidase 22 [Source:NCBI gene;Acc:692275])

HSP 1 Score: 50.447 bits (119), Expect = 3.920e-7
Identity = 49/184 (26.63%), Postives = 71/184 (38.59%), Query Frame = 2
Query:  983 YKRSSK---ISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            Y+ S+K   + +LP        RF +  K R   KI   + F + LDM  F                  M   K    R++ +++                    D + S N   Y L A+V HQG +  SGHY  ++RQ  D W K DD  +T   A D+L   G       Y+L Y  + +E
Sbjct:  129 YQESTKQLTMKKLPIVACFHLKRFEHSAKLR--KKITTYVSFPLELDMTPF------------------MASSKES--RVNGQHQVGG-----------------DALSSENK--YSLFAVVNHQG-TLESGHYTSFIRQHKDQWFKCDDAIITHAGARDVLDSEG-------YLLFYHKQFLE 263          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp22 (ubiquitin specific peptidase 22 [Source:NCBI gene;Acc:692275])

HSP 1 Score: 48.1358 bits (113), Expect = 3.457e-6
Identity = 27/75 (36.00%), Postives = 38/75 (50.67%), Query Frame = 2
Query: 1301 SNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            S N   Y L A+V HQG +  SGHY  ++R   D W K DD  +T  +  D+L   G       Y+L Y  +++E
Sbjct:  409 STNENKYSLFAVVNHQG-TLESGHYTSFIRLHRDQWFKCDDAVITHASVTDVLDSEG-------YLLFYHKQILE 475          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp3 (ubiquitin specific peptidase 3 [Source:ZFIN;Acc:ZDB-GENE-030131-5142])

HSP 1 Score: 46.9802 bits (110), Expect = 5.460e-6
Identity = 23/69 (33.33%), Postives = 35/69 (50.72%), Query Frame = 2
Query: 1301 SNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLY 1507
            SN+S +Y+L A+V H G    SGHY  +    G +W  ++D  VT+   + + R         AY+L Y
Sbjct:  199 SNSSSLYDLAAVVVHHGSGVGSGHYTAYAAHNG-LWFHFNDSTVTRSEEDTVARAK-------AYILFY 259          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp7 (ubiquitin specific peptidase 7 (herpes virus-associated) [Source:ZFIN;Acc:ZDB-GENE-030131-3656])

HSP 1 Score: 47.7506 bits (112), Expect = 6.646e-6
Identity = 28/80 (35.00%), Postives = 47/80 (58.75%), Query Frame = 2
Query: 1295 IGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGD-IWLKYDDDYVTQVTAEDILRLSGGG---DW---HC--AYVLLY 1507
            + + +S  Y L A++ H G  +  GHYV ++  +GD  W K+DDD V++ T ++ +  + GG   D+   HC  AY+L+Y
Sbjct:  419 LDAEDSATYILHAVLVHSG-DNHGGHYVVYLNPMGDGKWCKFDDDVVSRCTKKEAIEHNYGGLDDDFSVRHCTNAYMLVY 497          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP6 (Ubiquitin-specific protease; situated in the base subcomplex of the 26S proteasome, releases free ubiquitin from branched polyubiquitin chains en bloc, rather than from the distal tip of the chain; negatively regulates degradation of ubiquitinated proteins by the proteasome; works in opposition to Hul5p polyubiquitin elongation activity; mutant has aneuploidy tolerance; human homolog UBP14 complements yeast null mutant [Source:SGD;Acc:S000001906])

