casein kinase I isoform X3

Overview
Namecasein kinase I isoform X3
Smed IDSMED30034473
Length (bp)1665
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of casein kinase I isoform X3 (SMED30034473) t-SNE clustered cells

Violin plots show distribution of expression levels for casein kinase I isoform X3 (SMED30034473) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of casein kinase I isoform X3 (SMED30034473) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for casein kinase I isoform X3 (SMED30034473) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034473

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30034473SMESG000048912.1 SMESG000020005.1 dd_Smed_v4_172_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034473SMESG000048912.1 SMESG000020005.1 dd_Smed_v4_172_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30034473SMESG000043684.1 SMESG000034836.1 SMED30007343smed_20140614PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30034473SMESG000043684.1 SMESG000034836.1 SMED30007343smed_20140614PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymal cellSMED30034473SMESG000048912.1 SMESG000020005.1 dd_Smed_v6_172_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30034473SMESG000034836.1 Contig32799newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of casein kinase I isoform X3 vs. Ensembl Human
Match: CSNK1G3 (casein kinase 1 gamma 3 [Source:HGNC Symbol;Acc:HGNC:2456])

HSP 1 Score: 471.47 bits (1212), Expect = 7.227e-163
Identity = 234/393 (59.54%), Postives = 287/393 (73.03%), Query Frame = 1
Query:   82 SSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQSFVH----ELVTP-----------AMPKEDKIIYETD----VSIGCCGKCFGRKKQ 1203
             S  S  ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEPMK+R+PQLHLEY+FYK L S    DG P+V++FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R EY+H+  LIYRDVKPENFL+GR   K    I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  R  +  D+++DWI K   T   A + QD  +++  +      +  Q     V     EL T              P E +++ ET+    +++ CC  CF ++++
Sbjct:   30 GSSSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSG---DGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGA-VQQDPALSSNREAHQHRDKMQQSKNQVVSSTNGELNTDDPTAGRSNAPITAPTEVEVMDETNCQKVLNMWCC--CFFKRRK 416          
BLAST of casein kinase I isoform X3 vs. Ensembl Human
Match: CSNK1G1 (casein kinase 1 gamma 1 [Source:HGNC Symbol;Acc:HGNC:2454])

HSP 1 Score: 468.389 bits (1204), Expect = 1.036e-161
Identity = 219/338 (64.79%), Postives = 271/338 (80.18%), Query Frame = 1
Query:  103 VIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQSFVHELVT 1116
            ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L S G  +G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R F++KTV MIAIQLL R EY+H+  LIYRDVKPENFL+GR+  KK + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI+ LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  +  +  D+ +DW+ +   T    ++  D+  +A T  ++  R    + Q   +++V+
Sbjct:   38 LMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAG--EGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFEKKGYTFDYAYDWVGRPIPT-PVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVS 372          
BLAST of casein kinase I isoform X3 vs. Ensembl Human
Match: CSNK1G2 (casein kinase 1 gamma 2 [Source:HGNC Symbol;Acc:HGNC:2455])

HSP 1 Score: 467.618 bits (1202), Expect = 2.028e-161
Identity = 236/399 (59.15%), Postives = 292/399 (73.18%), Query Frame = 1
Query:   64 SNMSVHSSGDSSFVI-VGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKT---------SSSATLSQDTKITAFTDTTNQTRRS-SQRNQSFVHELVTPAMPKEDKIIYETDVSIGCCGKCF--GRKKQNLYKNQ 1221
            S+  + SSG SS V+ VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L++    +G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R F++KTV MIAIQL+ R EY+H   LIYRDVKPENFLVGR   K+ + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  R+ +  D+++DW  K   T          S   L   T+  +     N T    +  + +  H       P E ++  ET     CC  CF   RK+++L +++
Sbjct:   26 SSHGIRSSGTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLSA---TEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTKRQHAIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRSGFVFDYEYDWAGKPLPTPIGTVHTDLPSQPQLRDKTQPHSKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETK----CC--CFFKRRKRKSLQRHK 415          
BLAST of casein kinase I isoform X3 vs. Ensembl Human
Match: CSNK1G3 (casein kinase 1 gamma 3 [Source:HGNC Symbol;Acc:HGNC:2456])

HSP 1 Score: 468.774 bits (1205), Expect = 2.084e-161
Identity = 226/342 (66.08%), Postives = 269/342 (78.65%), Query Frame = 1
Query:   82 SSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQ-RNQSFVH 1104
             S  S  ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEPMK+R+PQLHLEY+FYK L S    DG P+V++FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R EY+H+  LIYRDVKPENFL+GR   K    I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE   PEM +YLRYVR+LDF+E+PDY YL+ LF+ +  R  +  D+++DWI K   T   A + QD  +++  +      +  Q +NQS  H
Sbjct:   30 GSSSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSG---DGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENF-PEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGA-VQQDPALSSNREAHQHRDKMQQSKNQSADH 366          
BLAST of casein kinase I isoform X3 vs. Ensembl Human
Match: CSNK1G1 (casein kinase 1 gamma 1 [Source:HGNC Symbol;Acc:HGNC:2454])

HSP 1 Score: 466.463 bits (1199), Expect = 2.153e-161
Identity = 224/337 (66.47%), Postives = 271/337 (80.42%), Query Frame = 1
Query:  103 VIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTR-RSSQ----RNQSF 1098
            ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L S G  +G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R F++KTV MIAIQLL R EY+H+  LIYRDVKPENFL+GR+  KK + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI+ LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  +  +  D+ +DW+ +   T    ++  D+  +A T  ++  R R SQ    RNQS 
Sbjct:   38 LMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAG--EGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFEKKGYTFDYAYDWVGRPIPT-PVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQSL 371          
BLAST of casein kinase I isoform X3 vs. Ensembl Celegans
Match: csnk-1 (Casein kinase I gamma [Source:UniProtKB/Swiss-Prot;Acc:Q8WQ99])

HSP 1 Score: 454.907 bits (1169), Expect = 5.503e-157
Identity = 218/331 (65.86%), Postives = 258/331 (77.95%), Query Frame = 1
Query:   64 SNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSS-SATL----SQDTKIT 1041
            S  S  ++     ++VGPNFKVGKKIG GNFGELRLGKNLYNNEHVAIKLEPMK+++PQLHLEY+FYK+L   G  +G P+V +FG C +YNALVMELLG SLEDLFD C+R FS+KTVAM+A+QL+ R EY+H   LIYRDVKPENFL+GR S +K + + +IDFGLAKEY D +T  HI YREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR T +++LCEG P E   YLRY R+LDF+E PDY +  +LF  +L R     D++FDW  K    S+ S +L    S+D K T
Sbjct:    9 SATSASTTNSQGVLMVGPNFKVGKKIGCGNFGELRLGKNLYNNEHVAIKLEPMKSKAPQLHLEYRFYKLL---GQAEGLPQVHYFGPCGKYNALVMELLGHSLEDLFDLCDRHFSLKTVAMVAMQLIRRIEYVHTKHLIYRDVKPENFLIGRYSTRKQHVLHIIDFGLAKEYIDCDTGKHIAYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRQTAVEVLCEGFPDEFAQYLRYARRLDFFETPDYDFCYNLFKSVLDRLGATYDYEFDWTPKLNNVSTPSGSLHTSESKDVKRT 336          
BLAST of casein kinase I isoform X3 vs. Ensembl Celegans
Match: kin-19 (Casein kinase I isoform alpha [Source:UniProtKB/Swiss-Prot;Acc:P42168])

