Protein YIF1B

Overview
NameProtein YIF1B
Smed IDSMED30034476
Length (bp)1189
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein YIF1B (SMED30034476) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein YIF1B (SMED30034476) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein YIF1B (SMED30034476) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein YIF1B (SMED30034476) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034476

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30034476SMESG000057246.1 dd_Smed_v4_3951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034476SMESG000057246.1 dd_Smed_v4_3951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein YIF1B vs. Ensembl Human
Match: YIF1B (Yip1 interacting factor homolog B, membrane trafficking protein [Source:HGNC Symbol;Acc:HGNC:30511])

HSP 1 Score: 214.542 bits (545), Expect = 1.173e-66
Identity = 114/251 (45.42%), Postives = 164/251 (65.34%), Query Frame = 3
Query:  273 TNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQESLTVSEG-------NKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            T +  F  D ++N A+ YGS++  QG +L+ +NID+++P + L+YYFAVD +YV +KL LLFFP+ H +W VQY  D  PV PR+D+NAPDLYIP M  +TYVL  GL  G  D+FSPD LG  AS+A+ WL  E+L ++  LY+V   T L  +D++AF GYK+VGM   +LM +L   +G+Y  L +  VA+  F+IRTL+++IL   +   +EG       N+ R+YL +  A  QP +M+ LT  +V
Sbjct:   36 TPHAAFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITKLKYYFAVDTMYVGRKLGLLFFPYLHQDWEVQYQQDT-PVAPRFDVNAPDLYIPAMAFITYVLVAGLALGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVAFLGYKYVGMIGGVLMGLLFGKIGYYLVLGWCCVAIFVFMIRTLRLKILADAA---AEGVPVRGARNQLRMYLTMAVAAAQPMLMYWLTFHLV 282          
BLAST of Protein YIF1B vs. Ensembl Human
Match: YIF1B (Yip1 interacting factor homolog B, membrane trafficking protein [Source:HGNC Symbol;Acc:HGNC:30511])

HSP 1 Score: 214.542 bits (545), Expect = 1.173e-66
Identity = 114/251 (45.42%), Postives = 164/251 (65.34%), Query Frame = 3
Query:  273 TNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQESLTVSEG-------NKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            T +  F  D ++N A+ YGS++  QG +L+ +NID+++P + L+YYFAVD +YV +KL LLFFP+ H +W VQY  D  PV PR+D+NAPDLYIP M  +TYVL  GL  G  D+FSPD LG  AS+A+ WL  E+L ++  LY+V   T L  +D++AF GYK+VGM   +LM +L   +G+Y  L +  VA+  F+IRTL+++IL   +   +EG       N+ R+YL +  A  QP +M+ LT  +V
Sbjct:   36 TPHAAFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITKLKYYFAVDTMYVGRKLGLLFFPYLHQDWEVQYQQDT-PVAPRFDVNAPDLYIPAMAFITYVLVAGLALGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVAFLGYKYVGMIGGVLMGLLFGKIGYYLVLGWCCVAIFVFMIRTLRLKILADAA---AEGVPVRGARNQLRMYLTMAVAAAQPMLMYWLTFHLV 282          
BLAST of Protein YIF1B vs. Ensembl Human
Match: YIF1B (Yip1 interacting factor homolog B, membrane trafficking protein [Source:HGNC Symbol;Acc:HGNC:30511])

HSP 1 Score: 214.542 bits (545), Expect = 1.173e-66
Identity = 114/251 (45.42%), Postives = 164/251 (65.34%), Query Frame = 3
Query:  273 TNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQESLTVSEG-------NKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            T +  F  D ++N A+ YGS++  QG +L+ +NID+++P + L+YYFAVD +YV +KL LLFFP+ H +W VQY  D  PV PR+D+NAPDLYIP M  +TYVL  GL  G  D+FSPD LG  AS+A+ WL  E+L ++  LY+V   T L  +D++AF GYK+VGM   +LM +L   +G+Y  L +  VA+  F+IRTL+++IL   +   +EG       N+ R+YL +  A  QP +M+ LT  +V
Sbjct:   36 TPHAAFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITKLKYYFAVDTMYVGRKLGLLFFPYLHQDWEVQYQQDT-PVAPRFDVNAPDLYIPAMAFITYVLVAGLALGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVAFLGYKYVGMIGGVLMGLLFGKIGYYLVLGWCCVAIFVFMIRTLRLKILADAA---AEGVPVRGARNQLRMYLTMAVAAAQPMLMYWLTFHLV 282          
BLAST of Protein YIF1B vs. Ensembl Human
Match: YIF1B (Yip1 interacting factor homolog B, membrane trafficking protein [Source:HGNC Symbol;Acc:HGNC:30511])

HSP 1 Score: 214.157 bits (544), Expect = 2.620e-66
Identity = 114/251 (45.42%), Postives = 164/251 (65.34%), Query Frame = 3
Query:  273 TNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQESLTVSEG-------NKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            T +  F  D ++N A+ YGS++  QG +L+ +NID+++P + L+YYFAVD +YV +KL LLFFP+ H +W VQY  D  PV PR+D+NAPDLYIP M  +TYVL  GL  G  D+FSPD LG  AS+A+ WL  E+L ++  LY+V   T L  +D++AF GYK+VGM   +LM +L   +G+Y  L +  VA+  F+IRTL+++IL   +   +EG       N+ R+YL +  A  QP +M+ LT  +V
Sbjct:   52 TPHAAFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITKLKYYFAVDTMYVGRKLGLLFFPYLHQDWEVQYQQDT-PVAPRFDVNAPDLYIPAMAFITYVLVAGLALGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVAFLGYKYVGMIGGVLMGLLFGKIGYYLVLGWCCVAIFVFMIRTLRLKILADAA---AEGVPVRGARNQLRMYLTMAVAAAQPMLMYWLTFHLV 298          
BLAST of Protein YIF1B vs. Ensembl Human
Match: YIF1B (Yip1 interacting factor homolog B, membrane trafficking protein [Source:HGNC Symbol;Acc:HGNC:30511])

HSP 1 Score: 213.772 bits (543), Expect = 5.396e-66
Identity = 114/251 (45.42%), Postives = 164/251 (65.34%), Query Frame = 3
Query:  273 TNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQESLTVSEG-------NKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            T +  F  D ++N A+ YGS++  QG +L+ +NID+++P + L+YYFAVD +YV +KL LLFFP+ H +W VQY  D  PV PR+D+NAPDLYIP M  +TYVL  GL  G  D+FSPD LG  AS+A+ WL  E+L ++  LY+V   T L  +D++AF GYK+VGM   +LM +L   +G+Y  L +  VA+  F+IRTL+++IL   +   +EG       N+ R+YL +  A  QP +M+ LT  +V
Sbjct:   67 TPHAAFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITKLKYYFAVDTMYVGRKLGLLFFPYLHQDWEVQYQQDT-PVAPRFDVNAPDLYIPAMAFITYVLVAGLALGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVAFLGYKYVGMIGGVLMGLLFGKIGYYLVLGWCCVAIFVFMIRTLRLKILADAA---AEGVPVRGARNQLRMYLTMAVAAAQPMLMYWLTFHLV 313          
BLAST of Protein YIF1B vs. Ensembl Celegans
Match: yif-1 (YIP1-Interacting Factor homolog [Source:UniProtKB/TrEMBL;Acc:Q20913])

HSP 1 Score: 178.333 bits (451), Expect = 2.317e-52
Identity = 104/254 (40.94%), Postives = 149/254 (58.66%), Query Frame = 3
Query:  246 NFEPQQPIETNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQE-SLTVSEGNKRRVYLLLFTALIQPFVMWLLTKSIV 1004
             F+PQQ +        +D M NAA  +G    EQ     +  + KY+ T  L+YYFAVDN YV KKL +LFFPF H +W++++     P P R D+NAPDLYIPLM  LTY+L  G + G   +FSP+ LG + SNA+ W+I E +V+    YI+N   SL     +A+S YKF  M V LL+ ++ +   +Y +LAY S+AL  FL+R++   +     S    EG KR++ L+ F  + QP +MW LT + +
Sbjct:   88 GFQPQQLM--------SDPMLNAAKQFGGQFAEQ----QKEKLTKYLGTFNLKYYFAVDNAYVGKKLGILFFPFFHKDWSLKFAGSADPAPAREDVNAPDLYIPLMSFLTYILVSGFVLGTQGRFSPEILGILTSNALIWVILENIVIFISKYILNISQSLSVWHSLAYSTYKFAHMIVCLLLFMVGDKTFYYGALAYSSLALVIFLLRSVSHFMFDSSGSYGSEEGRKRKLILVAFVVITQPLIMWWLTSTQI 329          
BLAST of Protein YIF1B vs. Ensembl Celegans
Match: yif-1 (YIP1-Interacting Factor homolog [Source:UniProtKB/TrEMBL;Acc:Q20913])