HSP 1 Score: 191.815 bits (486), Expect = 3.837e-55
Identity = 148/504 (29.37%), Postives = 244/504 (48.41%), Query Frame = 2
Query:  110 IECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEKWDGIK--LKDGVTIMMMGTSEELLTVGEISKPKFIEDMT-DSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAI--------KMSSKANESDSQARFVLNLGRLIFSMETAEV-PIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGRFDVKTT--NTESEEDIQLTQ-EPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLME---------------DKKAEAERISKKNEQSAEVKLDKSN----IEHYPYWYSDDI--GSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGD--IWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLY 1507
            I   TD    + K+    L+ V   RQK M+ GG   E+   I   +K G T+M++GT +  L      K  FIED+  + Q+ +  +LP G KN+GNTCYLNAT+Q L  + ++   I          +S A + +   + V+ + R   +++      + PI+ L +L +  PQFA   +    QGG     QQDA E + ++  S+        +I F D            F + F   R   KTT  +T ++ DI + + E   +L C I     +++ G+  GL   + K S+    +++Y    KISRLP +L++Q+VRF++K      +KIL+ + F   LD+ +  T E  A+   +RD+ + +E               D  +    ++ + +   +V L++S     +E Y   +  ++  G N S +Y L  ++THQG +S SGHY  ++R   D   W K++DD V+ V  E I  L+GGG+   A +L+Y
Sbjct:   19 ITLSTDATSADLKSKAEELTQVPSARQKYMVKGGLSGEESIKIYPLIKPGSTVMLLGTPDANLISKPAKKNNFIEDLAPEQQVQQFAQLPVGFKNMGNTCYLNATLQALYRVNDLRDMILNYNPSQGVSNSGAQDEEIHKQIVIEMKRCFENLQNKSFKSVLPIVLLNTLRKCYPQFAERDS----QGG--FYKQQDAEELFTQLFHSM--------SIVFGD-----------KFSEDF---RIQFKTTIKDTANDNDITVKENESDSKLQCHISGTTNFMRNGLLEGLNEKIEKRSDLTGANSIYSVEKKISRLPKFLTVQYVRFFWKRSTNKKSKILRKVVFPFQLDVADMLTPEYAAEKVKVRDELRKVEKEKNEKEREIKRRKFDPSSSENVMTPREQYETQVALNESEKDQWLEEYKKHFPPNLEKGENPSCVYNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGESDSALILMY 494          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP9 (Ubiquitin-specific protease that cleaves ubiquitin-protein fusions; UBP9 has a paralog, UBP13, that arose from the whole genome duplication [Source:SGD;Acc:S000000900])

HSP 1 Score: 57.7658 bits (138), Expect = 2.995e-9
Identity = 30/76 (39.47%), Postives = 38/76 (50.00%), Query Frame = 2
Query: 1319 YELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGG-GDWHCAYVLLYGPKLIEKNPNQD 1543
            YEL  +V H G     GHYV   R     WL YDD+ V  +  E +L+ +G  GD   AYVL Y     +K  NQ+
Sbjct:  601 YELSGVVIHMGSGPQHGHYVCICRNEKFGWLLYDDETVESIKEETVLQFTGHPGDQTTAYVLFYKETQADKTENQN 676          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP10 (Ubiquitin-specific protease, deubiquitinates Ub-protein moieties; interacts with proteins that function in rRNA production and ribosome biogenesis via its intrinsically disordered regions; stabilizes Rpa190p by deubiquitination; controls PCNA deubiquitylation; may regulate silencing by acting on Sir4p; involved in posttranscriptionally regulating Gap1p, possibly other transporters; localized to the nucleolus; null mutant phenotypes are functionally complemented by human USP36 [Source:SGD;Acc:S000005130])

HSP 1 Score: 56.6102 bits (135), Expect = 7.359e-9
Identity = 25/63 (39.68%), Postives = 37/63 (58.73%), Query Frame = 2
Query: 1319 YELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLY 1507
            Y+L ++V H+GRS SSGHY+   +Q    W  YDD+Y+  ++  D+L+         AY LLY
Sbjct:  674 YQLLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINIISERDVLKEPN------AYYLLY 730          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP3 (Ubiquitin-specific protease involved in transport and osmotic response; negatively regulates Ras/PKA signaling; interacts with Bre5p to coregulate anterograde, retrograde transport between ER and Golgi; involved in transcription elongation in response to osmostress through phosphorylation at Ser695 by Hog1p; inhibitor of gene silencing; role in ribophagy; cleaves ubiquitin fusions but not polyubiquitin; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000000953])

