Transducer of ERBB2, 1b

Overview
NameTransducer of ERBB2, 1b
Smed IDSMED30034477
Length (bp)1549
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transducer of ERBB2, 1b (SMED30034477) t-SNE clustered cells

Violin plots show distribution of expression levels for Transducer of ERBB2, 1b (SMED30034477) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transducer of ERBB2, 1b (SMED30034477) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transducer of ERBB2, 1b (SMED30034477) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034477

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30034477SMESG000063539.1 SmedASXL_004717SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30034477SMESG000063539.1 dd_Smed_v4_7444_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30034477SMESG000063539.1 dd_Smed_v4_7444_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034477SMESG000063539.1 dd_Smed_v4_7444_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034477SMESG000063539.1 dd_Smed_v4_7444_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30034477SMESG000063539.1 dd_Smed_v4_7444_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034477SMESG000063539.1 dd_Smed_v4_7444_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034477SMESG000063539.1 SMESG000039067.1 Contig37799newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034477SMESG000063539.1 SMESG000039067.1 Contig37799uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
central nervous systemSMED30034477SMESG000063539.1 DN313376ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30034477SMESG000063539.1 DN313376ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
zeta neoblastSMED30034477SMESG000063539.1 dd_Smed_v4_7444_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transducer of ERBB2, 1b vs. Ensembl Human
Match: TOB2 (transducer of ERBB2, 2 [Source:HGNC Symbol;Acc:HGNC:11980])

HSP 1 Score: 114.39 bits (285), Expect = 2.105e-27
Identity = 71/195 (36.41%), Postives = 107/195 (54.87%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLF-----RCNPVVNEHNFQSS------IYNETNNQ----------------SNFYLPKSLVP-SFTVSSFAKTKFGSTKLK 742
            M  EI VA+ +I+S LY+ LPRRR D F  EL  LLK K    W+P +P +G   RC  + G   DP++ +AA +SG+  E++   +P +EL +WIDP EV+YQ+G++ + +K L+      C     +   +SS      ++    +Q                S  ++P+S  P +FT +SFA TKFGSTK+K
Sbjct:    1 MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLKGSGFRCVHI-GEMVDPVVELAAKRSGLAVEDVRANVP-EELSVWIDPFEVSYQIGEKGA-VKVLYLDDSEGCGAPELDKEIKSSFNPDAQVFVPIGSQDSSLSNSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMK 192          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Human
Match: TOB1 (transducer of ERBB2, 1 [Source:HGNC Symbol;Acc:HGNC:11979])

HSP 1 Score: 102.449 bits (254), Expect = 3.029e-23
Identity = 54/144 (37.50%), Postives = 86/144 (59.72%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLP 673
            M  EI VA+ +I+S LY+ LPRRRV+ F  EL  LLK K    W+P +P++G   RC  + G   DP++  A+ +SG++ +++   LP+D L +WIDP EV+YQ+G++   +K L+  +   N       I N  N ++  ++P
Sbjct:    1 MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHI-GEKVDPVIEQASKESGLDIDDVRGNLPQD-LSVWIDPFEVSYQIGEK-GPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMP 141          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Human
Match: TOB1 (transducer of ERBB2, 1 [Source:HGNC Symbol;Acc:HGNC:11979])

HSP 1 Score: 102.449 bits (254), Expect = 3.029e-23
Identity = 54/144 (37.50%), Postives = 86/144 (59.72%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLP 673
            M  EI VA+ +I+S LY+ LPRRRV+ F  EL  LLK K    W+P +P++G   RC  + G   DP++  A+ +SG++ +++   LP+D L +WIDP EV+YQ+G++   +K L+  +   N       I N  N ++  ++P
Sbjct:    1 MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHI-GEKVDPVIEQASKESGLDIDDVRGNLPQD-LSVWIDPFEVSYQIGEK-GPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMP 141          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Human
Match: TOB2 (transducer of ERBB2, 2 [Source:HGNC Symbol;Acc:HGNC:11980])

HSP 1 Score: 92.4337 bits (228), Expect = 4.531e-22
Identity = 46/103 (44.66%), Postives = 65/103 (63.11%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTY 550
            M  EI VA+ +I+S LY+ LPRRR D F  EL  LLK K    W+P +P +G   RC  + G   DP++ +AA +SG+  E++   +P +EL +WIDP EV+Y
Sbjct:    1 MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLKGSGFRCVHI-GEMVDPVVELAAKRSGLAVEDVRANVP-EELSVWIDPFEVSY 101          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Human
Match: BTG1 (BTG anti-proliferation factor 1 [Source:HGNC Symbol;Acc:HGNC:1130])

HSP 1 Score: 87.4261 bits (215), Expect = 1.711e-19
Identity = 47/128 (36.72%), Postives = 72/128 (56.25%), Query Frame = 2
Query:  227 SKDLTMISEIAVAVTYIVSPLYSN--LPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPV 604
            ++  TMI EIA AV++I   L +      R++  F+  L  LL       WFP +P +G   RC R+N    DP++  AA + G++ +ELF  LP  EL +W+DP EV+Y++G+  S I  L+  +P 
Sbjct:    6 TRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHK-MDPLIGQAAQRIGLSSQELFRLLP-SELTLWVDPYEVSYRIGEDGS-ICVLYEASPA 130          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Fly
Match: Tob (gene:FBgn0028397 transcript:FBtr0301652)

HSP 1 Score: 97.4413 bits (241), Expect = 3.674e-21
Identity = 48/119 (40.34%), Postives = 75/119 (63.03%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCN 598
            M  EI VA+ +++S LY+ LPRRRV+ F  EL   L+ K    W+P +PF+G   RC +  G   D +L  AA +SG+   ++   LP +EL +WIDPGEV++++G++ + +K L+  N
Sbjct:    1 MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQDHWYPEKPFKGSAYRCLKT-GDPIDSVLERAARESGVPIGDILENLP-NELSVWIDPGEVSFRIGEKGA-VKILYTEN 116          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Fly
Match: Tob (gene:FBgn0028397 transcript:FBtr0074255)

HSP 1 Score: 97.4413 bits (241), Expect = 3.739e-21
Identity = 48/119 (40.34%), Postives = 75/119 (63.03%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCN 598
            M  EI VA+ +++S LY+ LPRRRV+ F  EL   L+ K    W+P +PF+G   RC +  G   D +L  AA +SG+   ++   LP +EL +WIDPGEV++++G++ + +K L+  N
Sbjct:    1 MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQDHWYPEKPFKGSAYRCLKT-GDPIDSVLERAARESGVPIGDILENLP-NELSVWIDPGEVSFRIGEKGA-VKILYTEN 116          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Fly
Match: Tob (gene:FBgn0028397 transcript:FBtr0310446)

HSP 1 Score: 97.4413 bits (241), Expect = 3.739e-21
Identity = 48/119 (40.34%), Postives = 75/119 (63.03%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCN 598
            M  EI VA+ +++S LY+ LPRRRV+ F  EL   L+ K    W+P +PF+G   RC +  G   D +L  AA +SG+   ++   LP +EL +WIDPGEV++++G++ + +K L+  N
Sbjct:    1 MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQDHWYPEKPFKGSAYRCLKT-GDPIDSVLERAARESGVPIGDILENLP-NELSVWIDPGEVSFRIGEKGA-VKILYTEN 116          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Fly
Match: Tob (gene:FBgn0028397 transcript:FBtr0310317)