HSP 1 Score: 177.948 bits (450), Expect = 6.692e-52
Identity = 104/250 (41.60%), Postives = 147/250 (58.80%), Query Frame = 3
Query:  246 NFEPQQPIETNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQE-SLTVSEGNKRRVYLLLFTALIQPFVMWLLT 992
             F+PQQ +        +D M NAA  +G    EQ     +  + KY+ T  L+YYFAVDN YV KKL +LFFPF H +W++++     P P R D+NAPDLYIPLM  LTY+L  G + G   +FSP+ LG + SNA+ W+I E +V+    YI+N   SL     +A+S YKF  M V LL+ ++ +   +Y +LAY S+AL  FL+R++   +     S    EG KR++ L+ F  + QP +MW LT
Sbjct:   88 GFQPQQLM--------SDPMLNAAKQFGGQFAEQ----QKEKLTKYLGTFNLKYYFAVDNAYVGKKLGILFFPFFHKDWSLKFAGSADPAPAREDVNAPDLYIPLMSFLTYILVSGFVLGTQGRFSPEILGILTSNALIWVILENIVIFISKYILNISQSLSVWHSLAYSTYKFAHMIVCLLLFMVGDKTFYYGALAYSSLALVIFLLRSVSHFMFDSSGSYGSEEGRKRKLILVAFVVITQPLIMWWLT 325          
BLAST of Protein YIF1B vs. Ensembl Fly
Match: Yif1 (gene:FBgn0039450 transcript:FBtr0085038)

HSP 1 Score: 202.216 bits (513), Expect = 8.104e-61
Identity = 107/272 (39.34%), Postives = 170/272 (62.50%), Query Frame = 3
Query:  261 QPIE--TNNFP----FSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQIL-------------------PQESLTVSEGNKRRVYLLLFTALIQPFVMWLLTKSI 1001
            QP+   T  +P    F    + + A+ YG  + +QG  +++   +K+VP + L+YYFAVDN YV +KL LLFFP+ H +W+++Y+ +  PV PRYD+NAPDLY+P MG +TYV+  GL+ G+  +FSP+QLG  AS+A+ + IFE+++    LY++N +TSL+ +D++AF+GYK+V + V L++S L    G+Y +LAY S + G+F++RTL+ ++L                   PQ+    S G KR++Y L      Q    +LL+K +
Sbjct:  110 QPVAPPTGQYPQFAMFQQPIVQDMAMQYGQKLADQGKQIMENQFEKWVPVAKLKYYFAVDNAYVGRKLRLLFFPYMHKDWSLRYDQE-HPVQPRYDVNAPDLYLPTMGYITYVIVAGLLLGMQKRFSPEQLGIQASSAMAYSIFELVIYSLALYVMNVKTSLKTLDLLAFTGYKYVNIVVCLMVSTLFFKSGYYIALAYTSFSFGFFMLRTLRTKLLQDNSPAAPSGAINYDPYGNPQQ-FDYSGGKKRKLYFLFMIVAGQALFAFLLSKHL 379          
BLAST of Protein YIF1B vs. Ensembl Fly
Match: Yif1 (gene:FBgn0039450 transcript:FBtr0085037)

HSP 1 Score: 201.83 bits (512), Expect = 9.669e-61
Identity = 107/272 (39.34%), Postives = 170/272 (62.50%), Query Frame = 3
Query:  261 QPIE--TNNFP----FSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQIL-------------------PQESLTVSEGNKRRVYLLLFTALIQPFVMWLLTKSI 1001
            QP+   T  +P    F    + + A+ YG  + +QG  +++   +K+VP + L+YYFAVDN YV +KL LLFFP+ H +W+++Y+ +  PV PRYD+NAPDLY+P MG +TYV+  GL+ G+  +FSP+QLG  AS+A+ + IFE+++    LY++N +TSL+ +D++AF+GYK+V + V L++S L    G+Y +LAY S + G+F++RTL+ ++L                   PQ+    S G KR++Y L      Q    +LL+K +
Sbjct:  114 QPVAPPTGQYPQFAMFQQPIVQDMAMQYGQKLADQGKQIMENQFEKWVPVAKLKYYFAVDNAYVGRKLRLLFFPYMHKDWSLRYDQE-HPVQPRYDVNAPDLYLPTMGYITYVIVAGLLLGMQKRFSPEQLGIQASSAMAYSIFELVIYSLALYVMNVKTSLKTLDLLAFTGYKYVNIVVCLMVSTLFFKSGYYIALAYTSFSFGFFMLRTLRTKLLQDNSPAAPSGAINYDPYGNPQQ-FDYSGGKKRKLYFLFMIVAGQALFAFLLSKHL 383          
BLAST of Protein YIF1B vs. Ensembl Fly
Match: Yif1 (gene:FBgn0039450 transcript:FBtr0085039)

HSP 1 Score: 201.83 bits (512), Expect = 1.170e-60
Identity = 107/272 (39.34%), Postives = 170/272 (62.50%), Query Frame = 3
Query:  261 QPIE--TNNFP----FSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQIL-------------------PQESLTVSEGNKRRVYLLLFTALIQPFVMWLLTKSI 1001
            QP+   T  +P    F    + + A+ YG  + +QG  +++   +K+VP + L+YYFAVDN YV +KL LLFFP+ H +W+++Y+ +  PV PRYD+NAPDLY+P MG +TYV+  GL+ G+  +FSP+QLG  AS+A+ + IFE+++    LY++N +TSL+ +D++AF+GYK+V + V L++S L    G+Y +LAY S + G+F++RTL+ ++L                   PQ+    S G KR++Y L      Q    +LL+K +
Sbjct:  119 QPVAPPTGQYPQFAMFQQPIVQDMAMQYGQKLADQGKQIMENQFEKWVPVAKLKYYFAVDNAYVGRKLRLLFFPYMHKDWSLRYDQE-HPVQPRYDVNAPDLYLPTMGYITYVIVAGLLLGMQKRFSPEQLGIQASSAMAYSIFELVIYSLALYVMNVKTSLKTLDLLAFTGYKYVNIVVCLMVSTLFFKSGYYIALAYTSFSFGFFMLRTLRTKLLQDNSPAAPSGAINYDPYGNPQQ-FDYSGGKKRKLYFLFMIVAGQALFAFLLSKHL 388          
BLAST of Protein YIF1B vs. Ensembl Zebrafish
Match: yif1b (Yip1 interacting factor homolog B (S. cerevisiae) [Source:NCBI gene;Acc:492462])

HSP 1 Score: 212.231 bits (539), Expect = 1.101e-65
Identity = 110/241 (45.64%), Postives = 161/241 (66.80%), Query Frame = 3
Query:  294 NDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQES----LTVSEGNKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            +D M+N A+ YGS++   G +++ +N+D+++P S L+YYFAVD +YV KKL LL FP+ H NW V Y  D  PV PR+DINAPDLYIP+MG +TYVL  GL  G  ++FSP+ LG  AS+A+ WLI E+L ++  LY+V   T L  +D++AFSGYK+VGM V ++  +L   +G+Y +L +F  ++  F IRTL+++IL + +    L     N+ R+YL +  A  QP  M+ LT  +V
Sbjct:   64 SDPMSNLAMAYGSSLASHGKEMMDKNLDRFIPISKLKYYFAVDTVYVGKKLGLLVFPYMHDNWEVNYQQDT-PVAPRFDINAPDLYIPVMGFITYVLVAGLALGTQNRFSPEILGIQASSALVWLIIEVLAVLLSLYLVTVNTDLTTIDLVAFSGYKYVGMIVGVVAGLLFGRMGYYLALLWFCASIFVFTIRTLRLKILSEAAAEGRLVRGTKNQLRMYLTMAIAAAQPVFMYWLTFHLV 303          
BLAST of Protein YIF1B vs. Ensembl Zebrafish
Match: yif1b (Yip1 interacting factor homolog B (S. cerevisiae) [Source:NCBI gene;Acc:492462])