HSP 1 Score: 320.857 bits (821), Expect = 1.511e-105
Identity = 165/321 (51.40%), Postives = 219/321 (68.22%), Query Frame = 1
Query:  106 IVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKH-NTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQ 1065
            IV   +K+ +KIGSG+FG++ +  N+ N E VAIKLE  + R PQL  E K Y+IL   G+  G P + ++G    YN LVM+LLGPSLEDLF+ C+R F++KTV M+A Q++ R EY+H    I+RD+KP+NFL+G   + +H N +F+IDFGLAK+Y+D  T  HIPYRE K+LTGTARY SIN HLG EQSRRDD+ESLG++ MYF RG+LPWQGLKA   K++Y+KI + K +T ++ LC+G P E   YL Y R L F E PDY YL+ LF  +    N + D+ FDW +  QK    A  SQ + +   T+TT Q
Sbjct:   11 IVATKYKLIRKIGSGSFGDIYVSINVTNGEEVAIKLESNRARHPQLLYESKVYRILQG-GV--GIPHIRWYGTEREYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMIGRIEYVHVKNFIHRDIKPDNFLMG---IGRHCNKLFLIDFGLAKKYRDSRTRTHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRGTLPWQGLKAATKKQKYEKISEKKMTTSVEHLCKGFPAEFPMYLSYTRGLRFDESPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQK----AQQSQSSGVPG-TNTTTQ 320          
BLAST of casein kinase I isoform X3 vs. Ensembl Celegans
Match: kin-19 (Casein kinase I isoform alpha [Source:UniProtKB/Swiss-Prot;Acc:P42168])

HSP 1 Score: 320.857 bits (821), Expect = 1.511e-105
Identity = 165/321 (51.40%), Postives = 219/321 (68.22%), Query Frame = 1
Query:  106 IVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKH-NTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQ 1065
            IV   +K+ +KIGSG+FG++ +  N+ N E VAIKLE  + R PQL  E K Y+IL   G+  G P + ++G    YN LVM+LLGPSLEDLF+ C+R F++KTV M+A Q++ R EY+H    I+RD+KP+NFL+G   + +H N +F+IDFGLAK+Y+D  T  HIPYRE K+LTGTARY SIN HLG EQSRRDD+ESLG++ MYF RG+LPWQGLKA   K++Y+KI + K +T ++ LC+G P E   YL Y R L F E PDY YL+ LF  +    N + D+ FDW +  QK    A  SQ + +   T+TT Q
Sbjct:   11 IVATKYKLIRKIGSGSFGDIYVSINVTNGEEVAIKLESNRARHPQLLYESKVYRILQG-GV--GIPHIRWYGTEREYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMIGRIEYVHVKNFIHRDIKPDNFLMG---IGRHCNKLFLIDFGLAKKYRDSRTRTHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRGTLPWQGLKAATKKQKYEKISEKKMTTSVEHLCKGFPAEFPMYLSYTRGLRFDESPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQK----AQQSQSSGVPG-TNTTTQ 320          
BLAST of casein kinase I isoform X3 vs. Ensembl Celegans
Match: kin-20 (Casein kinase I isoform delta [Source:UniProtKB/Swiss-Prot;Acc:Q20471])

HSP 1 Score: 317.005 bits (811), Expect = 1.107e-104
Identity = 156/291 (53.61%), Postives = 212/291 (72.85%), Query Frame = 1
Query:  109 VGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDW 981
            VG  F++G+KIGSG+FG++ LG+N+  NE VA+KLE +K++ PQLH+E + Y+I+   GI  G P++ + G    YN +VMELLGPSLEDLF+ C R FS+KTV ++A Q+L R E+IH    I+RD+KP+NFL+G    K+ N +++IDFGLAK Y+D + + HI YRE+K+LTGTARY SINTH G EQSRRDD+ESLG++FMYF RG+LPWQGLKA   +++Y+ I + K ST +D LC G+P     YL Y R L F E+PDY YL++LF  +  R  +  D+ FDW
Sbjct:    5 VGNRFRLGRKIGSGSFGDIYLGQNIQTNEEVAVKLECVKSKHPQLHIESRLYRIMLG-GI--GIPEIRWCGQEGDYNVMVMELLGPSLEDLFNFCQRKFSLKTVLLLADQMLSRVEFIHCRDYIHRDIKPDNFLMGLG--KRGNLVYIIDFGLAKRYRDSK-HQHIAYRENKNLTGTARYASINTHRGIEQSRRDDIESLGYVFMYFNRGTLPWQGLKAVTKRQKYELISEKKISTRVDDLCAGYPEAFAQYLNYCRSLGFEEQPDYGYLRNLFRTLFHRQQFCYDYVFDW 289          
BLAST of casein kinase I isoform X3 vs. Ensembl Celegans
Match: kin-20 (Casein kinase I isoform delta [Source:UniProtKB/Swiss-Prot;Acc:Q20471])

HSP 1 Score: 317.005 bits (811), Expect = 1.107e-104
Identity = 156/291 (53.61%), Postives = 212/291 (72.85%), Query Frame = 1
Query:  109 VGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDW 981
            VG  F++G+KIGSG+FG++ LG+N+  NE VA+KLE +K++ PQLH+E + Y+I+   GI  G P++ + G    YN +VMELLGPSLEDLF+ C R FS+KTV ++A Q+L R E+IH    I+RD+KP+NFL+G    K+ N +++IDFGLAK Y+D + + HI YRE+K+LTGTARY SINTH G EQSRRDD+ESLG++FMYF RG+LPWQGLKA   +++Y+ I + K ST +D LC G+P     YL Y R L F E+PDY YL++LF  +  R  +  D+ FDW
Sbjct:    5 VGNRFRLGRKIGSGSFGDIYLGQNIQTNEEVAVKLECVKSKHPQLHIESRLYRIMLG-GI--GIPEIRWCGQEGDYNVMVMELLGPSLEDLFNFCQRKFSLKTVLLLADQMLSRVEFIHCRDYIHRDIKPDNFLMGLG--KRGNLVYIIDFGLAKRYRDSK-HQHIAYRENKNLTGTARYASINTHRGIEQSRRDDIESLGYVFMYFNRGTLPWQGLKAVTKRQKYELISEKKISTRVDDLCAGYPEAFAQYLNYCRSLGFEEQPDYGYLRNLFRTLFHRQQFCYDYVFDW 289          
BLAST of casein kinase I isoform X3 vs. Ensembl Fly
Match: gish (gene:FBgn0250823 transcript:FBtr0083265)

HSP 1 Score: 470.7 bits (1210), Expect = 3.061e-162
Identity = 222/350 (63.43%), Postives = 273/350 (78.00%), Query Frame = 1
Query:   43 STMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTS-SSATLSQDTKITAFTDTTNQTRRSSQRN 1089
            S+ +N YS     S+  +  ++VGPNF+VGKKIG GNFGELRLGKNLYNNEHVAIK+EPMK+++PQLHLEY+FYK+L S    +G P+V++FG C +YNALVMELLGPSLEDLFD C R F++K+V +IAIQLL R EY+H+  LIYRDVKPENFL+GR S K+   I +IDFGLAKEY D +TN HIPYREHKSLTGTARYMSINTH+G+EQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LC+GHP E  +YLRYVR+LDF+E PDY +L+ LF  +  R  +  + +FDW  KT  T   S     +  I+   D  N T +++ + 
Sbjct:   37 SSSNNMYSTRQSVST-TTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHA--EGVPEVYYFGPCGKYNALVMELLGPSLEDLFDICGRRFTLKSVLLIAIQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWTGKTMSTPVGSLQTGHEVIISPNKDRHNVTAKTNAKG 383          
BLAST of casein kinase I isoform X3 vs. Ensembl Fly
Match: gish (gene:FBgn0250823 transcript:FBtr0083263)

HSP 1 Score: 465.692 bits (1197), Expect = 5.210e-161
Identity = 218/336 (64.88%), Postives = 266/336 (79.17%), Query Frame = 1
Query:   85 SGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTS-SSATLSQDTKITAFTDTTNQTRRSSQRN 1089
            S  +  ++VGPNF+VGKKIG GNFGELRLGKNLYNNEHVAIK+EPMK+++PQLHLEY+FYK+L S    +G P+V++FG C +YNALVMELLGPSLEDLFD C R F++K+V +IAIQLL R EY+H+  LIYRDVKPENFL+GR S K+   I +IDFGLAKEY D +TN HIPYREHKSLTGTARYMSINTH+G+EQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LC+GHP E  +YLRYVR+LDF+E PDY +L+ LF  +  R  +  + +FDW  KT  T   S     +  I+   D  N T +++ + 
Sbjct:    9 STTTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHA--EGVPEVYYFGPCGKYNALVMELLGPSLEDLFDICGRRFTLKSVLLIAIQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWTGKTMSTPVGSLQTGHEVIISPNKDRHNVTAKTNAKG 342          
BLAST of casein kinase I isoform X3 vs. Ensembl Fly
Match: gish (gene:FBgn0250823 transcript:FBtr0100331)