HSP 1 Score: 95.9005 bits (237), Expect = 1.214e-20
Identity = 45/110 (40.91%), Postives = 70/110 (63.64%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNS 571
            M  EI VA+ +++S LY+ LPRRRV+ F  EL   L+ K    W+P +PF+G   RC +  G   D +L  AA +SG+   ++   LP +EL +WIDPGEV++++G++ +
Sbjct:    1 MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQDHWYPEKPFKGSAYRCLKT-GDPIDSVLERAARESGVPIGDILENLP-NELSVWIDPGEVSFRIGEKGA 108          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Zebrafish
Match: tob1b (transducer of ERBB2, 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2151])

HSP 1 Score: 118.627 bits (296), Expect = 2.460e-29
Identity = 73/200 (36.50%), Postives = 107/200 (53.50%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLP----------------------KSLVPS-----------FTVSSFAKTKFGSTKLK 742
            M  EI VA+ +I+S LY+ LPRRRV+ F  EL   LK K    W+P++P++G   RC  V G   DP++  AA +SG++ E++ N LP+D L +WIDP EV+YQ+G++ + +K L+  +   N       I N  N ++  ++P                       S+ PS           FT +SFA TKFGSTK+K
Sbjct:    1 MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERQLKKKYEGHWYPDKPYKGSGFRCIHV-GEKVDPVVEEAAKESGLDIEDVRNNLPQD-LSVWIDPFEVSYQIGEKGA-VKVLYIDDNSENGSELDKEIRNSFNPEAQVFMPISEPVGVSSESSSPSPPPFGQSASVSPSFMPQRSAQPLTFTTASFAATKFGSTKMK 197          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Zebrafish
Match: tob1a (transducer of ERBB2, 1a [Source:ZFIN;Acc:ZDB-GENE-031030-4])

HSP 1 Score: 106.686 bits (265), Expect = 4.055e-25
Identity = 58/146 (39.73%), Postives = 88/146 (60.27%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLPKS 679
            M  EI VA+ +I+S LY+ LPRRRV+ F  EL   LK K    W+P++P++G   RC  V G   DP++  AA +SG++ E++ N LP+D L +WIDP EV+YQ+G++   +K L+  +   N       I N  N ++  ++P S
Sbjct:    1 MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERQLKQKYEGHWYPDKPYKGSGFRCIHV-GEKVDPVVEQAAKESGLDIEDVRNNLPQD-LSVWIDPFEVSYQIGEKGP-VKVLYVDDSNDNGLELDKEIKNSFNPEAQVFMPIS 143          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Zebrafish
Match: si:dkey-42i9.4 (si:dkey-42i9.4 [Source:ZFIN;Acc:ZDB-GENE-030131-8398])

HSP 1 Score: 80.1073 bits (196), Expect = 2.510e-17
Identity = 46/142 (32.39%), Postives = 70/142 (49.30%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSN--LPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSN 661
            M +E++ A  ++   L     L   ++  F   L   L       WFPN PFRG   RC R+N    DP++  AA   G+ +E LF+ LP  EL +W+DP EV+Y++G+  S I  L+   P +++ N   S   E   +  
Sbjct:    1 MKTEVSTAANFVARLLRGTGLLSEEQLQQFRFSLEEALGDHYRHHWFPNAPFRGSGYRCIRINHK-MDPLIGKAACTIGLTKERLFSLLP-SELTMWVDPYEVSYRIGEDGS-ICVLYESTP-LSDKNLGDSCKGELRKEQQ 138          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Zebrafish
Match: si:dkey-42i9.4 (si:dkey-42i9.4 [Source:ZFIN;Acc:ZDB-GENE-030131-8398])

HSP 1 Score: 80.1073 bits (196), Expect = 2.510e-17
Identity = 46/142 (32.39%), Postives = 70/142 (49.30%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSN--LPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSN 661
            M +E++ A  ++   L     L   ++  F   L   L       WFPN PFRG   RC R+N    DP++  AA   G+ +E LF+ LP  EL +W+DP EV+Y++G+  S I  L+   P +++ N   S   E   +  
Sbjct:    1 MKTEVSTAANFVARLLRGTGLLSEEQLQQFRFSLEEALGDHYRHHWFPNAPFRGSGYRCIRINHK-MDPLIGKAACTIGLTKERLFSLLP-SELTMWVDPYEVSYRIGEDGS-ICVLYESTP-LSDKNLGDSCKGELRKEQQ 138          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Zebrafish
Match: btg2 (B-cell translocation gene 2 [Source:ZFIN;Acc:ZDB-GENE-000210-15])

HSP 1 Score: 72.7886 bits (177), Expect = 1.007e-14
Identity = 45/148 (30.41%), Postives = 75/148 (50.68%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIE-----LNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYL 670
            M  E++ A +++   L     R R+ D  ++     L   L       WFP++P +G   RC R+N    DP++  AA + G+   +LF+ LP+ EL +W+DP EV+Y++G+  S I  L+   P     +   S Y++  N  N Y+
Sbjct:    9 MTPEVSAAASFVCRLLRG---RGRLSDAQLQVFRDGLAQALSEHYQHHWFPDRPQKGSGYRCIRINHEM-DPLIGRAAGRIGLTSGQLFSLLPR-ELTMWVDPYEVSYRIGEDGS-ICVLYEAEPPTT--SPAPSAYDQMANCKNTYM 148          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Xenopus
Match: tob1 (transducer of ERBB2, 1 [Source:NCBI gene;Acc:549365])

HSP 1 Score: 117.857 bits (294), Expect = 5.306e-29
Identity = 73/204 (35.78%), Postives = 109/204 (53.43%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLP-----------------------KSLVP------SFTVSSFAKTKFGSTKLKPNSSVFAE 766
            M  EI VA+ +I+S LY+ LPRRRV+ F  EL  LLK K    W+P++P++G   RC  V G   +PI+  AA++SG+  E++   LP+D L +WIDP EV+YQ+G++  +IK L+  +   N       I N  N ++  ++P                        + +P      +FT + FA TKFGSTK+K N +  A 
Sbjct:    1 MQLEIKVALNFIISYLYNKLPRRRVNIFGEELEKLLKNKYEGHWYPDRPYKGSGFRCIHV-GEKVEPIIQQAANESGLEIEDIRRNLPQD-LSVWIDPSEVSYQIGEK-GQIKVLYVDDNSENGTELDKEIKNSFNPEAQAFMPINDQSSSVSSSPSPLFNETAAVSPTFMPRLNQPLTFTTAMFAATKFGSTKMKNNRNKIAR 201          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Xenopus
Match: tob2 (transducer of ERBB2, 2 [Source:NCBI gene;Acc:548967])

HSP 1 Score: 103.219 bits (256), Expect = 7.684e-24
Identity = 84/250 (33.60%), Postives = 121/250 (48.40%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLP---------KSLVPSFTVS------------------SFAKTKFGSTKLKPNSSVFAEP-----VRPNSLKLSTTIQDSPNNSLVFTPDSCNSGVLSPNCQNVLSS 895
            M  EI VA+ +I+S LY+ LPRRR D F  EL  LLK K    W+P +P +G   RC  + G   DP++  AA +SG++ +++   +P +EL +WIDP EV+YQ+G++ S +K L+    V N       I +  N ++  ++P          S  PSF  S                  +FA TKFGSTK+K      A       V+   L LS        +SL F+P       LSPN +  + S
Sbjct:    1 MHLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKGKYEGHWYPEKPLKGSGYRCVHI-GETVDPVVEQAARRSGLDIDDVRANVP-EELSVWIDPFEVSYQIGEKGS-VKVLY-LEDVENSTELDKEIKSSFNPEAQAFIPITNQETSLSNSPSPSFGQSPSPTFIPRASQPMTFTTATFAATKFGSTKMKKGGQRMARSPTNNLVKHKGLSLSM-------HSLNFSPAQGAPSQLSPNAKEFVFS 239          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Xenopus
Match: nde1 (nudE neurodevelopment protein 1 [Source:Xenbase;Acc:XB-GENE-1005616])