HSP 1 Score: 194.897 bits (494), Expect = 1.253e-59
Identity = 96/196 (48.98%), Postives = 138/196 (70.41%), Query Frame = 3
Query:  294 NDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLK 881
            +D M+N A+ YGS++   G +++ +N+D+++P S L+YYFAVD +YV KKL LL FP+ H NW V Y  D  PV PR+DINAPDLYIP+MG +TYVL  GL  G  ++FSP+ LG  AS+A+ WLI E+L ++  LY+V   T L  +D++AFSGYK+VGM V ++  +L   +G+Y +L +F  ++  F IRTL+
Sbjct:   61 SDPMSNLAMAYGSSLASHGKEMMDKNLDRFIPISKLKYYFAVDTVYVGKKLGLLVFPYMHDNWEVNYQQDT-PVAPRFDINAPDLYIPVMGFITYVLVAGLALGTQNRFSPEILGIQASSALVWLIIEVLAVLLSLYLVTVNTDLTTIDLVAFSGYKYVGMIVGVVAGLLFGRMGYYLALLWFCASIFVFTIRTLR 255          
BLAST of Protein YIF1B vs. Ensembl Zebrafish
Match: yif1a (Yip1 interacting factor homolog A (S. cerevisiae) [Source:NCBI gene;Acc:334982])

HSP 1 Score: 192.971 bits (489), Expect = 3.844e-58
Identity = 116/288 (40.28%), Postives = 175/288 (60.76%), Query Frame = 3
Query:  156 PSQTNFGYNSEGYIVTDMGYTSFQQPVFQPNFEPQQPIETNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQESLT-----VSEGNKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            P   N  Y S GY + +M                Q+P   N F    D MANAA+ YGS +  QG D++ + I++++  + L+Y+FAVD  YV KKLLLL FP+ H +W V+Y+ D  P+ PR+D+NAPDLYIP M  +TY+L  G+  GI  +FSP+ LG  AS A+ W+I E+LV++  LY++   T L   D++A+SGYK+VGM + +   +L  S G+Y +LA+ S AL +F++R+LK++IL   S        S   + R+Y+ + +A  QPF+++ LT  +V
Sbjct:   35 PPMNNQNYYSSGYNMAEMPAGG------------QEPGVGNIFA---DPMANAAMMYGSTLANQGKDIVNKEINRFMSVNKLKYFFAVDTKYVMKKLLLLMFPYTHQDWEVRYHRD-TPLTPRHDVNAPDLYIPTMAFITYILLAGMALGIQKRFSPEVLGLCASTALVWMIIEVLVMLLSLYLLTVHTDLSTFDLVAYSGYKYVGMILTVFCGLLFGSDGYYVALAWSSCALMFFIVRSLKMKILSSISADSMGAGASAKPRFRLYITVASAAFQPFIIYWLTAHLV 306          
BLAST of Protein YIF1B vs. Ensembl Zebrafish
Match: yif1a (Yip1 interacting factor homolog A (S. cerevisiae) [Source:NCBI gene;Acc:334982])

HSP 1 Score: 192.971 bits (489), Expect = 3.844e-58
Identity = 116/288 (40.28%), Postives = 175/288 (60.76%), Query Frame = 3
Query:  156 PSQTNFGYNSEGYIVTDMGYTSFQQPVFQPNFEPQQPIETNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQESLT-----VSEGNKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            P   N  Y S GY + +M                Q+P   N F    D MANAA+ YGS +  QG D++ + I++++  + L+Y+FAVD  YV KKLLLL FP+ H +W V+Y+ D  P+ PR+D+NAPDLYIP M  +TY+L  G+  GI  +FSP+ LG  AS A+ W+I E+LV++  LY++   T L   D++A+SGYK+VGM + +   +L  S G+Y +LA+ S AL +F++R+LK++IL   S        S   + R+Y+ + +A  QPF+++ LT  +V
Sbjct:   35 PPMNNQNYYSSGYNMAEMPAGG------------QEPGVGNIFA---DPMANAAMMYGSTLANQGKDIVNKEINRFMSVNKLKYFFAVDTKYVMKKLLLLMFPYTHQDWEVRYHRD-TPLTPRHDVNAPDLYIPTMAFITYILLAGMALGIQKRFSPEVLGLCASTALVWMIIEVLVMLLSLYLLTVHTDLSTFDLVAYSGYKYVGMILTVFCGLLFGSDGYYVALAWSSCALMFFIVRSLKMKILSSISADSMGAGASAKPRFRLYITVASAAFQPFIIYWLTAHLV 306          
BLAST of Protein YIF1B vs. Ensembl Zebrafish
Match: yif1a (Yip1 interacting factor homolog A (S. cerevisiae) [Source:NCBI gene;Acc:334982])

HSP 1 Score: 128.642 bits (322), Expect = 9.567e-35
Identity = 75/175 (42.86%), Postives = 105/175 (60.00%), Query Frame = 3
Query:  156 PSQTNFGYNSEGYIVTDMGYTSFQQPVFQPNFEPQQPIETNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEI 680
            P   N  Y S GY + +M                Q+P   N F    D MANAA+ YGS +  QG D++ + I++++  + L+Y+FAVD  YV KKLLLL FP+ H +W V+Y+ D  P+ PR+D+NAPDLYIP M  +TY+L  G+  GI  +FSP+ LG  AS A+ W+I E+
Sbjct:   35 PPMNNQNYYSSGYNMAEMPAGG------------QEPGVGNIF---ADPMANAAMMYGSTLANQGKDIVNKEINRFMSVNKLKYFFAVDTKYVMKKLLLLMFPYTHQDWEVRYHRDT-PLTPRHDVNAPDLYIPTMAFITYILLAGMALGIQKRFSPEVLGLCASTALVWMIIEV 193          
BLAST of Protein YIF1B vs. Ensembl Xenopus
Match: mthfd1l (methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1 like [Source:Xenbase;Acc:XB-GENE-1011645])

HSP 1 Score: 211.075 bits (536), Expect = 5.641e-65
Identity = 105/243 (43.21%), Postives = 162/243 (66.67%), Query Frame = 3
Query:  288 FSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQES----LTVSEGNKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            F ++ M+N A+ YGS++  QG +++ +NID+ +P S ++YYFAVD +YV KK+ LL FP+ H +W V+Y  D  PV PR+DINAPDLYIP+M  +TY+L  GL  G   +FSP+ LG  AS+A+ WLI E+L ++  LY+V   T L  +D++AFSGYK+VGM   ++  +L    G+Y  L++  +++ +F+IRTL+++IL + +    L     N+ R+YL +  A +QP  M+ LT  +V
Sbjct:   65 FLSEPMSNFAMAYGSSLASQGKEMMDKNIDRIIPVSKIKYYFAVDTVYVGKKIGLLMFPYMHQDWEVRYQQDT-PVAPRFDINAPDLYIPVMAFITYILVAGLALGTQSRFSPEILGMQASSALAWLIVEVLAILLSLYLVTVNTDLTTVDLVAFSGYKYVGMISGVISGLLFGKTGYYVVLSWCGISVVFFMIRTLRLKILSEAAAEGVLVRGARNQLRMYLTMAIAAVQPIFMYWLTYHLV 306          
BLAST of Protein YIF1B vs. Ensembl Mouse
Match: Yif1b (Yip1 interacting factor homolog B (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1924504])

HSP 1 Score: 214.157 bits (544), Expect = 2.179e-66
Identity = 114/254 (44.88%), Postives = 165/254 (64.96%), Query Frame = 3
Query:  264 PIETNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQESLTVSEG-------NKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            P  +++  F    M+N A+ YGS++  QG +L+ +NID+++P S L+YYFAVD +YV KKL LL FP+ H +W VQY  D  PV PR+DINAPDLYIP M  +TY+L  GL  G  D+FSPD LG  AS+A+ WL  E++ ++  LY+V   T L  +D++AF GYK+VGM   +L  +L   +G+Y  LA+  V++  F+IRTL+++IL Q +   +EG       N+ R+YL +  A  QP +M+ LT  +V
Sbjct:   58 PPSSSDAAFLAAPMSNMAMVYGSSLAAQGKELVDKNIDRFIPVSKLKYYFAVDTVYVGKKLGLLVFPYLHQDWEVQYQQDT-PVAPRFDINAPDLYIPAMAFITYILVAGLALGTQDRFSPDLLGLQASSALAWLTLEVVAILLSLYLVTVNTDLTTIDLVAFLGYKYVGMIGGVLTGLLFGKIGYYLVLAWCCVSIFVFMIRTLRLKILAQAA---AEGVPVRGARNQLRMYLTMAVAAAQPVLMYWLTFHLV 307          
BLAST of Protein YIF1B vs. Ensembl Mouse
Match: Yif1b (Yip1 interacting factor homolog B (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1924504])