HSP 1 Score: 55.8398 bits (133), Expect = 1.137e-8
Identity = 59/251 (23.51%), Postives = 100/251 (39.84%), Query Frame = 2
Query:  782 VDQFLTGRFDVKTTNTESEEDIQLTQEPFLQLSCFI-DKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGI----YELQAIVTHQGRSSSSGHYVGWV-RQVGDIWLKYDDDYVTQVTAEDILRLSGG---GDWHCAYVLLY 1507
            + +   G+F        ++E   +T +PF  +   I D  V  L+T  +   E  L  F  S   D   K+ + I +LP  L +QF RF +          + ++     +  Y    +    +++ +R K K   +     E +S                       S  + +N SGI    Y+L  ++ H G SS  GHY   V     + W + DD  +T++  +D+L+  GG    D   AY+L+Y
Sbjct:  697 ISKLFGGQFRSVLDIPNNKESQSITLDPFQTIQLDISDAGVNDLETAFKKFSEYELLPFKSSSGNDVEAKKQTFIDKLPQVLLIQFKRFSF----------INNVNKDNAMTNY----NAYNGRIEKIRKKIKYGHELIIPEESMS-----------------------SITLKNNTSGIDDRRYKLTGVIYHHGVSSDGGHYTADVYHSEHNKWYRIDDVNITELEDDDVLK--GGEEASDSRTAYILMY 908          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP13 (Ubiquitin-specific protease that cleaves Ub-protein fusions; UBP13 has a paralog, UBP9, that arose from the whole genome duplication [Source:SGD;Acc:S000000163])

HSP 1 Score: 52.7582 bits (125), Expect = 1.206e-7
Identity = 36/104 (34.62%), Postives = 48/104 (46.15%), Query Frame = 2
Query: 1205 ERISKKNEQSAEVKLDKSNIEHYPYWYS--DDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSG-GGDWHCAYVLLY 1507
            +R     +Q+  +KL  +NI HYP   +    I S     YEL  IV H G     GHYV   +     WL +DD+ V  V  E +L  +G   +   AYVL Y
Sbjct:  564 KRFKYSEKQNCNIKL-FNNI-HYPLTLNVCSSINSKVCQKYELAGIVVHMGGGPQHGHYVSLCKHEKFGWLLFDDETVEAVKEETVLEFTGESPNMATAYVLFY 665          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO37371 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SFZ8])

HSP 1 Score: 384.415 bits (986), Expect = 8.077e-129
Identity = 213/500 (42.60%), Postives = 303/500 (60.60%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKE-KWDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSK----ANESDSQARFVLNLGRLIFSMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGRFDVKTTNTESEEDIQL-TQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMY----EFCTD-ELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            MPI+ VN+KW KEKF  +E +TD+PP+ FKA +F+LS V P+RQKVM+ G  L++ +W   KLKDGVT+MMMG+  ++ T   + K  F+EDM+++Q+  A KLP GL N+GNTCY+NAT+QCLR +PE++ ++   S      ++  S     + L  L  +M+     + PI+ L+ LH+  PQF+       EQG   +  QQDANECW +++R LQ+   +P      D  +         F+DQ+     +      E+ ++ +  ++E   QLSCFI ++VKY+ TG+++ L  ++TK S SL RDA Y + S +SRLPAYL++Q VRFY+KEKE +NAKILK  KF  +  +Y    + C D  L+A ++  + K    E+K    E   KK E   E           PYW+ DD+GSNNSG YEL A++THQGRSSSSGHY+ W+++  D W K DDD +T V           GDWHCAYVLLY P+ +E
Sbjct:    1 MPIFNVNVKWGKEKFGGVELNTDEPPQVFKAQLFALSSVPPERQKVMLKGAVLQDDEWGNFKLKDGVTLMMMGSVGDIPT-APVRKTVFMEDMSEAQLASAFKLPAGLNNLGNTCYMNATVQCLRNVPELHDSLTNYSGNLGFGSDIGSPESVTVALRDLFKTMDKTSEAVPPIIFLQVLHKAFPQFSEKT----EQG---IFAQQDANECWTQMVRVLQQK--LPGQPQACDGEEKMATPPR-GFMDQYFGIESESTMKCVEAPDEPETKSKETLFQLSCFISQEVKYIHTGLQSRLTENITKKSPSLGRDAQYVKKSMLSRLPAYLTVQLVRFYFKEKEAVNAKILKLQKFKELYPIYQGFHQGCWDISLRADLK-AKAKGPKSEEKLEPMEVDDKKKESKLE-----------PYWFPDDVGSNNSGYYELTAVLTHQGRSSSSGHYLAWIKKKDDEWYKCDDDKITMV-----------GDWHCAYVLLYAPRRLE 466          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp14 (ubiquitin specific peptidase 14 [Source:NCBI gene;Acc:101157975])