HSP 1 Score: 81.2629 bits (199), Expect = 1.571e-17
Identity = 40/112 (35.71%), Postives = 62/112 (55.36%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSN--LPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNS 571
            M++EI+ A  +I S L +   +  R++  F   L   +K      WFP  PF+G   RC R+N    DP++  AA   G++ + LF  LP  EL +W+DP EV+Y++G+  S
Sbjct:    1 MMTEISTAAAFITSLLKTTGVIEERQLQHFCQVLQEAMKDHYKHHWFPQNPFKGSGYRCLRINHKM-DPLIGQAAGHIGLSHQRLFQLLP-SELTLWVDPFEVSYRIGEDGS 110          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Xenopus
Match: btg2 (BTG family member 2 [Source:NCBI gene;Acc:496422])

HSP 1 Score: 74.7146 bits (182), Expect = 2.765e-15
Identity = 44/142 (30.99%), Postives = 75/142 (52.82%), Query Frame = 2
Query:  251 EIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCN-PVVNEH-NFQSSIYNETNNQSNFYL 670
            EI  AV ++ S L S L  +++  F   L + L       WFP++P +G   RC R+N    DP++   A +  ++ + L + LPK EL +W+DP EV+Y++G+  S I  L+  + P    H N +S +   +   S++ +
Sbjct:   16 EIVAAVNFLSSLLQSRLNEQQLRGFGKTLRNTLTEHYMHHWFPDKPAKGSGYRCIRINHK-MDPVISKVACRINMSNQHLLSLLPK-ELTLWVDPFEVSYRIGEDGS-ICVLYEASAPSARGHLNCKSELLGSSGTPSHYLM 154          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Xenopus
Match: btg1 (B-cell translocation gene 1, anti-proliferative [Source:NCBI gene;Acc:394522])

HSP 1 Score: 72.7886 bits (177), Expect = 1.647e-14
Identity = 41/112 (36.61%), Postives = 60/112 (53.57%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVD--DFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNS 571
            M  EI  AV++I   L +      +D   F   L  LL       WFP +P RG   RC R+N    DP++  AA + G+N +++F  LP  EL +W+DP EV+Y++G+  S
Sbjct:   10 MKPEIMAAVSFISKFLRTKGLMNDLDLQTFNQSLQELLADHYKHHWFPEKPSRGSAYRCIRINHK-MDPLIGEAADRIGLNSQQMFKLLP-SELTLWVDPYEVSYRIGEDGS 119          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Mouse
Match: Tob2 (transducer of ERBB2, 2 [Source:MGI Symbol;Acc:MGI:1888525])

HSP 1 Score: 110.153 bits (274), Expect = 4.106e-26
Identity = 70/194 (36.08%), Postives = 104/194 (53.61%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQ-------------------NSEIKCLFRCNPVV-------NEHNFQSSIYNETNNQSNFYLPKSLVP-SFTVSSFAKTKFGSTKLK 742
            M  EI VA+ +I+S LY+ LPRRR D F  EL  LL+ K    W+P +P +G   RC  + G   DP++ +AA +SG+  E++   +P +EL +WIDP EV+YQ+G++                   + EIK  F  +  V       +     S   +   + S  ++P+S  P +FT +SFA TKFGSTK+K
Sbjct:    1 MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLRKKYEGHWYPEKPLKGSGFRCVHI-GEVVDPVVELAAKRSGLAVEDVRANVP-EELSVWIDPFEVSYQIGEKGVVKVLYLGDSEASGTPELDKEIKSSFNPDAQVFVPIGSQDSSLSSSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMK 192          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Mouse
Match: Tob1 (transducer of ErbB-2.1 [Source:MGI Symbol;Acc:MGI:1349721])

HSP 1 Score: 102.449 bits (254), Expect = 2.615e-23
Identity = 54/144 (37.50%), Postives = 85/144 (59.03%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLP 673
            M  EI VA+ +I+S LY+ LPRRRV+ F  EL  LLK K    W+P +P++G   RC  V G   DP++  A+ +SG++ +++   LP+D L +WIDP EV+YQ+G++   +K L+  +           I N  N ++  ++P
Sbjct:    1 MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHV-GEKVDPVIEQASKESGLDIDDVRGNLPQD-LSVWIDPFEVSYQIGEKGP-VKVLYVDDSSETGCELDKEIKNSFNPEAQVFMP 141          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Mouse
Match: Btg1 (BTG anti-proliferation factor 1 [Source:MGI Symbol;Acc:MGI:88215])

HSP 1 Score: 87.4261 bits (215), Expect = 1.174e-19
Identity = 47/128 (36.72%), Postives = 72/128 (56.25%), Query Frame = 2
Query:  227 SKDLTMISEIAVAVTYIVSPLYSN--LPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPV 604
            ++  TMI EIA AV++I   L +      R++  F+  L  LL       WFP +P +G   RC R+N    DP++  AA + G++ +ELF  LP  EL +W+DP EV+Y++G+  S I  L+  +P 
Sbjct:    6 TRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHK-MDPLIGQAAQRIGLSSQELFRLLP-SELTLWVDPYEVSYRIGEDGS-ICVLYEASPA 130          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Mouse
Match: Btg1c (BTG anti-proliferation factor 1C [Source:MGI Symbol;Acc:MGI:3588265])

HSP 1 Score: 83.1889 bits (204), Expect = 3.017e-18
Identity = 52/140 (37.14%), Postives = 72/140 (51.43%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRR--VDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQ 655
            MI EI  A T+I   L +   R    +  F+  L  LL       WFP QP +G   RC R+N    DP++  AA + G++  ELF  LP  EL +W+DP EV+Y++G+  S I  L+  +PV        S +N TN Q
Sbjct:    1 MIGEICAAATFICKFLCTKGLRNEELLQTFSQSLQELLVEHYKHHWFPEQPCKGSGYRCIRINHK-MDPLVSQAAQQIGLSSRELFRLLP-SELTLWVDPYEVSYRIGEDGS-ICVLYEASPV------GGSSHNSTNAQ 131          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Mouse
Match: Btg1b (BTG anti-proliferation factor 1B [Source:MGI Symbol;Acc:MGI:3588262])