HSP 1 Score: 213.772 bits (543), Expect = 3.285e-66
Identity = 114/254 (44.88%), Postives = 165/254 (64.96%), Query Frame = 3
Query:  264 PIETNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQESLTVSEG-------NKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            P  +++  F    M+N A+ YGS++  QG +L+ +NID+++P S L+YYFAVD +YV KKL LL FP+ H +W VQY  D  PV PR+DINAPDLYIP M  +TY+L  GL  G  D+FSPD LG  AS+A+ WL  E++ ++  LY+V   T L  +D++AF GYK+VGM   +L  +L   +G+Y  LA+  V++  F+IRTL+++IL Q +   +EG       N+ R+YL +  A  QP +M+ LT  +V
Sbjct:   61 PPSSSDAAFLAAPMSNMAMVYGSSLAAQGKELVDKNIDRFIPVSKLKYYFAVDTVYVGKKLGLLVFPYLHQDWEVQYQQDT-PVAPRFDINAPDLYIPAMAFITYILVAGLALGTQDRFSPDLLGLQASSALAWLTLEVVAILLSLYLVTVNTDLTTIDLVAFLGYKYVGMIGGVLTGLLFGKIGYYLVLAWCCVSIFVFMIRTLRLKILAQAA---AEGVPVRGARNQLRMYLTMAVAAAQPVLMYWLTFHLV 310          
BLAST of Protein YIF1B vs. Ensembl Mouse
Match: Yif1b (Yip1 interacting factor homolog B (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1924504])

HSP 1 Score: 213.386 bits (542), Expect = 5.797e-66
Identity = 114/254 (44.88%), Postives = 165/254 (64.96%), Query Frame = 3
Query:  264 PIETNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQESLTVSEG-------NKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            P  +++  F    M+N A+ YGS++  QG +L+ +NID+++P S L+YYFAVD +YV KKL LL FP+ H +W VQY  D  PV PR+DINAPDLYIP M  +TY+L  GL  G  D+FSPD LG  AS+A+ WL  E++ ++  LY+V   T L  +D++AF GYK+VGM   +L  +L   +G+Y  LA+  V++  F+IRTL+++IL Q +   +EG       N+ R+YL +  A  QP +M+ LT  +V
Sbjct:   65 PPSSSDAAFLAAPMSNMAMVYGSSLAAQGKELVDKNIDRFIPVSKLKYYFAVDTVYVGKKLGLLVFPYLHQDWEVQYQQDT-PVAPRFDINAPDLYIPAMAFITYILVAGLALGTQDRFSPDLLGLQASSALAWLTLEVVAILLSLYLVTVNTDLTTIDLVAFLGYKYVGMIGGVLTGLLFGKIGYYLVLAWCCVSIFVFMIRTLRLKILAQAA---AEGVPVRGARNQLRMYLTMAVAAAQPVLMYWLTFHLV 314          
BLAST of Protein YIF1B vs. Ensembl Mouse
Match: Yif1b (Yip1 interacting factor homolog B (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1924504])

HSP 1 Score: 186.422 bits (472), Expect = 4.374e-56
Identity = 94/201 (46.77%), Postives = 134/201 (66.67%), Query Frame = 3
Query:  264 PIETNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFL 866
            P  +++  F    M+N A+ YGS++  QG +L+ +NID+++P S L+YYFAVD +YV KKL LL FP+ H +W VQY  D  PV PR+DINAPDLYIP M  +TY+L  GL  G  D+FSPD LG  AS+A+ WL  E++ ++  LY+V   T L  +D++AF GYK+VGM   +L  +L   +G+Y  LA+  V++  F+
Sbjct:   73 PPSSSDAAFLAAPMSNMAMVYGSSLAAQGKELVDKNIDRFIPVSKLKYYFAVDTVYVGKKLGLLVFPYLHQDWEVQYQQDT-PVAPRFDINAPDLYIPAMAFITYILVAGLALGTQDRFSPDLLGLQASSALAWLTLEVVAILLSLYLVTVNTDLTTIDLVAFLGYKYVGMIGGVLTGLLFGKIGYYLVLAWCCVSIFVFM 272          
BLAST of Protein YIF1B vs. Ensembl Mouse
Match: Yif1a (Yip1 interacting factor homolog A (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1915340])

HSP 1 Score: 186.808 bits (473), Expect = 4.442e-56
Identity = 103/238 (43.28%), Postives = 155/238 (65.13%), Query Frame = 3
Query:  294 NDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQESLTVSEGNKR-RVYLLLFTALIQPFVMWLLTKSIV 1004
             D +AN A+ YG+++  QG D++ + + ++V  + L+Y+FAVD  YVAKKL LL FP+ H NW +QY+HD  P+PPR D+NAPDLYIP M  +TYVL  G+  GI  +FSP+ LG  AS A+ W+  E+L L+  LY+   R+ L    ++A+SGYK+VGM + +L  +L  S G+Y +LA+ S AL YF++R+L+      +S+      +R ++YL L  A  QP +++ LT  +V
Sbjct:   47 GDPVANMAMAYGTSIASQGKDIVHKELHRFVSVNKLKYFFAVDTAYVAKKLGLLVFPYTHQNWKMQYSHDV-PLPPRKDLNAPDLYIPTMAFITYVLLAGMALGIQQRFSPEVLGLCASTALVWVFMEVLALLLGLYLATVRSELSTFHLLAYSGYKYVGMILSVLTGLLFGSDGYYVALAWTSSALMYFIVRSLRTAASGPDSMGGPAPRQRLQLYLTLGAAAFQPLIIYWLTFHLV 283          
BLAST of Protein YIF1B vs. UniProt/SwissProt
Match: sp|Q9CX30|YIF1B_MOUSE (Protein YIF1B OS=Mus musculus OX=10090 GN=Yif1b PE=1 SV=2)

HSP 1 Score: 213.772 bits (543), Expect = 2.298e-65
Identity = 114/254 (44.88%), Postives = 165/254 (64.96%), Query Frame = 3
Query:  264 PIETNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQESLTVSEG-------NKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            P  +++  F    M+N A+ YGS++  QG +L+ +NID+++P S L+YYFAVD +YV KKL LL FP+ H +W VQY  D  PV PR+DINAPDLYIP M  +TY+L  GL  G  D+FSPD LG  AS+A+ WL  E++ ++  LY+V   T L  +D++AF GYK+VGM   +L  +L   +G+Y  LA+  V++  F+IRTL+++IL Q +   +EG       N+ R+YL +  A  QP +M+ LT  +V
Sbjct:   61 PPSSSDAAFLAAPMSNMAMVYGSSLAAQGKELVDKNIDRFIPVSKLKYYFAVDTVYVGKKLGLLVFPYLHQDWEVQYQQDT-PVAPRFDINAPDLYIPAMAFITYILVAGLALGTQDRFSPDLLGLQASSALAWLTLEVVAILLSLYLVTVNTDLTTIDLVAFLGYKYVGMIGGVLTGLLFGKIGYYLVLAWCCVSIFVFMIRTLRLKILAQAA---AEGVPVRGARNQLRMYLTMAVAAAQPVLMYWLTFHLV 310          
BLAST of Protein YIF1B vs. UniProt/SwissProt
Match: sp|Q5BJH7|YIF1B_HUMAN (Protein YIF1B OS=Homo sapiens OX=9606 GN=YIF1B PE=1 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 2.591e-65
Identity = 114/251 (45.42%), Postives = 164/251 (65.34%), Query Frame = 3
Query:  273 TNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQESLTVSEG-------NKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            T +  F  D ++N A+ YGS++  QG +L+ +NID+++P + L+YYFAVD +YV +KL LLFFP+ H +W VQY  D  PV PR+D+NAPDLYIP M  +TYVL  GL  G  D+FSPD LG  AS+A+ WL  E+L ++  LY+V   T L  +D++AF GYK+VGM   +LM +L   +G+Y  L +  VA+  F+IRTL+++IL   +   +EG       N+ R+YL +  A  QP +M+ LT  +V
Sbjct:   67 TPHAAFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITKLKYYFAVDTMYVGRKLGLLFFPYLHQDWEVQYQQDT-PVAPRFDVNAPDLYIPAMAFITYVLVAGLALGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVAFLGYKYVGMIGGVLMGLLFGKIGYYLVLGWCCVAIFVFMIRTLRLKILADAA---AEGVPVRGARNQLRMYLTMAVAAAQPMLMYWLTFHLV 313          
BLAST of Protein YIF1B vs. UniProt/SwissProt
Match: sp|Q5U3G6|YIF1B_DANRE (Protein YIF1B OS=Danio rerio OX=7955 GN=yif1b PE=2 SV=2)