HSP 1 Score: 456.447 bits (1173), Expect = 2.429e-158
Identity = 215/329 (65.35%), Postives = 262/329 (79.64%), Query Frame = 1
Query:   25 SMKTSGSTMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNS--EGIIDGFPKVFFFGLCN-RYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKT 1002
            ++    S+ +N YS     S+  +  ++VGPNF+VGKKIG GNFGELRLGKNLYNNEHVAIK+EPMK+++PQLHLEY+FYK+L S  +   DG P+++  G C  RYNA+V+ELLG SLEDLF+ C R FS+KTV MIA QLL R EY+H+  LIYRDVKPENFL+GR S K+   I +IDFGLAKEY D +TN HIPYREHKSLTGTARYMSINTH+G+EQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LC+GHP E  +YLRYVR+LDF+E PDY +L+ LF  +  R  +  + +FDW  KT +T
Sbjct:   31 ALAGGKSSSNNMYSTRQSVST-TTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAPDGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWTGKTMET 358          
BLAST of casein kinase I isoform X3 vs. Ensembl Fly
Match: gish (gene:FBgn0250823 transcript:FBtr0083262)

HSP 1 Score: 457.988 bits (1177), Expect = 3.122e-157
Identity = 220/353 (62.32%), Postives = 270/353 (76.49%), Query Frame = 1
Query:   43 STMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNS--EGIIDGFPKVFFFGLCN-RYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTS-SSATLSQDTKITAFTDTTNQTRRSSQRN 1089
            S+ +N YS     S+  +  ++VGPNF+VGKKIG GNFGELRLGKNLYNNEHVAIK+EPMK+++PQLHLEY+FYK+L S  +   DG P+++  G C  RYNA+V+ELLG SLEDLF+ C R FS+KTV MIA QLL R EY+H+  LIYRDVKPENFL+GR S K+   I +IDFGLAKEY D +TN HIPYREHKSLTGTARYMSINTH+G+EQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LC+GHP E  +YLRYVR+LDF+E PDY +L+ LF  +  R  +  + +FDW  KT  T   S     +  I+   D  N T +++ + 
Sbjct:   37 SSSNNMYSTRQSVST-TTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAPDGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWTGKTMSTPVGSLQTGHEVIISPNKDRHNVTAKTNAKG 388          
BLAST of casein kinase I isoform X3 vs. Ensembl Fly
Match: gish (gene:FBgn0250823 transcript:FBtr0083261)

HSP 1 Score: 457.988 bits (1177), Expect = 3.122e-157
Identity = 220/353 (62.32%), Postives = 270/353 (76.49%), Query Frame = 1
Query:   43 STMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNS--EGIIDGFPKVFFFGLCN-RYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTS-SSATLSQDTKITAFTDTTNQTRRSSQRN 1089
            S+ +N YS     S+  +  ++VGPNF+VGKKIG GNFGELRLGKNLYNNEHVAIK+EPMK+++PQLHLEY+FYK+L S  +   DG P+++  G C  RYNA+V+ELLG SLEDLF+ C R FS+KTV MIA QLL R EY+H+  LIYRDVKPENFL+GR S K+   I +IDFGLAKEY D +TN HIPYREHKSLTGTARYMSINTH+G+EQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LC+GHP E  +YLRYVR+LDF+E PDY +L+ LF  +  R  +  + +FDW  KT  T   S     +  I+   D  N T +++ + 
Sbjct:   37 SSSNNMYSTRQSVST-TTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAPDGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWTGKTMSTPVGSLQTGHEVIISPNKDRHNVTAKTNAKG 388          
BLAST of casein kinase I isoform X3 vs. Ensembl Zebrafish
Match: csnk1g1 (casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494092])

HSP 1 Score: 473.781 bits (1218), Expect = 6.031e-164
Identity = 221/338 (65.38%), Postives = 275/338 (81.36%), Query Frame = 1
Query:  103 VIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQSFVHELVT 1116
            ++VGPNF+VGKKIG GNFGEL+LGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L   G  DG P+VF+FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R EY+H+  LIYRDVKPENFL+GR+  KK + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL++LF+++  R  +  D+ +DW+ + Q  +   T+  D+  +A T  ++  R    ++Q   +++V+
Sbjct:   38 LMVGPNFRVGKKIGCGNFGELKLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKTL---GSADGLPQVFYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRNLFTELFDRKGYAFDYSYDWVGR-QIPTPVGTVHVDSGASAITRESHAHRDRPSQHQPLRNQVVS 371          
BLAST of casein kinase I isoform X3 vs. Ensembl Zebrafish
Match: csnk1g1 (casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494092])

HSP 1 Score: 473.011 bits (1216), Expect = 4.433e-163
Identity = 225/340 (66.18%), Postives = 276/340 (81.18%), Query Frame = 1
Query:  103 VIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTR-RSSQ----RNQSFVHE 1107
            ++VGPNF+VGKKIG GNFGEL+LGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L   G  DG P+VF+FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R EY+H+  LIYRDVKPENFL+GR+  KK + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL++LF+++  R  +  D+ +DW+ + Q  +   T+  D+  +A T  ++  R R SQ    RNQ+ + +
Sbjct:   38 LMVGPNFRVGKKIGCGNFGELKLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKTL---GSADGLPQVFYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRNLFTELFDRKGYAFDYSYDWVGR-QIPTPVGTVHVDSGASAITRESHAHRDRPSQHQPLRNQTAISD 373          
BLAST of casein kinase I isoform X3 vs. Ensembl Zebrafish
Match: csnk1g2b (casein kinase 1, gamma 2b [Source:ZFIN;Acc:ZDB-GENE-060825-285])

HSP 1 Score: 469.159 bits (1206), Expect = 2.520e-162
Identity = 232/380 (61.05%), Postives = 285/380 (75.00%), Query Frame = 1
Query:   91 DSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKIL-NSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLS---QDTKITAFTDTTNQTRRSSQ-----RNQSFVHELVTPAMPKEDKIIYETDVSIGCCGKCFGRKKQ 1203
            +S  ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L NSEG+    P+VF+FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R E++H   LIYRDVKPENFL+GR   K+ +TI +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E PDY YL+ LF+ +  RN +  D+++DW+ K   T      +   Q ++  A   T NQ   S+       + +  H       P E ++  +T     CC  CF ++++
Sbjct:   33 NSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGNSEGV----PQVFYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEFVHTRSLIYRDVKPENFLMGRPGSKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRLDFFERPDYEYLRKLFTDLFDRNGFVFDFEYDWVGKPLPTPIGPIPTDTPQPSRDKAQPQTKNQVMSSTNGELNTDDPTAGHSNAPITAPAEVEVADDTK----CC--CFFKRRK 402          
BLAST of casein kinase I isoform X3 vs. Ensembl Zebrafish
Match: csnk1g2a (casein kinase 1, gamma 2a [Source:ZFIN;Acc:ZDB-GENE-030131-6445])

HSP 1 Score: 469.159 bits (1206), Expect = 3.366e-162
Identity = 237/401 (59.10%), Postives = 291/401 (72.57%), Query Frame = 1
Query:   31 KTSGSTMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKT-----SSSATLSQDTKITAFTDTTNQTRRSSQ-----RNQSFVHELVTPAMPKEDKIIYETDVSIGCCGKCFGRKKQ 1203
            KT GS   +  S  S +++G    ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L   G  +G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R E++H   LIYRDVKPENFLVGR   K+ +TI +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE   PEM +YLRYVR+LDF+E PDY YL+ LF+ +  RN +  D+++DW+ K   T      S   L    +  A   T NQ   S+       + +  H       P E ++  +T     CC  CF ++++
Sbjct:   23 KTGGSRTGHGGSRGSGNNTG---VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQL---GNAEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEFVHTRSLIYRDVKPENFLVGRPGTKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESF-PEMATYLRYVRRLDFFERPDYEYLRKLFTDLFDRNGYVFDYEYDWVGKPLPTPIGPMPSDTPLQPSNRDKAQPQTKNQVMSSTNGEVNTDDPTAGHSNAPITAPAEVEVADDTK----CC--CFFKRRK 410          
BLAST of casein kinase I isoform X3 vs. Ensembl Zebrafish
Match: csnk1g2a (casein kinase 1, gamma 2a [Source:ZFIN;Acc:ZDB-GENE-030131-6445])