HSP 1 Score: 82.8037 bits (203), Expect = 3.592e-18
Identity = 52/140 (37.14%), Postives = 72/140 (51.43%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRR--VDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQ 655
            MI EI  A T+I   L +   R    +  F+  L  LL       WFP QP +G   RC R+N    DP++  AA + G++  ELF  LP  EL +W+DP EV+Y++G+  S I  L+  +PV        S +N TN Q
Sbjct:    1 MIGEICAAATFICKFLCTKGLRNEELLQTFSQSLQELLVEHYKHHWFPEQPCKGSGYRCIRINHK-MDPLVSQAAQQIGLSSRELFRLLP-SELTLWVDPYEVSYRIGEDGS-ICVLYEASPV------GGSSHNSTNAQ 131          
BLAST of Transducer of ERBB2, 1b vs. UniProt/SwissProt
Match: sp|Q14106|TOB2_HUMAN (Protein Tob2 OS=Homo sapiens OX=9606 GN=TOB2 PE=1 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 1.011e-26
Identity = 71/195 (36.41%), Postives = 107/195 (54.87%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLF-----RCNPVVNEHNFQSS------IYNETNNQ----------------SNFYLPKSLVP-SFTVSSFAKTKFGSTKLK 742
            M  EI VA+ +I+S LY+ LPRRR D F  EL  LLK K    W+P +P +G   RC  + G   DP++ +AA +SG+  E++   +P +EL +WIDP EV+YQ+G++ + +K L+      C     +   +SS      ++    +Q                S  ++P+S  P +FT +SFA TKFGSTK+K
Sbjct:    1 MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLKGSGFRCVHI-GEMVDPVVELAAKRSGLAVEDVRANVP-EELSVWIDPFEVSYQIGEKGA-VKVLYLDDSEGCGAPELDKEIKSSFNPDAQVFVPIGSQDSSLSNSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMK 192          
BLAST of Transducer of ERBB2, 1b vs. UniProt/SwissProt
Match: sp|Q9JM55|TOB2_MOUSE (Protein Tob2 OS=Mus musculus OX=10090 GN=Tob2 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 2.872e-25
Identity = 70/194 (36.08%), Postives = 104/194 (53.61%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQ-------------------NSEIKCLFRCNPVV-------NEHNFQSSIYNETNNQSNFYLPKSLVP-SFTVSSFAKTKFGSTKLK 742
            M  EI VA+ +I+S LY+ LPRRR D F  EL  LL+ K    W+P +P +G   RC  + G   DP++ +AA +SG+  E++   +P +EL +WIDP EV+YQ+G++                   + EIK  F  +  V       +     S   +   + S  ++P+S  P +FT +SFA TKFGSTK+K
Sbjct:    1 MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLRKKYEGHWYPEKPLKGSGFRCVHI-GEVVDPVVELAAKRSGLAVEDVRANVP-EELSVWIDPFEVSYQIGEKGVVKVLYLGDSEASGTPELDKEIKSSFNPDAQVFVPIGSQDSSLSSSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMK 192          
BLAST of Transducer of ERBB2, 1b vs. UniProt/SwissProt
Match: sp|Q8R5K6|TOB1_RAT (Protein Tob1 OS=Rattus norvegicus OX=10116 GN=Tob1 PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 6.526e-23
Identity = 55/144 (38.19%), Postives = 86/144 (59.72%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLP 673
            M  EI VA+ +I+S LY+ LPRRRV+ F  EL  LLK K    W+P +P++G   RC  V G   DP++  A+ +SG++ +++   LP+D L +WIDP EV+YQ+G++   +K L+  +   N       I N  N ++  ++P
Sbjct:    1 MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKQKYEGHWYPEKPYKGSGFRCIHV-GEKVDPVIEQASKESGLDIDDVRGNLPQD-LSVWIDPFEVSYQIGEK-GPVKVLYVDDSNENGCELDKEIKNSFNPEAQVFMP 141          
BLAST of Transducer of ERBB2, 1b vs. UniProt/SwissProt
Match: sp|P50616|TOB1_HUMAN (Protein Tob1 OS=Homo sapiens OX=9606 GN=TOB1 PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.455e-22
Identity = 54/144 (37.50%), Postives = 86/144 (59.72%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLP 673
            M  EI VA+ +I+S LY+ LPRRRV+ F  EL  LLK K    W+P +P++G   RC  + G   DP++  A+ +SG++ +++   LP+D L +WIDP EV+YQ+G++   +K L+  +   N       I N  N ++  ++P
Sbjct:    1 MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHI-GEKVDPVIEQASKESGLDIDDVRGNLPQD-LSVWIDPFEVSYQIGEK-GPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMP 141          
BLAST of Transducer of ERBB2, 1b vs. UniProt/SwissProt
Match: sp|Q61471|TOB1_MOUSE (Protein Tob1 OS=Mus musculus OX=10090 GN=Tob1 PE=1 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 1.829e-22
Identity = 54/144 (37.50%), Postives = 85/144 (59.03%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLP 673
            M  EI VA+ +I+S LY+ LPRRRV+ F  EL  LLK K    W+P +P++G   RC  V G   DP++  A+ +SG++ +++   LP+D L +WIDP EV+YQ+G++   +K L+  +           I N  N ++  ++P
Sbjct:    1 MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHV-GEKVDPVIEQASKESGLDIDDVRGNLPQD-LSVWIDPFEVSYQIGEKGP-VKVLYVDDSSETGCELDKEIKNSFNPEAQVFMP 141          
BLAST of Transducer of ERBB2, 1b vs. TrEMBL
Match: S9XDN2 (Protein Tob2-like protein OS=Camelus ferus OX=419612 GN=CB1_000168029 PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 2.052e-27
Identity = 69/174 (39.66%), Postives = 106/174 (60.92%), Query Frame = 2
Query:  221 ALSKDLTMISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLPKSLVPSFTVSSFAKTKFGSTKLK 742
            +L ++ TM  EI VA+ +I+S LY+ LPRRR D F  EL  LLK K    W+P++P +G   RC  + G   DP++ +AA +SG+  E++   +P +EL +WIDP EV+YQ+G++ + +K L+  +   +E      +  E  +  N   P +   +FT +SFA TKFGSTK+K
Sbjct:   27 SLREERTMQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPDKPLKGSGFRCVHI-GEIVDPVVELAAKRSGLAVEDVRANVP-EELSVWIDPYEVSYQIGEKGA-VKVLYLDD---SEGCVAPELDKEIKSSFN---PDAQPITFTTASFAATKFGSTKMK 191          
BLAST of Transducer of ERBB2, 1b vs. TrEMBL
Match: G9KUL3 (Transducer of ERBB2, 2 (Fragment) OS=Mustela putorius furo OX=9669 PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 4.667e-26
Identity = 72/199 (36.18%), Postives = 109/199 (54.77%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLF-----RCNPVVNEHNFQSS------IYNETNNQ----------------SNFYLPKSLVP-SFTVSSFAKTKFGSTKLKPNSS 754
            M  EI VA+ +I+S LY+ LPRRR D F  EL  LLK K    W+P++P +G   RC  + G   DP++ +AA +SG+  E++   +P +EL +WIDP EV+YQ+G++ + +K L+      C     +  F+SS      ++    +Q                S  ++P+S  P +FT +SFA TKFGSTK+K    
Sbjct:    2 MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPDKPLKGSGFRCVHI-GELVDPVVELAARRSGLAVEDVRANVP-EELSVWIDPFEVSYQIGEKGA-VKVLYLDDSEGCVAPELDKEFKSSFNPDAQVFVPIGSQDSSLSNSPSPSLGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMKKGGG 197          
BLAST of Transducer of ERBB2, 1b vs. TrEMBL
Match: A0A3N0Y0C1 (Protein Tob1 OS=Anabarilius grahami OX=495550 GN=DPX16_4671 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 4.882e-26
Identity = 72/199 (36.18%), Postives = 107/199 (53.77%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNF-------------------------------YLPKSLVP-SFTVSSFAKTKFGSTKLK 742
            M  EI VA+ +I+S LY+ LPRRRV+ F  EL   LK K    W+P++P++G   RC  V G   DP++  AA +SG++ E++ N LP+D L +WIDP EV+YQ+G++ + +K L+  +   N       I N  N ++                                 ++P+S  P +FT +SFA TKFGSTK+K
Sbjct:    1 MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERQLKKKYEGHWYPDKPYKGSGFRCIHV-GEKVDPVVEEAAKESGLDIEDVRNNLPQD-LSVWIDPFEVSYQIGEKGA-VKVLYVDDNSENGSELDKEIRNSFNPEAQVFMPITDPVGVSSESSSPSPPPFGQSAAVSPSFMPRSAQPLTFTTASFAATKFGSTKMK 196          
BLAST of Transducer of ERBB2, 1b vs. TrEMBL
Match: Q6IQP8 (Transducer of ERBB2, 1b OS=Danio rerio OX=7955 GN=tob1b PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 4.892e-26
Identity = 73/200 (36.50%), Postives = 107/200 (53.50%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLP----------------------KSLVPS-----------FTVSSFAKTKFGSTKLK 742
            M  EI VA+ +I+S LY+ LPRRRV+ F  EL   LK K    W+P++P++G   RC  V G   DP++  AA +SG++ E++ N LP+D L +WIDP EV+YQ+G++ + +K L+  +   N       I N  N ++  ++P                       S+ PS           FT +SFA TKFGSTK+K
Sbjct:    1 MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERQLKKKYEGHWYPDKPYKGSGFRCIHV-GEKVDPVVEEAAKESGLDIEDVRNNLPQD-LSVWIDPFEVSYQIGEKGA-VKVLYVDDNSENGSELDKEIRNSFNPEAQVFMPISEPVGVSSESSSPSPPPFGQSASVSPSFMPQRSAQPLTFTTASFAATKFGSTKMK 197          
BLAST of Transducer of ERBB2, 1b vs. TrEMBL
Match: Q7SZP8 (Transducer of ERBB2, 1b OS=Danio rerio OX=7955 GN=tob1b PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 5.504e-26
Identity = 73/200 (36.50%), Postives = 107/200 (53.50%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLP----------------------KSLVPS-----------FTVSSFAKTKFGSTKLK 742
            M  EI VA+ +I+S LY+ LPRRRV+ F  EL   LK K    W+P++P++G   RC  V G   DP++  AA +SG++ E++ N LP+D L +WIDP EV+YQ+G++ + +K L+  +   N       I N  N ++  ++P                       S+ PS           FT +SFA TKFGSTK+K
Sbjct:    1 MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERQLKKKYEGHWYPDKPYKGSGFRCIHV-GEKVDPVVEEAAKESGLDIEDVRNNLPQD-LSVWIDPFEVSYQIGEKGA-VKVLYIDDNSENGSELDKEIRNSFNPEAQVFMPISEPVGVSSESSSPSPPPFGQSASVSPSFMPQRSAQPLTFTTASFAATKFGSTKMK 197          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Cavefish
Match: tob1b (transducer of ERBB2, 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2151])