HSP 1 Score: 211.846 bits (538), Expect = 1.053e-64
Identity = 110/241 (45.64%), Postives = 160/241 (66.39%), Query Frame = 3
Query:  294 NDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQES----LTVSEGNKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            +D M+N A+ YGS++   G +++ +N+D+++P S L+YYFAVD +YV KKL LL FP+ H NW V Y  D  PV PR+DINAPDLYIP+MG +TYVL  GL  G  ++FSP+ LG  AS+A+ WLI E+L ++  LY+V   T L  +D++AFSGYK+VGM V ++  +L    G+Y +L +F  ++  F IRTL+++IL + +    L     N+ R+YL +  A  QP  M+ LT  +V
Sbjct:   64 SDPMSNLAMAYGSSLASHGKEMMDKNLDRFIPISKLKYYFAVDTVYVGKKLGLLVFPYMHDNWEVNYQQDT-PVAPRFDINAPDLYIPVMGFITYVLVAGLALGTQNRFSPEILGIQASSALVWLIIEVLAVLLSLYLVTVNTDLTTIDLVAFSGYKYVGMIVGVVAGLLFGRTGYYLALLWFCASIFVFTIRTLRLKILSEAAAEGRLVRGTKNQLRMYLTMAIAAAQPVFMYWLTFHLV 303          
BLAST of Protein YIF1B vs. UniProt/SwissProt
Match: sp|Q4FZQ0|YF1BB_XENLA (Protein YIF1B-B OS=Xenopus laevis OX=8355 GN=yif1b-b PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 1.172e-64
Identity = 106/243 (43.62%), Postives = 163/243 (67.08%), Query Frame = 3
Query:  288 FSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQES----LTVSEGNKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            F ++ M+N A+ YGS++  QG +++ +NID+ +P S ++YYFAVD +YV KK+ LL FP+ H +W V+Y  D  PV PR+DINAPDLYIP+M  +TY+L  GL  G   +FSP+ LG  AS+A+ WLI E+L ++  LY+V   T L  +D++AFSGYK+VGM   ++  +L  + G+Y  LA+  +++ +F+IRTL+++IL + +    L     N+ R+YL +  A +QP  M+ LT  +V
Sbjct:   58 FLSEPMSNFAMAYGSSLASQGKEMMDKNIDRIIPVSKIKYYFAVDTVYVGKKIGLLMFPYMHQDWEVRYQQDT-PVAPRFDINAPDLYIPVMAFITYILVAGLALGTQSRFSPEILGMQASSALAWLIVEVLAILLSLYLVTVNTDLTTVDLVAFSGYKYVGMISGVIAGLLFGNTGYYVVLAWCCISIVFFMIRTLRLKILSEAAAEGVLVRGARNQLRMYLTMAIAAVQPIFMYWLTYHLV 299          
BLAST of Protein YIF1B vs. UniProt/SwissProt
Match: sp|Q6P301|YIF1B_XENTR (Protein YIF1B OS=Xenopus tropicalis OX=8364 GN=yif1b PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 2.766e-64
Identity = 105/243 (43.21%), Postives = 162/243 (66.67%), Query Frame = 3
Query:  288 FSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQES----LTVSEGNKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            F ++ M+N A+ YGS++  QG +++ +NID+ +P S ++YYFAVD +YV KK+ LL FP+ H +W V+Y  D  PV PR+DINAPDLYIP+M  +TY+L  GL  G   +FSP+ LG  AS+A+ WLI E+L ++  LY+V   T L  +D++AFSGYK+VGM   ++  +L    G+Y  L++  +++ +F+IRTL+++IL + +    L     N+ R+YL +  A +QP  M+ LT  +V
Sbjct:   58 FLSEPMSNFAMAYGSSLASQGKEMMDKNIDRIIPVSKIKYYFAVDTVYVGKKIGLLMFPYMHQDWEVRYQQDT-PVAPRFDINAPDLYIPVMAFITYILVAGLALGTQSRFSPEILGMQASSALAWLIVEVLAILLSLYLVTVNTDLTTVDLVAFSGYKYVGMISGVISGLLFGKTGYYVVLSWCGISVVFFMIRTLRLKILSEAAAEGVLVRGARNQLRMYLTMAIAAVQPIFMYWLTYHLV 299          
BLAST of Protein YIF1B vs. TrEMBL
Match: V4BLM7 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_124876 PE=4 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 3.008e-78
Identity = 126/259 (48.65%), Postives = 182/259 (70.27%), Query Frame = 3
Query:  240 QPNFEPQQPIETNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILP--QESLTVSEGNKRRVYLLLFTALIQPFVMWLLTKSIVFN 1010
            QP F  QQ I        ND MAN A+ YGS++  QG DLL +N++KYV TS ++YYFAVD  YV KKL LL FPF H++W+++YN D +P+ PRY+ NAPDLYIP+M  +TY+LT GL+ G  D+F+P+QLG  AS+A+ W++ E+L +   +YI+N  T L+Y+D +A+ GYK+VGM + L+  +L+ S G+Y  LA++ + + +FLIRTL+++ILP  Q     S G+KR  YL+L  ++IQP +MW LT+ I+F 
Sbjct:    8 QPQFPGQQYI--------NDPMANMAVQYGSSLAGQGRDLLDKNLEKYVSTSKIKYYFAVDTAYVGKKLALLTFPFTHSDWSIRYNED-EPIAPRYEHNAPDLYIPVMAFVTYLLTAGLVLGTQDRFTPEQLGIQASSALVWIVIEVLAMTLAVYIMNMNTELKYLDTLAYCGYKYVGMIMSLIAGLLLKSNGYYGVLAWYGLCIVFFLIRTLRVKILPHHQPQDDFSHGSKRSFYLILVISIIQPVMMWWLTRHIMFG 257          
BLAST of Protein YIF1B vs. TrEMBL
Match: A0A0L8FUT8 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22007976mg PE=4 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 8.615e-76
Identity = 139/307 (45.28%), Postives = 200/307 (65.15%), Query Frame = 3
Query:  120 KMRNTFNPYPQNP-------SQTNFGYNSEGYIVTDMGYTSFQQPVFQPNFEPQQPIETNNFP---FSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQ-ESLTVSEGNKRRVYLLLFTALIQPFVMWLLTKSIVF 1007
            K RN  NP  + P        Q  +GY +EGY            P   PN   QQP   N FP     ND MA+ A+ YGS++ +QG + + +NI+KYV TS L+YYFAVD  YV KKL LL FP++HT+W++ ++  +  V P+ ++NAPDLYIP+M L+TY+LT G++ GI ++F+P+QLG  AS+A+ WLI E+ ++M  LYI+N  T L+Y+D +A+SGYK+VGM VILL  +L    G+Y SL +F+ +  YFL++TL+IQILP  +S   + G+KR +Y +L  +L+QP +M  LT  I+F
Sbjct:   14 KKRNNRNPPSRPPLFEDTSSQQAPYGYPNEGY-----------PPNSGPNPYGQQPPNIN-FPGGQLLNDPMASMAMQYGSSLADQGKEYMHKNIEKYVSTSKLKYYFAVDTSYVGKKLTLLLFPYSHTDWSIHFSPGEL-VAPKDELNAPDLYIPVMALVTYILTAGVVMGIQNRFTPEQLGIQASSALVWLILELFIVMLSLYILNLNTGLKYLDTLAYSGYKYVGMIVILLAGLLFKKTGYYFSLLWFTFSTAYFLVKTLRIQILPHADSDGFTRGSKRSLYFILSISLLQPILMGWLTYHIIF 307          
BLAST of Protein YIF1B vs. TrEMBL
Match: C1L679 (Protein YIF1A (YIP1-interacting factor homolog A) OS=Schistosoma japonicum OX=6182 GN=EWB00_010605 PE=2 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 1.786e-75
Identity = 129/264 (48.86%), Postives = 181/264 (68.56%), Query Frame = 3
Query:  231 PVFQPNFE------PQQPIETNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQESLTVSEGNKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            P FQP  +      PQ  + T      N F+ + A  YGS M ++G + +Q+N+D+YV    L+YYF+V+N YVAKK+ ++ FPFAHT WA+ Y+    PVPP  DINAPDLYIPLM  +TYVL CG+IFG   +FSP+ LG ++S A GWL+ E+L+ +F +YI+N + ++ Y+D++A+ GYKFV M V+L+  I ++  G+Y  L Y SVAL +FLIR+LK++ILP      SE NKRR+YLLL  AL+QP +MW LT+ +V
Sbjct:   20 PSFQPQSQQYIPTAPQSGVSTGLSFVQNQFIPDLAARYGSAMFDEGANFVQKNVDQYVNRLRLKYYFSVNNSYVAKKIGVILFPFAHTKWAINYD-PAGPVPPSDDINAPDLYIPLMATITYVLLCGVIFGFQGRFSPEYLGILSSEAFGWLLLEVLLSLFAIYILNIQNNISYLDIVAYCGYKFVSMIVVLISYITLDRPGYYFGLLYVSVALAFFLIRSLKLKILPHAEAYPSECNKRRIYLLLLIALVQPLMMWWLTRRVV 282          
BLAST of Protein YIF1B vs. TrEMBL
Match: A0A2C9JRP2 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106065289 PE=4 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 2.584e-75
Identity = 134/294 (45.58%), Postives = 192/294 (65.31%), Query Frame = 3
Query:  129 NTFNPYPQNPSQTNFGYNSEGYIVTDMGYTSFQQPVFQPNFEPQQPIETNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILM-NSVGFYCSLAYFSVALGYFLIRTLKIQILPQESLT-VSEGNKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            N FN   Q P   N G     Y  +    +S+  P  Q  F  QQ +        ND +A+ A+ YG  +  QG  L+Q+NI+ YV +S L+YYFAVD  YV KKL LLFFPF H++W++ YN D +PVPPRY+INAPDLYIP+M  +TY+L  G++ G   +F+P+QLG  AS+A+ WLI E++     LYI+N  T+L+Y+D++A+ GYKFVGMNV LL  ++  N+  +Y  L +FS+AL +FL+RTLK+Q++PQ+     ++G KR +YL+L  +L QP +MW LT  ++
Sbjct:   37 NDFNIQSQQPFMPNLGQPDMFYGGSAFNSSSYGDPAGQ--FPGQQLL--------NDPVASMAMQYGHTLAGQGKVLVQKNIENYVASSRLKYYFAVDTAYVGKKLALLFFPFTHSDWSIHYNQD-EPVPPRYEINAPDLYIPIMAFVTYILVAGMVLGTQGRFTPEQLGTQASSALVWLIIEMVAFTLSLYILNLSTALKYLDIVAYCGYKFVGMNVSLLAGVMAGNTTVYYGCLIWFSLALVFFLLRTLKVQVMPQQDHDGFTKGAKRSLYLILLVSLSQPLLMWWLTSYVM 319          
BLAST of Protein YIF1B vs. TrEMBL
Match: C1LJ22 (Protein YIF1A (YIP1-interacting factor homolog A) OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 3.528e-75
Identity = 129/264 (48.86%), Postives = 181/264 (68.56%), Query Frame = 3
Query:  231 PVFQPNFE------PQQPIETNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQESLTVSEGNKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            P FQP  +      PQ  + T      N F+ + A  YGS M ++G + +Q+N+D+Y+    L+YYF+V+N YVAKK+ L+ FPFAHT WA+ Y+    PVPP  DINAPDLYIPLM  +TYVL CG+IFG   +FSP+ LG ++S A GWL+ E+L+ +F +YI+N + ++ Y+D++A+ GYKFV M V+L+  I ++  G+Y  L Y SVAL +FLIR+LK++ILP      SE NKRR+YLLL  AL+QP +MW LT+ +V
Sbjct:   20 PSFQPQSQQYIPTAPQSGVSTGLSFVQNQFIPDLAARYGSAMFDEGANFVQKNVDQYINRLRLKYYFSVNNSYVAKKIGLILFPFAHTKWAINYD-PAGPVPPSDDINAPDLYIPLMATITYVLLCGVIFGFQGRFSPEYLGILSSEAFGWLLLEVLLSLFAIYILNIQNNISYLDIVAYCGYKFVSMIVVLISYITLDRPGYYFGLLYVSVALAFFLIRSLKLKILPHAEAYPSECNKRRIYLLLLIALVQPLMMWWLTRRVV 282          
BLAST of Protein YIF1B vs. Ensembl Cavefish
Match: yif1a (Yip1 interacting factor homolog A, membrane trafficking protein [Source:NCBI gene;Acc:103046728])