HSP 1 Score: 469.159 bits (1206), Expect = 3.366e-162
Identity = 237/401 (59.10%), Postives = 291/401 (72.57%), Query Frame = 1
Query:   31 KTSGSTMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKT-----SSSATLSQDTKITAFTDTTNQTRRSSQ-----RNQSFVHELVTPAMPKEDKIIYETDVSIGCCGKCFGRKKQ 1203
            KT GS   +  S  S +++G    ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L   G  +G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R E++H   LIYRDVKPENFLVGR   K+ +TI +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE   PEM +YLRYVR+LDF+E PDY YL+ LF+ +  RN +  D+++DW+ K   T      S   L    +  A   T NQ   S+       + +  H       P E ++  +T     CC  CF ++++
Sbjct:   23 KTGGSRTGHGGSRGSGNNTG---VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQL---GNAEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEFVHTRSLIYRDVKPENFLVGRPGTKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESF-PEMATYLRYVRRLDFFERPDYEYLRKLFTDLFDRNGYVFDYEYDWVGKPLPTPIGPMPSDTPLQPSNRDKAQPQTKNQVMSSTNGEVNTDDPTAGHSNAPITAPAEVEVADDTK----CC--CFFKRRK 410          
BLAST of casein kinase I isoform X3 vs. Ensembl Xenopus
Match: sap30 (Sin3A associated protein 30kDa [Source:Xenbase;Acc:XB-GENE-942260])

HSP 1 Score: 469.929 bits (1208), Expect = 4.595e-162
Identity = 218/307 (71.01%), Postives = 255/307 (83.06%), Query Frame = 1
Query:   82 SSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKT 1002
             S +S  ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEPMK+R+PQLHLEY+FYK L S    DG P+V++FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R EY+H+  LIYRDVKPENFL+GR   K    I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  R  +  D+++DWI K   T
Sbjct:   32 GSSNSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSG---DGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKNQQIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPT 335          
BLAST of casein kinase I isoform X3 vs. Ensembl Xenopus
Match: sap30 (Sin3A associated protein 30kDa [Source:Xenbase;Acc:XB-GENE-942260])

HSP 1 Score: 468.774 bits (1205), Expect = 5.747e-162
Identity = 231/388 (59.54%), Postives = 282/388 (72.68%), Query Frame = 1
Query:   82 SSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTS-----SSATLSQDTKITAFTDTTNQTRRS---------SQRNQSFVHELVTPAMPKEDKIIYETDVSIGCCGKCFGRKKQ 1203
             S +S  ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEPMK+R+PQLHLEY+FYK L S    DG P+V++FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R EY+H+  LIYRDVKPENFL+GR   K    I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  R  +  D+++DWI K   T      +   LS + +     D   Q +           +  + +  H       P E +++ ET     CC  CF ++++
Sbjct:   30 GSSNSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSG---DGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKNQQIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGPIHADPALSSNREAHQHRDKMQQAKNQVVSSTNGELNTDDPTAGHSNAPITAPAEVEVLDETK----CC--CFFKRRK 408          
BLAST of casein kinase I isoform X3 vs. Ensembl Xenopus
Match: sap30 (Sin3A associated protein 30kDa [Source:Xenbase;Acc:XB-GENE-942260])

HSP 1 Score: 468.389 bits (1204), Expect = 1.047e-161
Identity = 218/307 (71.01%), Postives = 255/307 (83.06%), Query Frame = 1
Query:   82 SSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKT 1002
             S +S  ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEPMK+R+PQLHLEY+FYK L S    DG P+V++FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R EY+H+  LIYRDVKPENFL+GR   K    I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  R  +  D+++DWI K   T
Sbjct:   30 GSSNSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSG---DGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKNQQIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPT 333          
BLAST of casein kinase I isoform X3 vs. Ensembl Xenopus
Match: sap30 (Sin3A associated protein 30kDa [Source:Xenbase;Acc:XB-GENE-942260])

HSP 1 Score: 468.774 bits (1205), Expect = 1.082e-161
Identity = 218/307 (71.01%), Postives = 255/307 (83.06%), Query Frame = 1
Query:   82 SSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKT 1002
             S +S  ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEPMK+R+PQLHLEY+FYK L S    DG P+V++FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R EY+H+  LIYRDVKPENFL+GR   K    I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  R  +  D+++DWI K   T
Sbjct:   30 GSSNSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSG---DGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKNQQIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPT 333          
BLAST of casein kinase I isoform X3 vs. Ensembl Xenopus
Match: sap30 (Sin3A associated protein 30kDa [Source:Xenbase;Acc:XB-GENE-942260])

HSP 1 Score: 468.774 bits (1205), Expect = 1.490e-161
Identity = 224/342 (65.50%), Postives = 269/342 (78.65%), Query Frame = 1
Query:   82 SSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQ-RNQSFVH 1104
             S +S  ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEPMK+R+PQLHLEY+FYK L S    DG P+V++FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R EY+H+  LIYRDVKPENFL+GR   K    I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  R  +  D+++DWI K Q  +    +  D  +++  +      +  Q +NQS  H
Sbjct:   30 GSSNSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSG---DGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKNQQIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGK-QLPTPVGPIHADPALSSNREAHQHRDKMQQAKNQSADH 367          
BLAST of casein kinase I isoform X3 vs. Ensembl Mouse
Match: Csnk1g1 (casein kinase 1, gamma 1 [Source:MGI Symbol;Acc:MGI:2660884])

HSP 1 Score: 474.167 bits (1219), Expect = 3.703e-164
Identity = 227/359 (63.23%), Postives = 280/359 (77.99%), Query Frame = 1
Query:   46 TMDNRYSNMSVHS--SGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQSFVHELVT 1116
            TM  R ++ S  S  S  S  ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L S G  +G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R F++KTV MIAIQLL R EY+H+  LIYRDVKPENFL+GR+  KK + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI+ LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  R  +  D+ +DW+ +   T    ++  D+  +A T  ++  R    + Q   +++V+
Sbjct:   17 TMAQRNTHCSRPSGTSTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAG--EGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYVDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDWVGRPIPT-PVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVS 372          
BLAST of casein kinase I isoform X3 vs. Ensembl Mouse
Match: Csnk1g1 (casein kinase 1, gamma 1 [Source:MGI Symbol;Acc:MGI:2660884])

HSP 1 Score: 473.396 bits (1217), Expect = 1.233e-163
Identity = 227/359 (63.23%), Postives = 280/359 (77.99%), Query Frame = 1
Query:   46 TMDNRYSNMSVHS--SGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQSFVHELVT 1116
            TM  R ++ S  S  S  S  ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L S G  +G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R F++KTV MIAIQLL R EY+H+  LIYRDVKPENFL+GR+  KK + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI+ LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  R  +  D+ +DW+ +   T    ++  D+  +A T  ++  R    + Q   +++V+
Sbjct:   17 TMAQRNTHCSRPSGTSTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAG--EGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYVDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDWVGRPIPT-PVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVS 372          
BLAST of casein kinase I isoform X3 vs. Ensembl Mouse
Match: Csnk1g1 (casein kinase 1, gamma 1 [Source:MGI Symbol;Acc:MGI:2660884])

HSP 1 Score: 473.011 bits (1216), Expect = 1.388e-163
Identity = 227/359 (63.23%), Postives = 280/359 (77.99%), Query Frame = 1
Query:   46 TMDNRYSNMSVHS--SGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQSFVHELVT 1116
            TM  R ++ S  S  S  S  ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L S G  +G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R F++KTV MIAIQLL R EY+H+  LIYRDVKPENFL+GR+  KK + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI+ LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  R  +  D+ +DW+ +   T    ++  D+  +A T  ++  R    + Q   +++V+
Sbjct:   17 TMAQRNTHCSRPSGTSTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAG--EGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYVDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDWVGRPIPT-PVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVS 372          
BLAST of casein kinase I isoform X3 vs. Ensembl Mouse
Match: Csnk1g1 (casein kinase 1, gamma 1 [Source:MGI Symbol;Acc:MGI:2660884])