HSP 1 Score: 484.952 bits (1247), Expect = 1.770e-167
Identity = 245/500 (49.00%), Postives = 349/500 (69.80%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKE-KWDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSKANES---DSQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYI---PSNINFNDIPDSFGKNGNWNFVDQFLTGRFDVKTTNTESEEDIQLT-QEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEA--ERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            MP++ VN+KW KEKF+ +E +T++PP  FKA +F+L+GV PDRQKVM+ GGTLK+ +W  IKLK+G+T++MMG++E L     + +P F+EDMT+ Q+  A++LP GL N+GNTCY+NAT+QCLR++PE+  A++  S A  S   ++ ++++    R ++ +M+     + PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+ +      + +       +   +   NF+DQ+    ++     TESEE+  +  +E  LQLSCFI+++VKYL TG+R  L+  +TK S SL R+ALY +SSK+SRLPAYL++Q VRF+YKEKE +NAK+LKD+KF ++LD+YE CT EL+ KM P+R K+K +EDKK E   +++ KK + S E K D       P+ + DDIGSNNSG Y+LQA++THQGRSSSSGHYV WV++  D W+K+DDD V+ V  EDILRLSGGGDWH AYVLLYGP+ +E
Sbjct:    1 MPVFTVNVKWGKEKFDAVELNTEEPPMVFKAQLFALTGVQPDRQKVMVKGGTLKDDEWGNIKLKNGMTLLMMGSAEALPEEPAV-RPMFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCLRSVPELKTALRRYSGALRSSGANAPSQYITAALRDLYETMDKTSSSLPPIILLQFLHMAFPQFA-------EKGDQGQYLQQDANECWLQMMRVLQQKLEPLEPEAAMETESETGAAAASSKKNFIDQYFGVEYETSMKCTESEEEEPIKGKESQLQLSCFINQEVKYLATGLRLRLQEEITKMSPSLDRNALYIKSSKLSRLPAYLTVQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCTTELQEKMLPIRSKFKEVEDKKLEKQQQKVLKKPDASKETKYD-------PFSFPDDIGSNNSGYYDLQAVLTHQGRSSSSGHYVAWVKRKDDEWVKFDDDKVSVVAPEDILRLSGGGDWHIAYVLLYGPRRLE 485          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp14 (ubiquitin specific peptidase 14 [Source:NCBI gene;Acc:101157975])