HSP 1 Score: 189.119 bits (479), Expect = 8.054e-57
Identity = 103/242 (42.56%), Postives = 161/242 (66.53%), Query Frame = 3
Query:  294 NDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQESLT-----VSEGNKRRVYLLLFTALIQPFVMWLLTKSIV 1004
             D MA+AA+ YGS++  QG D++ + I +++  + L+Y+FAVD  YV KKL+LL FP+ H +W V+Y+ D  P+ PR+D+NAPDLYIP M  +TY+L  G+  GI  +FSP+ LG  AS A+ W+I E+LV++  LY++   T L   D++A+SGYK+VGM   +L  +L  S G+Y +LA+ S AL +F++R+LK++IL   S        S   + R+Y+ + +A+ QP +++ LT  +V
Sbjct:   67 TDPMASAAMMYGSSLANQGKDMVNKEISRFMSVNKLKYFFAVDTKYVVKKLMLLMFPYTHQDWEVRYHRD-TPLTPRHDVNAPDLYIPTMAFITYILLAGMALGIQKRFSPEVLGLCASTALVWVIIEVLVMLLSLYLLTVHTDLSTFDLVAYSGYKYVGMIFTVLCGLLFGSDGYYVALAWSSCALMFFIVRSLKMKILSSLSADSMGAGASAKPRFRLYITVASAVFQPIIIYWLTAHLV 307          
BLAST of Protein YIF1B vs. Ensembl Cavefish
Match: ENSAMXT00000040901.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000044.1:1792560:1798138:1 gene:ENSAMXG00000034557.1 transcript:ENSAMXT00000040901.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 3.378e-9
Identity = 29/60 (48.33%), Postives = 45/60 (75.00%), Query Frame = 3
Query:  294 NDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAH 473
            +D M+N A+ YGS++   G +++ +N+D+++P S L+YYFAVD +YV KKL LL FP+ H
Sbjct:   57 SDPMSNLAMAYGSSLASHGKEMMDKNLDRFIPISKLKYYFAVDTVYVGKKLGLLVFPYMH 116          
BLAST of Protein YIF1B vs. Ensembl Sea Lamprey
Match: yif1b (Yip1 interacting factor homolog B (S. cerevisiae) [Source:NCBI gene;Acc:492462])

HSP 1 Score: 202.601 bits (514), Expect = 1.585e-62
Identity = 108/242 (44.63%), Postives = 155/242 (64.05%), Query Frame = 3
Query:  279 NFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQIL----PQESLTVSEGNKRRVYLLLFTALIQPFVMWLLT 992
            N P +N  M N A+ YGS +  QG + +++NID++     L+YYFAVD +YV KKL +L FP+ H NW ++Y  D  PV PR D+NAPDLYIP M  +TY+L  G+  G  ++FSP+QLG  AS+A+ WLI E L ++  LY++  RT L   D++AF+GYK+VGM V LL  +L     +Y  LA+ S A+ +F IRTL+++IL       S+  S  N+ R+YL    A +QP +M+ L+
Sbjct:   77 NDPMANP-MTNMAMAYGSTLANQGKEAVEKNIDRFFSVKKLKYYFAVDTVYVGKKLGILLFPYTHQNWEMRYQQDA-PVAPRVDLNAPDLYIPSMAFITYLLVTGVALGTQNRFSPEQLGMQASSALVWLIMETLAVLLSLYLITVRTDLTTFDIVAFAGYKYVGMIVSLLAGLLFGGNAYYMVLAWCSCAIFFFTIRTLRLKILADMSADSSIVRSSKNQLRMYLTFSIAALQPALMYWLS 316          
BLAST of Protein YIF1B vs. Ensembl Sea Lamprey
Match: yif1a (Yip1 interacting factor homolog A (S. cerevisiae) [Source:NCBI gene;Acc:334982])

HSP 1 Score: 180.259 bits (456), Expect = 6.732e-55
Identity = 93/243 (38.27%), Postives = 151/243 (62.14%), Query Frame = 3
Query:  294 NDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQ-----ESLTVSEGNKRRVYLLLFTALIQPFVMWLLTKSIVF 1007
            +D +A+ AL YGSN+  +  + + R I KY P   L+ YFAVD +YV  KL +L  P+ H NW +++    +PV P++D+NAPDLYIP M  LTYVL  GL++G  D+F PD L    + A+ WL+ E+L++   LY+   R  +   +++A++GYK+VG+ + +L  +L+   G+Y +L + S A   F+I+T++++ILP       + +VS G + R+YL +  A +QP +M  L+  +V 
Sbjct:    5 SDPLADMALKYGSNLAVRSREAMDRGISKYFPIDKLKCYFAVDTVYVQNKLKVLLCPYTHKNWDLRFQKG-EPVAPKFDVNAPDLYIPTMAFLTYVLEAGLVYGTQDRFCPDVLWTRTNMALTWLLVEVLLITLGLYLAALRMPMDIPEIVAYAGYKYVGIVLSVLAGLLLGRCGYYVALLWNSCAFILFMIQTMRLKILPDMDVAGRAQSVSAG-RLRMYLTVAIAAVQPLLMLWLSSDLVL 245          
BLAST of Protein YIF1B vs. Ensembl Yeast
Match: YIF1 (Integral membrane protein; required for the fusion of ER-derived COPII transport vesicles with the Golgi; interacts with Yip1p and Yos1p; localizes to the Golgi, the ER, and COPII vesicles; homolog of human YIPF3 [Source:SGD;Acc:S000005207])