HSP 1 Score: 470.7 bits (1210), Expect = 2.910e-163
Identity = 231/356 (64.89%), Postives = 279/356 (78.37%), Query Frame = 1
Query:   46 TMDNRYSNMSVHS--SGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTR-RSSQ----RNQ 1092
            TM  R ++ S  S  S  S  ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L S G  +G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R F++KTV MIAIQLL R EY+H+  LIYRDVKPENFL+GR+  KK + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI+ LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  R  +  D+ +DW+ +   T    ++  D+  +A T  ++  R R SQ    RNQ
Sbjct:   17 TMAQRNTHCSRPSGTSTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAG--EGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYVDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDWVGRPIPT-PVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQ 369          
BLAST of casein kinase I isoform X3 vs. Ensembl Mouse
Match: Csnk1g2 (casein kinase 1, gamma 2 [Source:MGI Symbol;Acc:MGI:1920014])

HSP 1 Score: 471.855 bits (1213), Expect = 2.983e-163
Identity = 241/400 (60.25%), Postives = 296/400 (74.00%), Query Frame = 1
Query:   64 SNMSVHSSGDSSFVI-VGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDT------KITAFTDTTNQTRRSSQ-----RNQSFVHELVTPAMPKEDKIIYETDVSIGCCGKCF--GRKKQNLYKNQ 1221
            SN  V SSG SS V+ VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L++    +G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R F++KTV MIAIQL+ R EY+H   LIYRDVKPENFLVGR   K+ ++I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  R+ +  D+++DW  K   T    T+  D       +  A   T NQ   S+       + +  H     A P E ++  ET     CC  CF   RK+++L +++
Sbjct:   26 SNHGVRSSGTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLST---TEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGSKRQHSIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRSGYVFDYEYDWAGKPLPT-PIGTVHPDVPSQPPHRDKAQLHTKNQALNSTNGELNTDDPTAGHSNAPIAAPAEVEVADETK----CC--CFFKRRKRKSLQRHK 415          
BLAST of casein kinase I isoform X3 vs. UniProt/SwissProt
Match: sp|Q62761|KC1G1_RAT (Casein kinase I isoform gamma-1 OS=Rattus norvegicus OX=10116 GN=Csnk1g1 PE=2 SV=1)

HSP 1 Score: 473.781 bits (1218), Expect = 1.396e-163
Identity = 232/356 (65.17%), Postives = 281/356 (78.93%), Query Frame = 1
Query:   46 TMDNRYSNMSVHS--SGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTR-RSSQ----RNQ 1092
            TM  R ++ S  S  S  S  ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L S G  +G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R F++KTV MIAIQLL R EY+H+  LIYRDVKPENFL+GR+  KK + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKRSTPI+ LCE  P EM++YLRYVR+LDF+E+PDY YL++LF+ +  R  +  D+ +DW+ +   T    ++  D+  +A T  ++  R R SQ    RNQ
Sbjct:   17 TMAQRNTHCSRPSGTSTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAG--EGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRSTPIEALCENFPEEMMTYLRYVRRLDFFEKPDYEYLRNLFTDLFERKGYTFDYAYDWVGRPIPT-PVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQ 369          
BLAST of casein kinase I isoform X3 vs. UniProt/SwissProt
Match: sp|Q5PRD4|KC1G1_DANRE (Casein kinase I isoform gamma-1 OS=Danio rerio OX=7955 GN=csnk1g1 PE=2 SV=1)

HSP 1 Score: 473.781 bits (1218), Expect = 4.553e-163
Identity = 221/338 (65.38%), Postives = 275/338 (81.36%), Query Frame = 1
Query:  103 VIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQSFVHELVT 1116
            ++VGPNF+VGKKIG GNFGEL+LGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L   G  DG P+VF+FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R EY+H+  LIYRDVKPENFL+GR+  KK + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL++LF+++  R  +  D+ +DW+ + Q  +   T+  D+  +A T  ++  R    ++Q   +++V+
Sbjct:   38 LMVGPNFRVGKKIGCGNFGELKLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKTL---GSADGLPQVFYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRNLFTELFDRKGYAFDYSYDWVGR-QIPTPVGTVHVDSGASAITRESHAHRDRPSQHQPLRNQVVS 371          
BLAST of casein kinase I isoform X3 vs. UniProt/SwissProt
Match: sp|Q8BVP5|KC1G2_MOUSE (Casein kinase I isoform gamma-2 OS=Mus musculus OX=10090 GN=Csnk1g2 PE=1 SV=1)

HSP 1 Score: 471.855 bits (1213), Expect = 2.087e-162
Identity = 241/400 (60.25%), Postives = 296/400 (74.00%), Query Frame = 1
Query:   64 SNMSVHSSGDSSFVI-VGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDT------KITAFTDTTNQTRRSSQ-----RNQSFVHELVTPAMPKEDKIIYETDVSIGCCGKCF--GRKKQNLYKNQ 1221
            SN  V SSG SS V+ VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L++    +G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R F++KTV MIAIQL+ R EY+H   LIYRDVKPENFLVGR   K+ ++I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  R+ +  D+++DW  K   T    T+  D       +  A   T NQ   S+       + +  H     A P E ++  ET     CC  CF   RK+++L +++
Sbjct:   26 SNHGVRSSGTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLST---TEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGSKRQHSIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRSGYVFDYEYDWAGKPLPT-PIGTVHPDVPSQPPHRDKAQLHTKNQALNSTNGELNTDDPTAGHSNAPIAAPAEVEVADETK----CC--CFFKRRKRKSLQRHK 415          
BLAST of casein kinase I isoform X3 vs. UniProt/SwissProt
Match: sp|A7E3X2|KC1G1_BOVIN (Casein kinase I isoform gamma-1 OS=Bos taurus OX=9913 GN=CSNK1G1 PE=2 SV=1)

HSP 1 Score: 473.396 bits (1217), Expect = 2.162e-162
Identity = 232/358 (64.80%), Postives = 280/358 (78.21%), Query Frame = 1
Query:   49 MDNRYSNMSVHSSGDSSFVI-VGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTR-RSSQ---RNQSFVHE 1107
            M  R  + S  S   SS V+ VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L S G  +G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R F++KTV MIAIQLL R EY+H+  LIYRDVKPENFL+GR+  KK + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  R  +  D+ +DW+ +   T    ++  D+  +A T  ++  R R SQ   RNQ+   E
Sbjct:   18 MAQRREHCSRPSGSTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAG--EGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDWVGRPIPT-PVGSVHVDSGASAITRESHTHRDRPSQQPLRNQTASSE 372          
BLAST of casein kinase I isoform X3 vs. UniProt/SwissProt
Match: sp|Q8BTH8|KC1G1_MOUSE (Casein kinase I isoform gamma-1 OS=Mus musculus OX=10090 GN=Csnk1g1 PE=1 SV=2)

HSP 1 Score: 473.011 bits (1216), Expect = 3.209e-162
Identity = 232/361 (64.27%), Postives = 281/361 (77.84%), Query Frame = 1
Query:   46 TMDNRYSNMSVHS--SGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTR-RSSQ----RNQSFVHE 1107
            TM  R ++ S  S  S  S  ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L S G  +G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R F++KTV MIAIQLL R EY+H+  LIYRDVKPENFL+GR+  KK + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI+ LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  R  +  D+ +DW+ +   T    ++  D+  +A T  ++  R R SQ    RNQ+   E
Sbjct:   17 TMAQRNTHCSRPSGTSTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAG--EGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYVDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDWVGRPIPT-PVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQTTSSE 374          
BLAST of casein kinase I isoform X3 vs. TrEMBL
Match: A0A267E962 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011973g1 PE=3 SV=1)