HSP 1 Score: 108.612 bits (270), Expect = 4.817e-26
Identity = 59/146 (40.41%), Postives = 87/146 (59.59%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLPKS 679
            M  EI VA+ +I+S LY+ LPRRRV+ F  EL   LK K    W+P++PF+G   RC  V G   DP++  AA +SG++ E++ N LP+D L +WIDP EV+YQ+G++   +K L+  +   N       I N  N  +  ++P S
Sbjct:    1 MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERQLKKKYEGHWYPDKPFKGSGYRCIHV-GEKVDPVVEEAAKESGLDIEDVRNNLPQD-LSVWIDPFEVSYQIGEK-GPVKVLYVDDNGENGSELDKEIRNSFNPDAQVFMPIS 143          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Cavefish
Match: tob1a (transducer of ERBB2, 1a [Source:ZFIN;Acc:ZDB-GENE-031030-4])

HSP 1 Score: 108.997 bits (271), Expect = 9.638e-26
Identity = 58/150 (38.67%), Postives = 89/150 (59.33%), Query Frame = 2
Query:  224 LSKDLTMISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLP 673
            L +   M  EI VA+ +I+S LY+ LPRRRV+ F  EL   LK K    W+P++P++G   RC  V G   DP++  AA +SG++ E++ N LP+D L +WIDP EV+YQ+G++   +K L+  +   N       I N  N ++  ++P
Sbjct:   10 LGRSAAMQLEIQVALNFIISYLYNKLPRRRVNIFGEELERQLKQKYEGHWYPDKPYKGSGFRCIHV-GEKVDPVVEQAAKESGLDIEDVRNNLPQD-LSVWIDPFEVSYQIGEKGP-VKVLYVDDSNDNGLELDKEIKNSFNPEAQVFMP 156          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Cavefish
Match: TOB2 (transducer of ERBB2, 2 [Source:HGNC Symbol;Acc:HGNC:11980])

HSP 1 Score: 100.523 bits (249), Expect = 5.620e-23
Identity = 72/210 (34.29%), Postives = 99/210 (47.14%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNP--------------------------------------VVNEHNFQSSIYNETNNQSNFYLPK--SLVP---SFTVSSFAKTKFGSTKLK 742
            M  E+ VA+ +IVS LY+ LPRRR D F  EL  +L  +    W+P  P RG   RC  + G   DPI+ +AA +SG++ EE+   +P  EL IWIDP EV+YQ+G++   +K L+  +P                                       V      S +    N  SN   P   +  P   +FT +SFA TKFGSTK+K
Sbjct:    1 MHLEVKVALNFIVSYLYNKLPRRRADLFGEELERILVSRFEGHWYPEAPLRGSAFRCLHL-GAPRDPIVDLAARRSGLDTEEVRANVPP-ELSIWIDPYEVSYQIGEKGV-VKVLYIEDPPGLGVEGEASDSAVCPVSKVDLELDEGKSLGFNPDAQVFVPIGGHVSPVLLNPNTHSNASSPSPPTTAPQPITFTTASFAATKFGSTKMK 207          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Cavefish
Match: si:dkey-42i9.4 (protein BTG1-like [Source:NCBI gene;Acc:103025083])

HSP 1 Score: 77.7962 bits (190), Expect = 1.148e-16
Identity = 43/122 (35.25%), Postives = 67/122 (54.92%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSN--LPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNP 601
            M +E++ AV +I + L     L   ++  F++ L   L       WFP+ P RG   RC R+N    DP++  AA   G+ +E+LF+ LP  EL +W+DP EV+Y++G+  S I  L+   P
Sbjct:    1 MKTEVSTAVNFISTLLRGTGLLSEEQLHHFSLSLEEALGEHYQHHWFPDAPCRGSGYRCIRINHK-MDPLIGKAALTIGLTREQLFSLLPS-ELTMWVDPYEVSYRIGEDGS-ICVLYESAP 119          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Cavefish
Match: si:dkey-42i9.4 (protein BTG1-like [Source:NCBI gene;Acc:103025083])

HSP 1 Score: 77.7962 bits (190), Expect = 1.148e-16
Identity = 43/122 (35.25%), Postives = 67/122 (54.92%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSN--LPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNP 601
            M +E++ AV +I + L     L   ++  F++ L   L       WFP+ P RG   RC R+N    DP++  AA   G+ +E+LF+ LP  EL +W+DP EV+Y++G+  S I  L+   P
Sbjct:    1 MKTEVSTAVNFISTLLRGTGLLSEEQLHHFSLSLEEALGEHYQHHWFPDAPCRGSGYRCIRINHK-MDPLIGKAALTIGLTREQLFSLLPS-ELTMWVDPYEVSYRIGEDGS-ICVLYESAP 119          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008121.1 (pep scaffold:Pmarinus_7.0:GL492076:4302:5113:-1 gene:ENSPMAG00000007341.1 transcript:ENSPMAT00000008121.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 1.208e-6
Identity = 25/55 (45.45%), Postives = 36/55 (65.45%), Query Frame = 2
Query:  407 RCFRVNGTYA-DPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQN 568
            RC R+NG  A DP+L  A   SG+   EL   LP+ EL +W+DPGEV+ + G+++
Sbjct:    1 RCLRMNGIAAVDPVLATACEASGVAYVELC--LPR-ELTVWVDPGEVSCRYGEKS 52          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Nematostella
Match: EDO38535 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCK5])