HSP 1 Score: 394.815 bits (1013), Expect = 4.477e-133
Identity = 212/478 (44.35%), Postives = 301/478 (62.97%), Query Frame = 2
Query:  119 DTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKE-KWDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSKANES---DSQARFVLNLGRLIF-SMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYI---PSNINFNDIPDSFGKNGNWNFVDQFLTGRFDVKTTNTESEEDIQLT-QEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            +T++PP  FKA +F+L+GV PDRQKVM+ GGTLK+ +W  IKLK+G+T++MMG++E L     + +P F+EDMT+ Q+  A++LP GL N+GNTCY+NAT+QCLR++PE+  A++  S A  S   ++ ++++    R ++ +M+     + PI+ L+ LH   PQFA       E+G     +QQDANECW +++R LQ+ +      + +       +   +   NF+DQ+    ++     TESEE+  +  +E  LQLSCFI+++VKYL TG+R  L+  +TK S SL R+ALY +SSK+SRLPAYL++Q VRF+YKEKE +NAK+LK                                         + KK + S E K D       P+ + DDIGSNNSG Y+LQA++THQGRSSSSGHYV WV++  D W+K+DDD V+ V  EDILRLSGGGDWH AYVLLYGP+ +E
Sbjct:    1 NTEEPPMVFKAQLFALTGVQPDRQKVMVKGGTLKDDEWGNIKLKNGMTLLMMGSAEALPEEPAV-RPMFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCLRSVPELKTALRRYSGALRSSGANAPSQYITAALRDLYETMDKTSSSLPPIILLQFLHMAFPQFA-------EKGDQGQYLQQDANECWLQMMRVLQQKLEPLEPEAAMETESETGAAAASSKKNFIDQYFGVEYETSMKCTESEEEEPIKGKESQLQLSCFINQEVKYLATGLRLRLQEEITKMSPSLDRNALYIKSSKLSRLPAYLTVQMVRFFYKEKESVNAKVLK-----------------------------------------VLKKPDASKETKYD-------PFSFPDDIGSNNSGYYDLQAVLTHQGRSSSSGHYVAWVKRKDDEWVKFDDDKVSVVAPEDILRLSGGGDWHIAYVLLYGPRRLE 422          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp22 (ubiquitin carboxyl-terminal hydrolase 22 [Source:NCBI gene;Acc:101172905])

HSP 1 Score: 53.9138 bits (128), Expect = 3.023e-7
Identity = 50/184 (27.17%), Postives = 73/184 (39.67%), Query Frame = 2
Query:  983 YKRSSK---ISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIE 1525
            Y+ S+K   + +LP        RF +  K R   KI   + F + LDM  F                  M   K    R++ + +Q+ EV                    NN   Y L A+V HQG +  SGHY  ++RQ  D W K DD  +T+ + +D+L   G       Y+L Y    +E
Sbjct:  374 YQESTKQLTMKKLPIVACFHLKRFEHSAKLR--RKITTYVSFPLELDMTPF------------------MASSKES--RMNGQYQQTVEVL-------------------NNDNKYSLFAVVNHQG-TLESGHYTSFIRQHKDQWFKCDDAIITKASIKDVLDSEG-------YLLFYHKHFLE 508          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000033580.1 (SMESG000033580.1)

HSP 1 Score: 1050.43 bits (2715), Expect = 0.000e+0
Identity = 504/504 (100.00%), Postives = 504/504 (100.00%), Query Frame = 2
Query:   59 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEKWDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSKANESDSQARFVLNLGRLIFSMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGRFDVKTTNTESEEDIQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIEKNPNQDNGDQAVTRQ 1570
            MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEKWDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSKANESDSQARFVLNLGRLIFSMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGRFDVKTTNTESEEDIQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIEKNPNQDNGDQAVTRQ
Sbjct:    1 MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPGGTLKEKWDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSKANESDSQARFVLNLGRLIFSMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGRFDVKTTNTESEEDIQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFSESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIVLDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKSNIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIWLKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIEKNPNQDNGDQAVTRQ 504          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000038075.1 (SMESG000038075.1)