HSP 1 Score: 506.138 bits (1302), Expect = 5.406e-173
Identity = 228/350 (65.14%), Postives = 285/350 (81.43%), Query Frame = 1
Query:   31 KTSGSTMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSS 1080
            + S     NR+SN    +S + +F++VGPNFKVGKKIGSGNFGELRLGKN+YNNEHVA+KLEP+K+R+PQLHLE++FY  L   G  +G P++F+FG  ++YNALVMELLGPSLEDLFD C+R FS+KTV MIA+QLL R EY+H+HRLIYRD+KPENFL+GR++ ++ + I +IDFGLAKEY D +T  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA++LKERYQKIGDTKR+TPI++LCEG P E+ SYLRYVR LDFY++PDYA+L+ LF++++ +N W CDW FDW+ + ++T +  +   D    A    + Q   SS
Sbjct:   19 RASSGASANRHSNAPGGASRNEAFLMVGPNFKVGKKIGSGNFGELRLGKNIYNNEHVAVKLEPLKSRAPQLHLEFRFYSEL---GTSEGIPQIFYFGPTHKYNALVMELLGPSLEDLFDICDRHFSLKTVLMIAVQLLHRIEYVHSHRLIYRDIKPENFLIGRQTTRRQHIIHIIDFGLAKEYIDKDTGKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADNLKERYQKIGDTKRATPIEVLCEGFPEELASYLRYVRGLDFYQDPDYAFLRSLFTELMAKNGWSCDWDFDWLSRQEQTGTPVSGGADADAKARHGPSTQKVISS 365          
BLAST of casein kinase I isoform X3 vs. TrEMBL
Match: A0A267EHJ6 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011530g1 PE=3 SV=1)

HSP 1 Score: 504.982 bits (1299), Expect = 1.697e-172
Identity = 229/349 (65.62%), Postives = 288/349 (82.52%), Query Frame = 1
Query:   34 TSGSTMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSS 1080
            +SG++  NR+SN    +S + +F++VGPNFKVGKKIGSGNFGELRLGKN+YNNEHVA+KLEP+K+R+PQLHLE++FY  L   G  +G P++F+FG  ++YNALVMELLGPSLEDLFD C+R FS+KTV MIA+QLL R EY+H+HRLIYRD+KPENFL+GR++ ++ + I +IDFGLAKEY D +T  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA++LKERYQKIGDTKR+TPI++LCEG P E+ SYLRYVR LDFY++PDYA+L+ LF++++ +N W CDW FDW+ + ++T +  +   D    A    + Q   SS
Sbjct:   21 SSGASA-NRHSNAPGGASRNEAFLMVGPNFKVGKKIGSGNFGELRLGKNIYNNEHVAVKLEPLKSRAPQLHLEFRFYSEL---GTSEGIPQIFYFGPTHKYNALVMELLGPSLEDLFDICDRHFSLKTVLMIAVQLLHRIEYVHSHRLIYRDIKPENFLIGRQTTRRQHIIHIIDFGLAKEYIDKDTGKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADNLKERYQKIGDTKRATPIEVLCEGFPEELASYLRYVRGLDFYQDPDYAFLRSLFTELMAKNGWSCDWDFDWLSRQEQTGTPVSGGADADAKARHGPSTQKVISS 365          
BLAST of casein kinase I isoform X3 vs. TrEMBL
Match: A0A1I8FVU8 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 505.368 bits (1300), Expect = 2.674e-172
Identity = 230/354 (64.97%), Postives = 292/354 (82.49%), Query Frame = 1
Query:   34 TSGSTMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQS 1095
            +SG++  NR+SN    +S + +F++VGPNFKVGKKIGSGNFGELRLGKN+YNNEHVA+KLEP+K+R+PQLHLE++FY  L   G  +G P++F+FG  ++YNALVMELLGPSLEDLFD C+R FS+KTV MIA+QLL R EY+H+HRLIYRD+KPENFL+GR++ ++ + I +IDFGLAKEY D +T  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA++LKERYQKIGDTKR+TPI++LCEG P E+ SYLRYVR LDFY++PDYA+L+ LF++++ +N W CDW FDW+ + ++T +  +   D    A    + Q + +S  NQ+
Sbjct:    8 SSGASA-NRHSNAPGGASRNEAFLMVGPNFKVGKKIGSGNFGELRLGKNIYNNEHVAVKLEPLKSRAPQLHLEFRFYSEL---GTSEGIPQIFYFGPTHKYNALVMELLGPSLEDLFDICDRHFSLKTVLMIAVQLLHRIEYVHSHRLIYRDIKPENFLIGRQTTRRQHIIHIIDFGLAKEYIDKDTGKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADNLKERYQKIGDTKRATPIEVLCEGFPEELASYLRYVRGLDFYQDPDYAFLRSLFTELMAKNGWSCDWDFDWLSRQEQTGTPVSGGADADAKARHGPSTQ-KLTSLNNQA 356          
BLAST of casein kinase I isoform X3 vs. TrEMBL
Match: A0A267G330 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030008g1 PE=3 SV=1)

HSP 1 Score: 503.442 bits (1295), Expect = 5.814e-172
Identity = 227/350 (64.86%), Postives = 285/350 (81.43%), Query Frame = 1
Query:   31 KTSGSTMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSS 1080
            + S     NR+SN    +S + +F++VGPNFKVGKKIGSGNFGELRLGKN+YNNEHVA+KLEP+K+R+PQLHLE++FY  L   G  +G P++F+FG  ++YNALVMELLGPSLEDLFD C+R FS+KTV MIA+QLL R EY+H+HRLIYRD+KPENFL+GR++ ++ + I +IDFGLAKEY D +T  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA++LKERYQKIGDTKR+TPI++LCEG P E+ SYLRYVR LDFY++PDYA+L+ LF++++ +N W C+W FDW+ + ++T +  +   D    A    + Q   SS
Sbjct:   19 RPSSGASANRHSNAPGGASRNEAFLMVGPNFKVGKKIGSGNFGELRLGKNIYNNEHVAVKLEPLKSRAPQLHLEFRFYSEL---GTSEGIPQIFYFGPTHKYNALVMELLGPSLEDLFDICDRHFSLKTVLMIAVQLLHRIEYVHSHRLIYRDIKPENFLIGRQTTRRQHIIHIIDFGLAKEYIDKDTGKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADNLKERYQKIGDTKRATPIEVLCEGFPEELASYLRYVRGLDFYQDPDYAFLRSLFTELMAKNGWSCEWDFDWLSRQEQTGTPVSGGADADAKARHGPSTQKVISS 365          
BLAST of casein kinase I isoform X3 vs. TrEMBL
Match: A0A1S3HI09 (casein kinase I isoform X3 OS=Lingula unguis OX=7574 GN=LOC106155054 PE=3 SV=1)

HSP 1 Score: 501.901 bits (1291), Expect = 1.240e-171
Identity = 242/396 (61.11%), Postives = 299/396 (75.51%), Query Frame = 1
Query:   31 KTSGSTMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQ--SFVHELVTPAMP----KEDKIIYETDVSI----GCCGKCF 1188
            + S ++    +SN +  SS  S  ++VGPNF+VGKKIG GNFGELRLGKNLYNNEHVAIKLEPMK+R+PQLHLEY+FYK L   G  +G P+V++FG C +YNALV+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R EY+H+  LIYRDVKPENFL+GR+S KK + I++IDFGLAKEY DPET+ HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P E+ +YLRYVR+LDF+E PDY YL+ LF+ ++ +  WECDW+FDW  +   T S +  + +   +   D   + R ++Q N+  S  +  + P  P        I  + +V +     CCG CF
Sbjct:   19 RVSKASARGMHSNRT--SSSGSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKLEPMKSRAPQLHLEYRFYKQL---GQSEGVPQVYYFGPCGKYNALVLELLGPSLEDLFDLCDRKFSLKTVLMIAIQLVTRMEYVHSKHLIYRDVKPENFLIGRQSAKKQHIIYIIDFGLAKEYIDPETHKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEELATYLRYVRRLDFFETPDYDYLRKLFTDLMAKKGWECDWEFDWTGRQLSTPSGSIHTTEGATSPNRDGEGRVRHNTQTNKVVSSTNGELAPDDPTAGHSNTPITAQAEVEVVDETKCCG-CF 408          
BLAST of casein kinase I isoform X3 vs. Ensembl Cavefish
Match: CSNK1G1 (casein kinase I-like [Source:NCBI gene;Acc:103043194])