HSP 1 Score: 89.3521 bits (220), Expect = 1.106e-21
Identity = 47/106 (44.34%), Postives = 68/106 (64.15%), Query Frame = 2
Query:  251 EIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQN 568
            EI V+V ++++ LY+ LPRRRVD F  EL   L  K    W+PN+P +G   RC  +   Y DPIL  AA +SG+  +++   LP ++L +WIDP EV+Y++G QN
Sbjct:    1 EIQVSVNFLMNFLYNKLPRRRVDLFGEELAMKLTKKFDGHWYPNKPTKGSGYRCILIT-HYLDPILAAAARESGLKIDDVKANLP-EKLCLWIDPHEVSYRIGKQN 104          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Nematostella
Match: EDO41701 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3C6])

HSP 1 Score: 69.3218 bits (168), Expect = 5.117e-14
Identity = 38/112 (33.93%), Postives = 64/112 (57.14%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLY--SNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNS 571
            M +E+  A +++ + L   + +  RRV+DF+ ++  LL  +    W P  P  G   RC R+N T  DPI+  AA  +G + E+L +F   +EL +W+DP EV +++G+  S
Sbjct:    1 MKTEVRTACSFLATILRRSTKVNDRRVEDFSTKMEELLCERYRHHWHPQNPLLGSGFRCIRINHTM-DPIVAAAARAAGFSYEQLKSF--PEELTLWVDPNEVCFRIGENGS 109          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Nematostella
Match: EDO43445 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYE1])

HSP 1 Score: 67.0106 bits (162), Expect = 9.385e-14
Identity = 38/107 (35.51%), Postives = 58/107 (54.21%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLY-SNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVG 559
            M +E++ AV ++VS L  ++L   +V  F   L  L+  +    W PN+P +G   RC  V+ T  DP+L  A+  SG +  +L    P D L +WIDP +V  +VG
Sbjct:    1 MKNEVSSAVNFVVSNLTNTSLSSEQVGQFKENLEQLITERFQDHWHPNKPLKGNAYRCLNVDTTAIDPLLVKASLASGFSPLKLQEVFP-DGLALWIDPEDVCCRVG 106          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Medaka
Match: TOB2 (transducer of ERBB2, 2 [Source:NCBI gene;Acc:101169611])

HSP 1 Score: 111.694 bits (278), Expect = 3.827e-27
Identity = 78/238 (32.77%), Postives = 120/238 (50.42%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEH------NFQSSIYNETNNQSNFYL----------------PKSLVPSFTVSSFAKTKFGSTKLKPNSSVFAEPV--RPNSLKLSTTIQDSPNNSLVFTPDSCNSGVLSPNCQN 883
            M  E+ VA+ +IVS LY+ LPRRR D F  EL  +L  +    W+P  P RG   RC  + G   DP++ +AA +SG++ EE+   +P  EL +WIDP EV+YQ+G+Q   +K L+  +P   E       N  + ++    +Q +  L                P  +  +FT +SFA TKFGSTK+K  S   +  +   P ++     I+  P +  + +  +  S  LSPN + 
Sbjct:    1 MHLEVKVALNFIVSYLYNKLPRRRADLFGEELEKILVSRFDGHWYPEAPMRGSAFRCIHL-GAQRDPVVELAAKRSGLDTEEVRANVPA-ELSVWIDPYEVSYQIGEQGP-VKLLYLEDPPEAEEGKTMGFNPDAQVFVPVGSQVSPALMPSLSSSPTPLSSQPCPGPM--TFTTASFAATKFGSTKMKKCSGAGSVMLSRSPTTMSAPELIKHKPLSLSLHSLGAPMSSQLSPNAKE 233          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Medaka
Match: tob1b (transducer of ERBB2, 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2151])

HSP 1 Score: 107.071 bits (266), Expect = 2.368e-25
Identity = 57/146 (39.04%), Postives = 88/146 (60.27%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLPKS 679
            M  EI VA+ +I+S LY+ LPRRRV+ F  EL   L+ K    W+P +P++G   RC  V G   DP++  AA +SG++ E++ N LP+D L +WIDP EV+YQ+G++ + +K L+  +   N       I N  N ++  ++P S
Sbjct:    1 MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERQLRRKYEGHWYPEKPYKGSGFRCIHV-GEKVDPVVERAAKESGLDIEDVRNNLPQD-LSVWIDPFEVSYQIGEKGA-VKVLYVDDNGENGSELDREIKNSFNPEAQVFMPIS 143          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Medaka
Match: tob1a (transducer of ERBB2, 1 [Source:NCBI gene;Acc:101171994])

HSP 1 Score: 87.4261 bits (215), Expect = 3.171e-18
Identity = 44/97 (45.36%), Postives = 63/97 (64.95%), Query Frame = 2
Query:  299 LPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLF 589
            LPRRRV+ F  EL   LK K    W+P++P++G   RC  V G   DP++  AA +SG+  E++ N LP+D L +WIDP EV+YQ+G++   IK L+
Sbjct:   59 LPRRRVNIFGEELERQLKQKYEGHWYPDKPYKGSGFRCIHV-GEKVDPVVEKAAKESGLEIEDVRNNLPQD-LSVWIDPYEVSYQIGEKGP-IKVLY 152          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Medaka
Match: tob1a (transducer of ERBB2, 1 [Source:NCBI gene;Acc:101171994])

HSP 1 Score: 86.6557 bits (213), Expect = 6.686e-18
Identity = 44/98 (44.90%), Postives = 63/98 (64.29%), Query Frame = 2
Query:  296 NLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLF 589
             LPRRRV+ F  EL   LK K    W+P++P++G   RC  V G   DP++  AA +SG+  E++ N LP+D L +WIDP EV+YQ+G++   IK L+
Sbjct:   89 KLPRRRVNIFGEELERQLKQKYEGHWYPDKPYKGSGFRCIHV-GEKVDPVVEKAAKESGLEIEDVRNNLPQD-LSVWIDPYEVSYQIGEKGP-IKVLY 183          
BLAST of Transducer of ERBB2, 1b vs. Ensembl Medaka
Match: btg1 (BTG anti-proliferation factor 1 [Source:NCBI gene;Acc:101169651])

HSP 1 Score: 72.0182 bits (175), Expect = 2.502e-14
Identity = 41/123 (33.33%), Postives = 67/123 (54.47%), Query Frame = 2
Query:  239 TMISEIAVAVTYIVSPLY--SNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNP 601
            TM  EI  AV ++   L    ++  R+V  F+  L  +L  +    WFP++P +G   RC R+N    DP++  A  + G+  ++L+  LP  EL +W+DP EV+Y++G+  S I  L+   P
Sbjct:    9 TMKPEITAAVGFLSRFLRVKGHVNDRQVQTFSQSLQDILAEQYKHHWFPDRPCKGSGYRCIRIN-HKMDPLVGQAGQRIGLTIQQLYLLLP-SELTLWVDPFEVSYRIGEDGS-ICVLYESQP 128          
BLAST of Transducer of ERBB2, 1b vs. Planmine SMEST
Match: SMESG000063539.1 (SMESG000063539.1)