HSP 1 Score: 53.1434 bits (126), Expect = 4.058e-7
Identity = 40/128 (31.25%), Postives = 63/128 (49.22%), Query Frame = 2
Query:  305 ISKPKFIEDMTDSQITKALKLPQGLKNIGNTCYLNATIQCLRTIP---EVYKAIKMSSKANESDSQARFVLNLGR--LIFSMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQQDANE 673
            +  P   +D+ DS+ +  L    GLKN+GNTCY+NA +QCL  IP   E +++I  S   ++S +  +   NL    L +  +T  +P      +K+L+            PP +G     +QQDA E
Sbjct:  108 VDNPYNNDDLMDSERSLGL---VGLKNLGNTCYMNAALQCLLNIPQLTEYFESIHPSLYEHKSHTLTKHYQNLVNDILDYKRKTYVIPTGVCHTMKALY------------PPFRG----YVQQDAQE 216          
The following BLAST results are available for this feature:
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
USP148.544e-15947.90ubiquitin specific peptidase 14 [Source:HGNC Symbo... [more]
USP143.454e-15447.19ubiquitin specific peptidase 14 [Source:HGNC Symbo... [more]
USP142.433e-14245.09ubiquitin specific peptidase 14 [Source:HGNC Symbo... [more]
USP142.704e-13944.38ubiquitin specific peptidase 14 [Source:HGNC Symbo... [more]
USP27X2.920e-826.09ubiquitin specific peptidase 27 X-linked [Source:H... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
usp-149.372e-10639.37Ubiquitin carboxyl-terminal hydrolase 14 [Source:... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp146.685e-16348.17gene:FBgn0032216 transcript:FBtr0331669[more]
Usp146.685e-16348.17gene:FBgn0032216 transcript:FBtr0080061[more]
Usp476.503e-721.37gene:FBgn0016756 transcript:FBtr0306259[more]
Usp477.535e-721.37gene:FBgn0016756 transcript:FBtr0077096[more]
Usp477.535e-721.37gene:FBgn0016756 transcript:FBtr0077095[more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp141.177e-16749.50ubiquitin specific peptidase 14 (tRNA-guanine tran... [more]
usp229.500e-727.03ubiquitin specific peptidase 22 [Source:NCBI gene;... [more]
usp229.703e-727.03ubiquitin specific peptidase 22 [Source:NCBI gene;... [more]
usp372.887e-624.46ubiquitin specific peptidase 37 [Source:NCBI gene;... [more]
usp372.906e-624.46ubiquitin specific peptidase 37 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zmiz11.650e-16649.00zinc finger, MIZ-type containing 1 [Source:Xenbase... [more]
zmiz11.090e-16448.80zinc finger, MIZ-type containing 1 [Source:Xenbase... [more]
zmiz12.056e-16149.20zinc finger, MIZ-type containing 1 [Source:Xenbase... [more]
zmiz12.596e-16148.19zinc finger, MIZ-type containing 1 [Source:Xenbase... [more]
zmiz18.033e-16148.30zinc finger, MIZ-type containing 1 [Source:Xenbase... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp142.483e-15948.20ubiquitin specific peptidase 14 [Source:MGI Symbol... [more]
Usp141.531e-14245.40ubiquitin specific peptidase 14 [Source:MGI Symbol... [more]
Usp27x5.867e-925.93ubiquitin specific peptidase 27, X chromosome [Sou... [more]
Usp27x5.867e-925.93ubiquitin specific peptidase 27, X chromosome [Sou... [more]
Usp27x5.867e-925.93ubiquitin specific peptidase 27, X chromosome [Sou... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0IIF7|UBP14_BOVIN2.404e-15947.70Ubiquitin carboxyl-terminal hydrolase 14 OS=Bos ta... [more]
sp|P40826|UBP14_RABIT7.687e-15947.79Ubiquitin carboxyl-terminal hydrolase 14 OS=Orycto... [more]
sp|Q9JMA1|UBP14_MOUSE1.737e-15848.20Ubiquitin carboxyl-terminal hydrolase 14 OS=Mus mu... [more]
sp|P60051|UBP14_PANTR2.597e-15847.90Ubiquitin carboxyl-terminal hydrolase 14 OS=Pan tr... [more]
sp|P54578|UBP14_HUMAN4.103e-15847.90Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo s... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QYH53.048e-17753.41Ubiquitin carboxyl-terminal hydrolase OS=Crassostr... [more]
V4ALX13.642e-17352.10Ubiquitin carboxyl-terminal hydrolase OS=Lottia gi... [more]
A0A4Z2DHW83.959e-17150.78Ubiquitin carboxyl-terminal hydrolase OS=Schistoso... [more]
D6WPP31.834e-17051.01Ubiquitin carboxyl-terminal hydrolase OS=Tribolium... [more]