HSP 1 Score: 478.789 bits (1231), Expect = 6.433e-166
Identity = 222/344 (64.53%), Postives = 278/344 (80.81%), Query Frame = 1
Query:   85 SGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQSFVHELVT 1116
            SG S  ++VGPNF+VGKKIG GNFGEL+LGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L S   ++G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R EY+H+  LIYRDVKPENFL+GR+  KK + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+++  R  +  D+ +DW+ + Q  +   ++  D+  +A T  T+  R    ++Q   +++V+
Sbjct:   29 SGSSGVLMVGPNFRVGKKIGCGNFGELKLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKTLGS--TVEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGSKKEHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTELFERKGYTFDYTYDWVGR-QIPTPVGSVPVDSGASAITRDTHTNRDRPSQHQPLRNQVVS 369          
BLAST of casein kinase I isoform X3 vs. Ensembl Cavefish
Match: CSNK1G1 (casein kinase I-like [Source:NCBI gene;Acc:103043194])

HSP 1 Score: 478.404 bits (1230), Expect = 1.997e-165
Identity = 227/346 (65.61%), Postives = 278/346 (80.35%), Query Frame = 1
Query:   85 SGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTR-RSSQ----RNQSFVHE 1107
            SG S  ++VGPNF+VGKKIG GNFGEL+LGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L S   ++G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R EY+H+  LIYRDVKPENFL+GR+  KK + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+++  R  +  D+ +DW+ + Q  +   ++  D+  +A T  T+  R R SQ    RNQ+   E
Sbjct:   29 SGSSGVLMVGPNFRVGKKIGCGNFGELKLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKTLGS--TVEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGSKKEHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTELFERKGYTFDYTYDWVGR-QIPTPVGSVPVDSGASAITRDTHTNRDRPSQHQPLRNQTASSE 371          
BLAST of casein kinase I isoform X3 vs. Ensembl Cavefish
Match: CSNK1G1 (casein kinase I-like [Source:NCBI gene;Acc:103043194])

HSP 1 Score: 478.404 bits (1230), Expect = 1.997e-165
Identity = 227/346 (65.61%), Postives = 278/346 (80.35%), Query Frame = 1
Query:   85 SGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTR-RSSQ----RNQSFVHE 1107
            SG S  ++VGPNF+VGKKIG GNFGEL+LGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L S   ++G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R EY+H+  LIYRDVKPENFL+GR+  KK + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+++  R  +  D+ +DW+ + Q  +   ++  D+  +A T  T+  R R SQ    RNQ+   E
Sbjct:   29 SGSSGVLMVGPNFRVGKKIGCGNFGELKLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKTLGS--TVEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGSKKEHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTELFERKGYTFDYTYDWVGR-QIPTPVGSVPVDSGASAITRDTHTNRDRPSQHQPLRNQTASSE 371          
BLAST of casein kinase I isoform X3 vs. Ensembl Cavefish
Match: CSNK1G1 (casein kinase I-like [Source:NCBI gene;Acc:103043194])

HSP 1 Score: 476.478 bits (1225), Expect = 2.633e-165
Identity = 226/341 (66.28%), Postives = 276/341 (80.94%), Query Frame = 1
Query:   85 SGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTR-RSSQ----RNQ 1092
            SG S  ++VGPNF+VGKKIG GNFGEL+LGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L S   ++G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R EY+H+  LIYRDVKPENFL+GR+  KK + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+++  R  +  D+ +DW+ + Q  +   ++  D+  +A T  T+  R R SQ    RNQ
Sbjct:   29 SGSSGVLMVGPNFRVGKKIGCGNFGELKLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKTLGS--TVEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGSKKEHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTELFERKGYTFDYTYDWVGR-QIPTPVGSVPVDSGASAITRDTHTNRDRPSQHQPLRNQ 366          
BLAST of casein kinase I isoform X3 vs. Ensembl Cavefish
Match: CSNK1G1 (casein kinase I-like [Source:NCBI gene;Acc:103043194])

HSP 1 Score: 477.633 bits (1228), Expect = 6.624e-165
Identity = 227/346 (65.61%), Postives = 278/346 (80.35%), Query Frame = 1
Query:   85 SGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTR-RSSQ----RNQSFVHE 1107
            SG S  ++VGPNF+VGKKIG GNFGEL+LGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L S   ++G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R EY+H+  LIYRDVKPENFL+GR+  KK + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+++  R  +  D+ +DW+ + Q  +   ++  D+  +A T  T+  R R SQ    RNQ+   E
Sbjct:   29 SGSSGVLMVGPNFRVGKKIGCGNFGELKLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKTLGS--TVEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGSKKEHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTELFERKGYTFDYTYDWVGR-QIPTPVGSVPVDSGASAITRDTHTNRDRPSQHQPLRNQTASSE 371          
BLAST of casein kinase I isoform X3 vs. Ensembl Sea Lamprey
Match: csnk1g2a (casein kinase 1, gamma 2a [Source:ZFIN;Acc:ZDB-GENE-030131-6445])

HSP 1 Score: 468.003 bits (1203), Expect = 1.547e-162
Identity = 228/387 (58.91%), Postives = 284/387 (73.39%), Query Frame = 1
Query:  103 VIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQSFV---------------HELVTPAMPKEDKIIYETD-----VSIGCCGKCFGRKKQ 1203
            ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEPMK+R+PQLHLEY+FYK L   G  +G P+V++FG C +YNA+V+ELLGPSLEDLFD CNR F++KTV MIAIQLL R EY+H+  LIYRDVKPENFL+GR+S  K + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E PDY Y+++LF  +  R  +  D++FDW  + Q  +   ++  +T +   +   ++ R         V               H       P E +++ ET+     ++I CC  CF ++++
Sbjct:   32 LMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQL---GNAEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCNRTFTLKTVLMIAIQLLTRMEYVHSRNLIYRDVKPENFLIGRQSTNKQHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFERPDYEYMRNLFMDLFERKGYSFDYEFDWTGR-QIPTPIGSVHSETALLPVSREPHRDRTLQLARHQVVGSTNGELNPDDPTAGHSNAPITAPAEVEVMEETNNCREMLTIWCC--CFFKRRK 412          
BLAST of casein kinase I isoform X3 vs. Ensembl Sea Lamprey
Match: csnk1g1 (casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494092])