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 273/273 (100.00%), Postives = 273/273 (100.00%), Query Frame = 2
Query:  242 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLPKSLVPSFTVSSFAKTKFGSTKLKPNSSVFAEPVRPNSLKLSTTIQDSPNNSLVFTPDSCNSGVLSPNCQNVLSSPESTTLNIPCYLPWNVDPNNNLLTINIPHYSTTNGRESSGAGSLNSELSSPVHGY 1060
            MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLPKSLVPSFTVSSFAKTKFGSTKLKPNSSVFAEPVRPNSLKLSTTIQDSPNNSLVFTPDSCNSGVLSPNCQNVLSSPESTTLNIPCYLPWNVDPNNNLLTINIPHYSTTNGRESSGAGSLNSELSSPVHGY
Sbjct:    1 MISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLPKSLVPSFTVSSFAKTKFGSTKLKPNSSVFAEPVRPNSLKLSTTIQDSPNNSLVFTPDSCNSGVLSPNCQNVLSSPESTTLNIPCYLPWNVDPNNNLLTINIPHYSTTNGRESSGAGSLNSELSSPVHGY 273          
BLAST of Transducer of ERBB2, 1b vs. Planmine SMEST
Match: SMESG000080545.1 (SMESG000080545.1)

HSP 1 Score: 62.003 bits (149), Expect = 2.943e-10
Identity = 75/244 (30.74%), Postives = 111/244 (45.49%), Query Frame = 2
Query:  251 EIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWID----PGEVTYQVGDQ---NSEIKCLFRCN---PVVNEHNFQSSIYN----ETNNQSNFYLPKSLVPSFTVSSFAKTKFGSTKLKPN-------SSVFAEP-----VRPNSLKLSTTIQDSPNNSLVFTPDSCNSGVLSPNCQNVLSSPES 904
            E  VAV +I+S LY+ LPRRRVD F   L  LL+  +  FW         H + + V+  +     YI     GI   ++ + + ++ + I+ D      E   QV +Q   +S  K   R     P  +   +Q+        + +++  F    S  P+FT +SFA+TKFGSTKLK         SS  A+      V P ++ L  +I+ SP    V T DS +S  LSP   +   SP S
Sbjct:    2 EATVAVNFILSYLYNKLPRRRVDMFGEMLEQLLQSNLEKFWVSQ---FSKHDQTYEVSYVFT---FYI-----GIGTNQVNSMINQNRISIFGDLINEKYERKSQVQEQELISSTEKITLRTTGTLPYSSTFAWQTPSVGPQIVQVSSEGCFIQKSSSTPNFTAASFAQTKFGSTKLKSQLKRSSRISSYLAQQRSLVGVIPATIALEPSIK-SPK---VATSDSPSS--LSPFTSSYFESPTS 228          
BLAST of Transducer of ERBB2, 1b vs. Planmine SMEST
Match: SMESG000080545.1 (SMESG000080545.1)