A0A0X3P0223.094e-16850.19Ubiquitin carboxyl-terminal hydrolase 14 OS=Schist... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp141.273e-16548.72ubiquitin specific peptidase 14 [Source:NCBI gene;... [more]
usp143.535e-14545.45ubiquitin specific peptidase 14 [Source:NCBI gene;... [more]
ENSAMXT00000041443.14.293e-726.63ubiquitin carboxyl-terminal hydrolase 22-like [Sou... [more]
usp221.373e-626.63ubiquitin carboxyl-terminal hydrolase 22 [Source:N... [more]
ENSAMXT00000044537.13.323e-635.38ubiquitin carboxyl-terminal hydrolase 37-like [Sou... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp149.398e-7141.75ubiquitin specific peptidase 14 (tRNA-guanine tran... [more]
usp223.920e-726.63ubiquitin specific peptidase 22 [Source:NCBI gene;... [more]
usp223.457e-636.00ubiquitin specific peptidase 22 [Source:NCBI gene;... [more]
usp35.460e-633.33ubiquitin specific peptidase 3 [Source:ZFIN;Acc:ZD... [more]
usp76.646e-635.00ubiquitin specific peptidase 7 (herpes virus-assoc... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
UBP63.837e-5529.37Ubiquitin-specific protease; situated in the base ... [more]
UBP92.995e-939.47Ubiquitin-specific protease that cleaves ubiquitin... [more]
UBP107.359e-939.68Ubiquitin-specific protease, deubiquitinates Ub-pr... [more]
UBP31.137e-823.51Ubiquitin-specific protease involved in transport ... [more]
UBP131.206e-734.62Ubiquitin-specific protease that cleaves Ub-protei... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO373718.077e-12942.60Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
usp141.770e-16749.00ubiquitin specific peptidase 14 [Source:NCBI gene;... [more]
usp144.477e-13344.35ubiquitin specific peptidase 14 [Source:NCBI gene;... [more]
usp223.023e-727.17ubiquitin carboxyl-terminal hydrolase 22 [Source:N... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000033580.10.000e+0100.00SMESG000033580.1[more]
SMESG000038075.14.058e-731.25SMESG000038075.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034487 ID=SMED30034487|Name=Ubiquitin carboxyl-terminal hydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=1644bp
GTTTAAATTGTTTGTTTCTTTTCATTTTGACTGACAATTTCAAATTTTTG
CTGAAGTGATGCCTATTTACAAAGTAAATATTAAGTGGCAAAAAGAAAAG
TTTAATGATATTGAATGTGATACTGATCAACCACCTGAAAATTTTAAAGC
TTTAATATTTTCCTTATCTGGCGTAGCTCCAGATAGGCAAAAAGTTATGA
TGCCCGGCGGAACACTTAAAGAAAAATGGGATGGAATCAAACTAAAAGAT
GGAGTTACCATTATGATGATGGGAACGTCAGAAGAACTATTAACAGTTGG
AGAAATATCAAAACCAAAATTTATTGAAGACATGACAGATAGTCAAATAA
CAAAAGCTCTTAAATTACCACAAGGATTAAAAAATATTGGAAATACTTGT
TATTTGAATGCAACGATTCAGTGTTTAAGAACCATTCCAGAAGTGTACAA
AGCTATTAAAATGTCATCAAAGGCAAACGAATCAGACTCTCAAGCGCGAT
TTGTTTTAAATCTTGGTAGGTTAATATTCAGTATGGAAACAGCGGAGGTC
CCAATTGCTCCTATTCTCCCTTTAAAATCTCTACATGAAATGTGTCCACA
ATTTGCGACAACTCAAACCGTTCCACCAGAACAAGGTGGTGGAACTGTTC
TTATGCAGCAGGATGCAAACGAATGTTGGGCAGAAATTATCCGATCCTTA
CAAAAGACTGTATATATTCCATCAAACATAAATTTCAATGATATACCTGA
TTCTTTTGGGAAAAATGGTAATTGGAATTTTGTCGATCAGTTTCTTACTG
GGCGTTTTGATGTCAAAACAACTAATACTGAAAGTGAAGAAGATATTCAA
TTAACACAAGAACCGTTTCTCCAATTAAGTTGCTTTATCGATAAAGATGT
AAAATATCTCCAGACTGGGATTAGAAATGGTCTTGAAACCAGTCTGACGA
AATTCTCAGAATCACTTTCCCGCGATGCTCTTTATAAACGTTCTTCGAAA
ATATCCCGTTTACCTGCTTATTTGTCATTGCAATTTGTTAGATTTTATTA
TAAAGAAAAAGAACGAATTAATGCAAAAATATTGAAGGATATTAAATTTT
CTATCGTTTTGGATATGTACGAATTTTGTACTGATGAATTAAAAGCTAAA
ATGCAACCAATGCGCGATAAATATAAATTGATGGAAGACAAGAAAGCTGA
AGCTGAAAGAATTAGTAAGAAAAATGAGCAATCGGCAGAAGTGAAGTTAG
ACAAATCGAATATTGAGCATTACCCTTATTGGTATTCTGATGATATCGGA
TCTAATAACAGTGGTATTTATGAGCTACAGGCAATTGTTACTCATCAAGG
CCGATCTAGTAGCAGTGGTCATTATGTTGGTTGGGTTAGACAAGTTGGGG
ATATTTGGCTAAAATACGATGATGATTACGTCACACAAGTTACAGCTGAG
GATATATTACGCCTGTCTGGGGGTGGTGATTGGCATTGCGCTTATGTGCT
GCTATATGGGCCAAAATTAATTGAAAAAAACCCGAATCAAGATAATGGAG
ATCAAGCTGTGACTCGACAAATGGATTTAAGTTGAAAAATGCTCAAGCTT
GATAAATAAGGGCAATAAATTATCTGTTGACTTTTTAAAAAAAA
back to top