HSP 1 Score: 68.9366 bits (167), Expect = 1.733e-13
Identity = 65/239 (27.20%), Postives = 114/239 (47.70%), Query Frame = 3
Query:  327 GSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPF--AHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLI--FEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLA-----YFSVALGYFLIRTLKIQILPQE---------SLTVSEGNKRRVYLLLFTALIQPFVMWLL 989
            G +   Q  + + +       +  +  YF V   YV  KL L+  PF     NW  +       +PPR D+N+PD+Y+P+MGL+TY+L      G+   F+P+ L    S+ + ++     IL L   L I +   S   ++++ + GYKFV     L+++ L+ +V    +L      Y  +A G FL+R++K  +L +          S++ S   K   +L ++  + Q  +MWL+
Sbjct:   80 GQDNFNQFQETVNKATANAAGSQQISTYFQVSTRYVINKLKLILVPFLNGTKNWQ-RIMDSGNFLPPRDDVNSPDMYMPIMGLVTYILIWNTQQGLKGSFNPEDLYYKLSSTLAFVCLDLLILKLGLYLLIDSKIPSFSLVELLCYVGYKFVP----LILAQLLTNVTMPFNLNILIKFYLFIAFGVFLLRSVKFNLLSRSGAEDDDIHVSISKSTVKKCNYFLFVYGFIWQNVLMWLM 313          
BLAST of Protein YIF1B vs. Ensembl Nematostella
Match: EDO43056 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZV4])

HSP 1 Score: 234.958 bits (598), Expect = 1.070e-75
Identity = 113/237 (47.68%), Postives = 166/237 (70.04%), Query Frame = 3
Query:  303 MANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDK----FSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQESLTVSEGNKRRVYLLLFTALIQPFVMWLLTKSI 1001
            M N A  YG+N+  QG + +++N+D++V  S L+YYFAVD  YV KKL LL FPF H NWAVQYN + +PV PRY++NAPDLYIP+M  +TYVL  GL+ G  ++    F+P+QLG  AS+A+ WL  EI+ ++F +Y+ N ++ ++  D++AF GYK+ GM +  L  +L  S+G+YC   Y S+   +FLIRTL++ I+P+ S  ++  +KRR+YLLLF A++QPF M+ LT  +
Sbjct:   13 MTNMAFQYGTNVASQGKEYVEKNLDRFVSISKLKYYFAVDTSYVVKKLGLLLFPFTHKNWAVQYNKE-EPVAPRYEVNAPDLYIPVMAFVTYVLVAGLVLGTQNRQVVQFTPEQLGITASSALIWLFVEIMAILFSMYLCNVQSEIKTFDLLAFCGYKYFGMILSCLAGLLFKSLGYYCVFIYTSITNAFFLIRTLRLVIIPETSDGIARTSKRRIYLLLFIAVLQPFFMFFLTSHL 248          
BLAST of Protein YIF1B vs. Ensembl Medaka
Match: yif1a (Yip1 interacting factor homolog A, membrane trafficking protein [Source:NCBI gene;Acc:101173231])

HSP 1 Score: 178.333 bits (451), Expect = 1.372e-52
Identity = 108/290 (37.24%), Postives = 179/290 (61.72%), Query Frame = 3
Query:  150 QNPSQTNFGYNSEGYIVTDMGYTSFQQPVFQPNFEPQQPIETNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQ-----ESLTVSEGNKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            ++ S    G +S+GY  +  GY + + P   PN     P   N F    D MA+AA+ YGS++  +G +++ + I +++  + L+Y+FAVD  YV KKL++L FP+ H +W V+Y+ D  P+ PR D+NAPDLYIP M  +TY+L  G+  GI  +FSP+ LG  AS A+ W+I E+L+++  LY++   + L   D+IA+SGYK+VG+   +   +L  S G++ +LA+ S A+ +F++R+LK++IL         +  S   + R+Y+ + TA+ QP +++ LT  +V
Sbjct:   28 EDTSSAALGPSSQGYYAS--GY-NMEGP---PNDTQGGPGMNNLF---ADPMASAAMMYGSSLANRGQEIVNKEIGRFMSVNKLKYFFAVDTRYVLKKLMILMFPYTHQDWDVRYHRDT-PLTPRQDVNAPDLYIPTMAFITYILLAGMALGIQKRFSPEVLGLCASTALVWVIIEVLIMLLSLYLLTVHSDLSTFDLIAYSGYKYVGIIFTMTCGLLFGSDGYFVALAWSSFAIMFFIVRSLKMKILTSVSSDSMGMGSSAKPQIRIYITVATAIFQPIIIYWLTSHLV 307          
BLAST of Protein YIF1B vs. Ensembl Medaka
Match: yif1a (Yip1 interacting factor homolog A, membrane trafficking protein [Source:NCBI gene;Acc:101173231])

HSP 1 Score: 177.563 bits (449), Expect = 9.439e-52
Identity = 108/290 (37.24%), Postives = 179/290 (61.72%), Query Frame = 3
Query:  150 QNPSQTNFGYNSEGYIVTDMGYTSFQQPVFQPNFEPQQPIETNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQ-----ESLTVSEGNKRRVYLLLFTALIQPFVMWLLTKSIV 1004
            ++ S    G +S+GY  +  GY + + P   PN     P   N F    D MA+AA+ YGS++  +G +++ + I +++  + L+Y+FAVD  YV KKL++L FP+ H +W V+Y+ D  P+ PR D+NAPDLYIP M  +TY+L  G+  GI  +FSP+ LG  AS A+ W+I E+L+++  LY++   + L   D+IA+SGYK+VG+   +   +L  S G++ +LA+ S A+ +F++R+LK++IL         +  S   + R+Y+ + TA+ QP +++ LT  +V
Sbjct:   79 EDTSSAALGPSSQGYYAS--GY-NMEGP---PNDTQGGPGMNNLF---ADPMASAAMMYGSSLANRGQEIVNKEIGRFMSVNKLKYFFAVDTRYVLKKLMILMFPYTHQDWDVRYHRDT-PLTPRQDVNAPDLYIPTMAFITYILLAGMALGIQKRFSPEVLGLCASTALVWVIIEVLIMLLSLYLLTVHSDLSTFDLIAYSGYKYVGIIFTMTCGLLFGSDGYFVALAWSSFAIMFFIVRSLKMKILTSVSSDSMGMGSSAKPQIRIYITVATAIFQPIIIYWLTSHLV 358          
BLAST of Protein YIF1B vs. Planmine SMEST
Match: SMESG000057246.1 (SMESG000057246.1)