HSP 1 Score: 61.2326 bits (147), Expect = 4.609e-10
Identity = 54/164 (32.93%), Postives = 71/164 (43.29%), Query Frame = 2
Query:  251 EIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLLKLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNFLPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETNNQSNFYLPKSLVPSFTVSSFAKTKFGSTKLK 742
            E  VAV +I+S LY+ LPRRRVD F   L  LL+  +  FW     F    Q        + D I      KS + ++EL +   K  L+     G + Y                P V     Q S      ++  F    S  P+FT +SFA+TKFGSTKLK
Sbjct:    2 EATVAVNFILSYLYNKLPRRRVDMFGEMLEQLLQSNLEKFWVSQ--FSKHDQTYENRISIFGDLINEKYERKSQVQEQELISSTEKITLR---TTGTLPYS--------STFAWQTPSVGPQIVQVS------SEGCFIQKSSSTPNFTAASFAQTKFGSTKLK 146          
The following BLAST results are available for this feature:
BLAST of Transducer of ERBB2, 1b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TOB22.105e-2736.41transducer of ERBB2, 2 [Source:HGNC Symbol;Acc:HGN... [more]
TOB13.029e-2337.50transducer of ERBB2, 1 [Source:HGNC Symbol;Acc:HGN... [more]
TOB13.029e-2337.50transducer of ERBB2, 1 [Source:HGNC Symbol;Acc:HGN... [more]
TOB24.531e-2244.66transducer of ERBB2, 2 [Source:HGNC Symbol;Acc:HGN... [more]
BTG11.711e-1936.72BTG anti-proliferation factor 1 [Source:HGNC Symbo... [more]
back to top
BLAST of Transducer of ERBB2, 1b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transducer of ERBB2, 1b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Tob3.674e-2140.34gene:FBgn0028397 transcript:FBtr0301652[more]
Tob3.739e-2140.34gene:FBgn0028397 transcript:FBtr0074255[more]
Tob3.739e-2140.34gene:FBgn0028397 transcript:FBtr0310446[more]
Tob1.214e-2040.91gene:FBgn0028397 transcript:FBtr0310317[more]
back to top
BLAST of Transducer of ERBB2, 1b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tob1b2.460e-2936.50transducer of ERBB2, 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
tob1a4.055e-2539.73transducer of ERBB2, 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
si:dkey-42i9.42.510e-1732.39si:dkey-42i9.4 [Source:ZFIN;Acc:ZDB-GENE-030131-83... [more]
si:dkey-42i9.42.510e-1732.39si:dkey-42i9.4 [Source:ZFIN;Acc:ZDB-GENE-030131-83... [more]
btg21.007e-1430.41B-cell translocation gene 2 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Transducer of ERBB2, 1b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tob15.306e-2935.78transducer of ERBB2, 1 [Source:NCBI gene;Acc:54936... [more]
tob27.684e-2433.60transducer of ERBB2, 2 [Source:NCBI gene;Acc:54896... [more]
nde11.571e-1735.71nudE neurodevelopment protein 1 [Source:Xenbase;Ac... [more]
btg22.765e-1530.99BTG family member 2 [Source:NCBI gene;Acc:496422][more]
btg11.647e-1436.61B-cell translocation gene 1, anti-proliferative [S... [more]
back to top
BLAST of Transducer of ERBB2, 1b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tob24.106e-2636.08transducer of ERBB2, 2 [Source:MGI Symbol;Acc:MGI:... [more]
Tob12.615e-2337.50transducer of ErbB-2.1 [Source:MGI Symbol;Acc:MGI:... [more]
Btg11.174e-1936.72BTG anti-proliferation factor 1 [Source:MGI Symbol... [more]
Btg1c3.017e-1837.14BTG anti-proliferation factor 1C [Source:MGI Symbo... [more]
Btg1b3.592e-1837.14BTG anti-proliferation factor 1B [Source:MGI Symbo... [more]
back to top
BLAST of Transducer of ERBB2, 1b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14106|TOB2_HUMAN1.011e-2636.41Protein Tob2 OS=Homo sapiens OX=9606 GN=TOB2 PE=1 ... [more]
sp|Q9JM55|TOB2_MOUSE2.872e-2536.08Protein Tob2 OS=Mus musculus OX=10090 GN=Tob2 PE=2... [more]
sp|Q8R5K6|TOB1_RAT6.526e-2338.19Protein Tob1 OS=Rattus norvegicus OX=10116 GN=Tob1... [more]
sp|P50616|TOB1_HUMAN1.455e-2237.50Protein Tob1 OS=Homo sapiens OX=9606 GN=TOB1 PE=1 ... [more]
sp|Q61471|TOB1_MOUSE1.829e-2237.50Protein Tob1 OS=Mus musculus OX=10090 GN=Tob1 PE=1... [more]
back to top
BLAST of Transducer of ERBB2, 1b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
S9XDN22.052e-2739.66Protein Tob2-like protein OS=Camelus ferus OX=4196... [more]
G9KUL34.667e-2636.18Transducer of ERBB2, 2 (Fragment) OS=Mustela putor... [more]
A0A3N0Y0C14.882e-2636.18Protein Tob1 OS=Anabarilius grahami OX=495550 GN=D... [more]
Q6IQP84.892e-2636.50Transducer of ERBB2, 1b OS=Danio rerio OX=7955 GN=... [more]
Q7SZP85.504e-2636.50Transducer of ERBB2, 1b OS=Danio rerio OX=7955 GN=... [more]
back to top
BLAST of Transducer of ERBB2, 1b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tob1b4.817e-2640.41transducer of ERBB2, 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
tob1a9.638e-2638.67transducer of ERBB2, 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
TOB25.620e-2334.29transducer of ERBB2, 2 [Source:HGNC Symbol;Acc:HGN... [more]
si:dkey-42i9.41.148e-1635.25protein BTG1-like [Source:NCBI gene;Acc:103025083][more]
si:dkey-42i9.41.148e-1635.25protein BTG1-like [Source:NCBI gene;Acc:103025083][more]
back to top
BLAST of Transducer of ERBB2, 1b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008121.11.208e-645.45pep scaffold:Pmarinus_7.0:GL492076:4302:5113:-1 ge... [more]
back to top
BLAST of Transducer of ERBB2, 1b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transducer of ERBB2, 1b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO385351.106e-2144.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417015.117e-1433.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434459.385e-1435.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transducer of ERBB2, 1b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TOB23.827e-2732.77transducer of ERBB2, 2 [Source:NCBI gene;Acc:10116... [more]
tob1b2.368e-2539.04transducer of ERBB2, 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
tob1a3.171e-1845.36transducer of ERBB2, 1 [Source:NCBI gene;Acc:10117... [more]
tob1a6.686e-1844.90transducer of ERBB2, 1 [Source:NCBI gene;Acc:10117... [more]
btg12.502e-1433.33BTG anti-proliferation factor 1 [Source:NCBI gene;... [more]
back to top
BLAST of Transducer of ERBB2, 1b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000063539.10.000e+0100.00SMESG000063539.1[more]
SMESG000080545.12.943e-1030.74SMESG000080545.1[more]
SMESG000080545.14.609e-1032.93SMESG000080545.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034477 ID=SMED30034477|Name=Transducer of ERBB2, 1b|organism=Schmidtea mediterranea sexual|type=transcript|length=1549bp
TTTGTAAATTCGAATAAATTTGTTTCATATTGATAAAATTGAAATATTTG
TAGTTTGTTTTAAAATCTGAATGAGATAAAAATAATTTAACCGCATCATT
TTTCCTATTGATAAGTAGACATCATCAGTCTAAATATAGAATTTCTCTGA
TACGATTGGATATTTTGTGTTGGAGAATTTTTAATCAAACTCTGACGCCA
TGTCAGTAGGCGCTAAAGGTGCATTATCAAAGGATCTAACAATGATATCA
GAAATAGCTGTCGCTGTTACATATATTGTTAGTCCATTGTACTCTAATCT
ACCAAGACGCAGAGTTGATGATTTTGCTATCGAATTAAATAGTCTTTTGA
AACTTAAAATTGCTCCATTTTGGTTTCCAAACCAACCGTTTCGAGGCATT
CATCAGCGCTGTTTTCGAGTCAATGGAACATATGCAGATCCAATTTTATA
TATCGCTGCTTCAAAGTCGGGAATCAATCAAGAAGAACTGTTCAACTTTC
TTCCGAAAGATGAGCTGAAAATCTGGATCGATCCTGGTGAAGTAACATAT
CAAGTCGGTGATCAAAACTCAGAAATCAAATGCCTATTCCGCTGCAATCC
AGTCGTCAATGAACATAATTTCCAATCTAGCATTTATAATGAAACAAATA
ACCAAAGTAATTTCTATCTTCCAAAAAGTCTCGTACCAAGTTTCACGGTG
TCGTCCTTTGCGAAAACTAAATTTGGTTCAACAAAATTGAAACCGAATTC
TTCGGTATTTGCTGAACCTGTAAGACCGAATTCTTTGAAATTGTCTACTA
CTATTCAAGACTCACCAAATAATAGTCTGGTTTTTACCCCAGATTCCTGT
AATTCCGGTGTCCTGTCTCCGAATTGTCAAAATGTTTTAAGTTCACCAGA
ATCAACAACTCTGAACATTCCATGTTACCTTCCATGGAATGTTGATCCAA
ACAATAATTTATTAACGATAAACATTCCTCATTATAGCACTACAAATGGC
CGTGAATCATCTGGAGCTGGTTCTTTGAATTCTGAACTCAGTTCTCCAGT
TCATGGCTATTAACTGTATTTACCAGTATAGAAGAAAATAATTTTTATCA
ATAGGGTTATGTCTATTTTTTTAAAATAGATATAATTATTTTTTTCATTT
AAACTATTTTGTACGACGTAATTATCTATCAATTCATAAACTTGTCTCGA
TCTATTCTAAAGATATTGCTTAAAAATTGATATCAGTAATCTTATTTTTA
TTATTTTACCAGAAAATCTGTTGACAGAAAAAAATTAATATGTGAATAAC
CATATGTTAAACATATTTGATGTAAGTGACCATTTTTTAGGTGATTTTTA
TACTTTCTAATGTCGATAATTCTATCTATTATTGCTGATGCTAATGCTGC
TGATATTAATGTTTTCATTTTAAGAAATGTAATAAATAGATTTGTCATTA
AATACTAAAAAAAATAAATCGACGATTCGTATTAATAAAATTTAATTATC
AATTTTGAATTCTTATTTACAATTTAAAAACATTTGTACTAACTCGTCG
back to top

protein sequence of SMED30034477-orf-1

>SMED30034477-orf-1 ID=SMED30034477-orf-1|Name=SMED30034477-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=288bp
MSVGAKGALSKDLTMISEIAVAVTYIVSPLYSNLPRRRVDDFAIELNSLL
KLKIAPFWFPNQPFRGIHQRCFRVNGTYADPILYIAASKSGINQEELFNF
LPKDELKIWIDPGEVTYQVGDQNSEIKCLFRCNPVVNEHNFQSSIYNETN
NQSNFYLPKSLVPSFTVSSFAKTKFGSTKLKPNSSVFAEPVRPNSLKLST
TIQDSPNNSLVFTPDSCNSGVLSPNCQNVLSSPESTTLNIPCYLPWNVDP
NNNLLTINIPHYSTTNGRESSGAGSLNSELSSPVHGY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000208testis
PLANA:0002111X2 cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036054BTG-like_sf
IPR015676Tob1/2
IPR002087Anti_prolifrtn
Vocabulary: molecular function
TermDefinition
GO:0003714transcription corepressor activity
GO:0042809vitamin D receptor binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0008285negative regulation of cell proliferation
GO:0010468regulation of gene expression
GO:0023052signaling
GO:0045671negative regulation of osteoclast differentiation
GO:0045778positive regulation of ossification
GO:1903507negative regulation of nucleic acid-templated transcription
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002087Anti-proliferative proteinSMARTSM00099btg1_nrcoord: 15..122
e-value: 4.5E-26
score: 102.6
IPR002087Anti-proliferative proteinPFAMPF07742BTGcoord: 15..124
e-value: 3.4E-27
score: 94.6
IPR036054BTG-like domain superfamilyGENE3DG3DSA:1.20.120.1120coord: 9..136
e-value: 7.3E-31
score: 108.2
IPR036054BTG-like domain superfamilySUPERFAMILYSSF160696BTG domain-likecoord: 15..126
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 266..287
IPR015676Tob1/2PANTHERPTHR17537TRANSDUCER OF ERBB2 TOBcoord: 15..160