protein sequence of SMED30034487-orf-1

>SMED30034487-orf-1 ID=SMED30034487-orf-1|Name=SMED30034487-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=509bp
MPIYKVNIKWQKEKFNDIECDTDQPPENFKALIFSLSGVAPDRQKVMMPG
GTLKEKWDGIKLKDGVTIMMMGTSEELLTVGEISKPKFIEDMTDSQITKA
LKLPQGLKNIGNTCYLNATIQCLRTIPEVYKAIKMSSKANESDSQARFVL
NLGRLIFSMETAEVPIAPILPLKSLHEMCPQFATTQTVPPEQGGGTVLMQ
QDANECWAEIIRSLQKTVYIPSNINFNDIPDSFGKNGNWNFVDQFLTGRF
DVKTTNTESEEDIQLTQEPFLQLSCFIDKDVKYLQTGIRNGLETSLTKFS
ESLSRDALYKRSSKISRLPAYLSLQFVRFYYKEKERINAKILKDIKFSIV
LDMYEFCTDELKAKMQPMRDKYKLMEDKKAEAERISKKNEQSAEVKLDKS
NIEHYPYWYSDDIGSNNSGIYELQAIVTHQGRSSSSGHYVGWVRQVGDIW
LKYDDDYVTQVTAEDILRLSGGGDWHCAYVLLYGPKLIEKNPNQDNGDQA
VTRQMDLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0016579protein deubiquitination
GO:0006511ubiquitin-dependent protein catabolic process
Vocabulary: molecular function
TermDefinition
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0005515protein binding
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR000626Ubiquitin-like_dom
IPR001394Peptidase_C19_UCH
IPR018200USP_CS
IPR019954Ubiquitin_CS
IPR028889USP_dom
IPR029071Ubiquitin-like_domsf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 45..449
e-value: 3.8E-84
score: 284.9
NoneNo IPR availablePANTHERPTHR43982FAMILY NOT NAMEDcoord: 1..443
NoneNo IPR availableCDDcd16104Ubl_USP14_likecoord: 1..29
e-value: 6.91E-7
score: 44.5305
IPR001394Peptidase C19, ubiquitin carboxyl-terminal hydrolasePFAMPF00443UCHcoord: 59..437
e-value: 2.0E-39
score: 135.6
IPR018200Ubiquitin specific protease, conserved sitePROSITEPS00973USP_2coord: 375..393
IPR018200Ubiquitin specific protease, conserved sitePROSITEPS00972USP_1coord: 60..75
IPR028889Ubiquitin specific protease domainPROSITEPS50235USP_3coord: 59..440
score: 30.061
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 57..437