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 295/296 (99.66%), Postives = 296/296 (100.00%), Query Frame = 3
Query:  123 MRNTFNPYPQNPSQTNFGYNSEGYIVTDMGYTSFQQPVFQPNFEPQQPIETNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAXXXXXXXXPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIRTLKIQILPQESLTVSEGNKRRVYLLLFTALIQPFVMWLLTKSIVFN 1010
            MRNTFNPYPQNPSQTNFGYNSEGYIVTDMGYTSFQQPVFQPNFEPQQPIETNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAKKLLLLFFPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFS+ALGYFLIRTLKIQILPQESLTVSEGNKRRVYLLLFTALIQPFVMWLLTKSIVFN
Sbjct:    1 MRNTFNPYPQNPSQTNFGYNSEGYIVTDMGYTSFQQPVFQPNFEPQQPIETNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVDNLYVAKKLLLLFFPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLLTYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNARTSLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSIALGYFLIRTLKIQILPQESLTVSEGNKRRVYLLLFTALIQPFVMWLLTKSIVFN 296          
The following BLAST results are available for this feature:
BLAST of Protein YIF1B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
YIF1B1.173e-6645.42Yip1 interacting factor homolog B, membrane traffi... [more]
YIF1B1.173e-6645.42Yip1 interacting factor homolog B, membrane traffi... [more]
YIF1B1.173e-6645.42Yip1 interacting factor homolog B, membrane traffi... [more]
YIF1B2.620e-6645.42Yip1 interacting factor homolog B, membrane traffi... [more]
YIF1B5.396e-6645.42Yip1 interacting factor homolog B, membrane traffi... [more]
back to top
BLAST of Protein YIF1B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
yif-12.317e-5240.94YIP1-Interacting Factor homolog [Source:UniProtKB... [more]
yif-16.692e-5241.60YIP1-Interacting Factor homolog [Source:UniProtKB... [more]
back to top
BLAST of Protein YIF1B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Yif18.104e-6139.34gene:FBgn0039450 transcript:FBtr0085038[more]
Yif19.669e-6139.34gene:FBgn0039450 transcript:FBtr0085037[more]
Yif11.170e-6039.34gene:FBgn0039450 transcript:FBtr0085039[more]
back to top
BLAST of Protein YIF1B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yif1b1.101e-6545.64Yip1 interacting factor homolog B (S. cerevisiae) ... [more]
yif1b1.253e-5948.98Yip1 interacting factor homolog B (S. cerevisiae) ... [more]
yif1a3.844e-5840.28Yip1 interacting factor homolog A (S. cerevisiae) ... [more]
yif1a3.844e-5840.28Yip1 interacting factor homolog A (S. cerevisiae) ... [more]
yif1a9.567e-3542.86Yip1 interacting factor homolog A (S. cerevisiae) ... [more]
back to top
BLAST of Protein YIF1B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mthfd1l5.641e-6543.21methylenetetrahydrofolate dehydrogenase (NADP+ dep... [more]
back to top
BLAST of Protein YIF1B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Yif1b2.179e-6644.88Yip1 interacting factor homolog B (S. cerevisiae) ... [more]
Yif1b3.285e-6644.88Yip1 interacting factor homolog B (S. cerevisiae) ... [more]
Yif1b5.797e-6644.88Yip1 interacting factor homolog B (S. cerevisiae) ... [more]
Yif1b4.374e-5646.77Yip1 interacting factor homolog B (S. cerevisiae) ... [more]
Yif1a4.442e-5643.28Yip1 interacting factor homolog A (S. cerevisiae) ... [more]
back to top
BLAST of Protein YIF1B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CX30|YIF1B_MOUSE2.298e-6544.88Protein YIF1B OS=Mus musculus OX=10090 GN=Yif1b PE... [more]
sp|Q5BJH7|YIF1B_HUMAN2.591e-6545.42Protein YIF1B OS=Homo sapiens OX=9606 GN=YIF1B PE=... [more]
sp|Q5U3G6|YIF1B_DANRE1.053e-6445.64Protein YIF1B OS=Danio rerio OX=7955 GN=yif1b PE=2... [more]
sp|Q4FZQ0|YF1BB_XENLA1.172e-6443.62Protein YIF1B-B OS=Xenopus laevis OX=8355 GN=yif1b... [more]
sp|Q6P301|YIF1B_XENTR2.766e-6443.21Protein YIF1B OS=Xenopus tropicalis OX=8364 GN=yif... [more]
back to top
BLAST of Protein YIF1B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4BLM73.008e-7848.65Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A0L8FUT88.615e-7645.28Uncharacterized protein OS=Octopus bimaculoides OX... [more]
C1L6791.786e-7548.86Protein YIF1A (YIP1-interacting factor homolog A) ... [more]
A0A2C9JRP22.584e-7545.58Uncharacterized protein OS=Biomphalaria glabrata O... [more]
C1LJ223.528e-7548.86Protein YIF1A (YIP1-interacting factor homolog A) ... [more]
back to top
BLAST of Protein YIF1B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
yif1a8.054e-5742.56Yip1 interacting factor homolog A, membrane traffi... [more]
ENSAMXT00000040901.13.378e-948.33pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Protein YIF1B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
yif1b1.585e-6244.63Yip1 interacting factor homolog B (S. cerevisiae) ... [more]
yif1a6.732e-5538.27Yip1 interacting factor homolog A (S. cerevisiae) ... [more]
back to top
BLAST of Protein YIF1B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YIF11.733e-1327.20Integral membrane protein; required for the fusion... [more]
back to top
BLAST of Protein YIF1B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO430561.070e-7547.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein YIF1B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
yif1a1.372e-5237.24Yip1 interacting factor homolog A, membrane traffi... [more]
yif1a9.439e-5237.24Yip1 interacting factor homolog A, membrane traffi... [more]
back to top
BLAST of Protein YIF1B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000057246.10.000e+099.66SMESG000057246.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034476 ID=SMED30034476|Name=Protein YIF1B|organism=Schmidtea mediterranea sexual|type=transcript|length=1189bp
CTTAATTCGTTAATTAAAAATCTGCTTCAAAAATTAATCAGTACAATAAC
AGATTGTTTTAGTTATATGCAACCTTAATTTTGCTAACGTTATAAAAATT
ACAATTTTATTTTTAAATTAAAATGCGAAACACTTTTAATCCATATCCCC
AAAATCCTTCACAAACAAATTTTGGTTATAATTCCGAAGGATATATTGTT
ACTGATATGGGCTATACTTCATTTCAACAACCTGTGTTTCAGCCTAATTT
CGAACCTCAACAACCAATAGAAACAAATAATTTTCCTTTTTCTAATGATT
TTATGGCGAATGCAGCTTTAAATTATGGGTCAAATATGGTTGAACAAGGC
ACGGATTTGTTACAAAGAAATATAGATAAATATGTACCAACGTCCACACT
TAGATATTATTTTGCCGTTGATAATCTCTATGTTGCTAAAAAGTTACTTT
TATTATTCTTTCCATTCGCTCATACAAACTGGGCTGTTCAATATAATCAT
GATAAGCAACCTGTGCCTCCAAGATATGATATAAATGCCCCAGATCTATA
TATTCCATTAATGGGATTATTAACATATGTCTTGACTTGTGGTCTTATTT
TCGGAATAAATGATAAGTTCTCTCCGGACCAACTTGGTGGAATGGCTAGT
AATGCAGTTGGATGGTTAATATTCGAAATTTTAGTATTAATGTTCATTTT
GTACATTGTTAACGCCAGAACATCTCTCAGATATATGGATATGATAGCCT
TTTCTGGCTATAAATTTGTAGGAATGAATGTTATTTTACTCATGTCAATT
TTGATGAATTCTGTGGGATTCTATTGCTCTCTAGCTTACTTTAGCGTTGC
ATTGGGATATTTTCTGATTAGAACTTTGAAAATTCAAATATTGCCACAGG
AATCTCTAACTGTTAGTGAAGGAAATAAAAGACGAGTTTATTTGCTGCTT
TTTACAGCACTTATACAGCCATTTGTCATGTGGTTGTTGACAAAATCAAT
CGTGTTTAATTAATATTTATCATTTGACAACAATCTTTACGAATGGATGT
TTACAGATTTGTTTACAGAATCTTTTATCGTAATGAGAATGAGCCAACTT
AAAATGTGTTATAATAAAGATTAACTAAATATCGAGTATTTAAACATTTC
TTTTAAAATAATGTTACATTTAAATATATAAAACTTTCC
back to top

protein sequence of SMED30034476-orf-1

>SMED30034476-orf-1 ID=SMED30034476-orf-1|Name=SMED30034476-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=297bp
MRNTFNPYPQNPSQTNFGYNSEGYIVTDMGYTSFQQPVFQPNFEPQQPIE
TNNFPFSNDFMANAALNYGSNMVEQGTDLLQRNIDKYVPTSTLRYYFAVD
NLYVAKKLLLLFFPFAHTNWAVQYNHDKQPVPPRYDINAPDLYIPLMGLL
TYVLTCGLIFGINDKFSPDQLGGMASNAVGWLIFEILVLMFILYIVNART
SLRYMDMIAFSGYKFVGMNVILLMSILMNSVGFYCSLAYFSVALGYFLIR
TLKIQILPQESLTVSEGNKRRVYLLLFTALIQPFVMWLLTKSIVFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006888ER to Golgi vesicle-mediated transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005578Yif1_fam
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005578Yif1 familyPFAMPF03878YIF1coord: 58..290
e-value: 2.0E-81
score: 273.1
IPR005578Yif1 familyPANTHERPTHR14083YIP1 INTERACTING FACTOR HOMOLOG YIF1 PROTEINcoord: 31..290
NoneNo IPR availableTMHMMTMhelixcoord: 230..252
NoneNo IPR availableTMHMMTMhelixcoord: 143..162
NoneNo IPR availableTMHMMTMhelixcoord: 177..196
NoneNo IPR availableTMHMMTMhelixcoord: 209..226
NoneNo IPR availableTMHMMTMhelixcoord: 273..295