HSP 1 Score: 364.77 bits (935), Expect = 9.154e-125
Identity = 170/224 (75.89%), Postives = 194/224 (86.61%), Query Frame = 1
Query:   91 DSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLK 762
             S  ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEPMK+R+PQLHLEY+FYK L   G  +G P+V++FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIA+QL+ R EY+H+  LIYRDVKPENFLVGR+   KH+ I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLK
Sbjct:   22 SSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQL---GNAEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAMQLISRMEYVHSRSLIYRDVKPENFLVGRQGTSKHHNIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLK 242          
BLAST of casein kinase I isoform X3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008477.1 (pep scaffold:Pmarinus_7.0:GL482342:316:9736:-1 gene:ENSPMAG00000007664.1 transcript:ENSPMAT00000008477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 325.094 bits (832), Expect = 1.145e-107
Identity = 156/292 (53.42%), Postives = 216/292 (73.97%), Query Frame = 1
Query:  109 VGPNFKVGKKIGSGNFGELRL-GKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDW 981
            +G  +++G+KIGSG+FG++ L G N+   E VAIKLE +KT+ PQLH+E K YK+L   G+  G P + + G    YN +VMELLGPS+EDLF+ C+R FS+KTV ++A Q++ R EY+H+   I+RD+KP+NFL+G    KK N +++ID GLAK+Y+D  T+ HIPYRE+K+LTGTARY SINTHLG EQSRRDDLESLG++ MYF  GSLPWQGLKA   +++Y++I + K STPI++LC+ +P E  +YL + R L F ++PDY+YL+ LF  +  R  +  D+ FDW
Sbjct:    5 IGNKYRLGRKIGSGSFGDIYLVGTNIATGEEVAIKLECVKTKHPQLHIESKIYKLLQG-GV--GIPVIKWCGAEGDYNVMVMELLGPSMEDLFNFCSRKFSLKTVLLLADQMISRIEYLHSKNFIHRDIKPDNFLMGLG--KKGNLVYIIDLGLAKKYRDSRTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEMLCKTYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDW 291          
BLAST of casein kinase I isoform X3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001691.1 (pep scaffold:Pmarinus_7.0:GL476581:539457:546336:1 gene:ENSPMAG00000001522.1 transcript:ENSPMAT00000001691.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 212.231 bits (539), Expect = 4.198e-66
Identity = 110/205 (53.66%), Postives = 145/205 (70.73%), Query Frame = 1
Query:   70 MSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKH-NTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQ 681
            M+   +  S F IVG  +++ +KIGSG+FG++ L  N+ N E VA+KLE  K R PQL  E K YKIL   G+  G P + ++G    YN LVM+LLGPSLEDLF+ C+R F++KTV M+A Q++ R EY+HN   I+RD+KP+NFL+G   + +H N +F+IDFGLAK+Y+D  T  HIPYRE K+LTGTARY SIN HLG EQ
Sbjct:    1 MASAGASKSEF-IVGGKYRLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQG-GV--GIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHNKNFIHRDIKPDNFLMG---IGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQ 198          
BLAST of casein kinase I isoform X3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004926.1 (pep scaffold:Pmarinus_7.0:GL480178:196:11423:1 gene:ENSPMAG00000004461.1 transcript:ENSPMAT00000004926.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.694 bits (278), Expect = 3.536e-28
Identity = 73/226 (32.30%), Postives = 110/226 (48.67%), Query Frame = 1
Query:  319 GLCNRYNALVMELLGPSLEDLFDHCNRA-FSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKAND----LKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDW 981
            G  +++N +VM+L G +L DL     R  FS+ T   +  Q+L+  E IH    ++RD+KP NF +GR     H   F++D+GLA++Y +       P R      GT RY SIN H  KE  R DDL SL +M + F  G LPW+ +K  +    +KERY             +L    P +   +L +V  LD+   P+Y  +      I+   +   +  +DW
Sbjct:   11 GRNDKFNYVVMQLQGRNLADLRRSQPRGTFSLSTTLRLGRQMLEAIESIHAVGFLHRDIKPSNFAMGRLPSTTHK-CFMLDYGLARQYTNSSGEVRPP-RAVAGFRGTVRYASINAHRNKEMGRHDDLWSLFYMLVEFTVGQLPWRKIKDKEQVGLIKERYDH----------RLLLRHMPTDFHIFLDHVSTLDYCTRPNYQSIHSCALHIMRERSITENEPYDW 224          
BLAST of casein kinase I isoform X3 vs. Ensembl Yeast
Match: YCK1 (Palmitoylated plasma membrane-bound casein kinase I (CK1) isoform; shares redundant functions with Yck2p in morphogenesis, proper septin assembly, endocytic trafficking, and glucose sensing; stabilized by Sod1p binding in the presence of glucose and oxygen, causing glucose repression of respiratory metabolism; involved in the phosphorylation and regulation of glucose sensor Rgt2p; YCK1 has a paralog, YCK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001177])

HSP 1 Score: 332.028 bits (850), Expect = 5.974e-108
Identity = 164/294 (55.78%), Postives = 205/294 (69.73%), Query Frame = 1
Query:  103 VIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWI 984
             IVG ++K+GKKIG G+FG L  G N+ N   VAIK EP KT +PQL  EYK YKILN    I   P  ++FG    +N LV++LLGPSLEDLFD C R FSVKTV  +A+Q++   E +H H LIYRD+KP+NFL+GR      N I +IDFG+AK+Y+DP+T  HIPYRE KSL+GTARYMSINTHLG+EQSRRDD+E+LGH+F YF RG LPWQGLKA + K++Y+KIG+ KRST +  L +G P +   YL  VR L F E PDY   + L   +L       D Q+DW+
Sbjct:   63 TIVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPNI---PYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLAQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWM 353          
BLAST of casein kinase I isoform X3 vs. Ensembl Yeast
Match: YCK2 (Palmitoylated plasma membrane-bound casein kinase I (CK1) isoform; shares redundant functions with Yck1p in morphogenesis, proper septin assembly, endocytic trafficking, and glucose sensing; stabilized by Sod1p binding in the presence of glucose and oxygen, causing glucose repression of respiratory metabolism; involved in the phosphorylation and regulation of glucose sensor Rgt2p; YCK2 has a paralog, YCK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005098])

HSP 1 Score: 328.176 bits (840), Expect = 1.997e-106
Identity = 165/339 (48.67%), Postives = 221/339 (65.19%), Query Frame = 1
Query:  103 VIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQSFVHELVTP 1119
             IVG ++K+GKKIG G+FG L  G N+ N   VAIK EP KT +PQL  EY+ YKIL       G P+ ++FG    +N LV++LLGPSLEDLFD C R FSVKTV  +A+Q++   E +H H LIYRD+KP+NFL+GR      N + +IDFG+AK+Y+DP+T  HIPYRE KSL+GTARYMSINTHLG+EQSRRDD+E++GH+F YF RG LPWQGLKA + K++Y+KIG+ KR T +  L +G P +   YL  VR L F E PDY   + L   +L       D Q+DW+          ++++   +  +    N     S+R++S  H+  +P
Sbjct:   70 TIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAG---TPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDWMKLNGGRGWDLSINKKPNLHGYGH-PNPPNEKSKRHRSKNHQYSSP 404          
BLAST of casein kinase I isoform X3 vs. Ensembl Yeast
Match: HRR25 (Conserved casein kinase; regulates diverse events including: vesicular traffic, DNA repair, the CVT pathway, monopolar attachment of sister kinetochores at meiosis I, and ribosomal subunit biogenesis; monopolin subunit; binds the RNAPII CTD; phosphorylates COPII coat subunits; interacts with Sit4p phosphatase; antagonizes calcineurin signaling, reducing nuclear accumulation of Crz1p; phosphorylates Dsn1p, the kinetochore receptor for monopolin; homolog of mammalian CK1delta [Source:SGD;Acc:S000006125])

HSP 1 Score: 306.22 bits (783), Expect = 1.446e-98
Identity = 151/293 (51.54%), Postives = 209/293 (71.33%), Query Frame = 1
Query:  109 VGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWII 987
            VG  F++G+KIGSG+FG++  G NL + E VAIKLE +++R PQL  E + Y+ L S G+  G P + +FG    YNA+V++LLGPSLEDLF++C+R FS KTV M+A+Q+  R +YIH    I+RD+KP+NFL+G    ++ +T+ VIDFGL+K+Y+D  T+ HIPYRE+KSLTGTARY S+NTHLG EQSRRDDLESLG++ +YF +GSLPWQGLKA   K++Y +I + K +  ++ LC G P E   Y+ Y + L F E+PDY +L  LF  +  +  +  D  FDW +
Sbjct:    5 VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYRYL-SGGV--GIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRRFSFKTVIMLALQMFCRIQYIHGRSFIHRDIKPDNFLMGVG--RRGSTVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKKQKYDRIMEKKLNVSVETLCSGLPLEFQEYMAYCKNLKFDEKPDYLFLARLFKDLSIKLEYHNDHLFDWTM 292          
BLAST of casein kinase I isoform X3 vs. Ensembl Yeast
Match: YCK3 (Palmitoylated vacuolar membrane-localized casein kinase I isoform; negatively regulates vacuole fusion during hypertonic stress via phosphorylation of Vps41p; shares essential functions with Hrr25p; regulates vesicle fusion in AP-3 pathway [Source:SGD;Acc:S000000925])

HSP 1 Score: 306.99 bits (785), Expect = 1.883e-98
Identity = 162/332 (48.80%), Postives = 212/332 (63.86%), Query Frame = 1
Query:   94 SSFVIVGPNFKVGKKIGSGNFGELRLGKNLYN-----------------NEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGR----------------KSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRS-TPIDILCEGHPP-EMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWI 984
            SS  IVG ++ VG KIG G+FG +  G+N+ +                 NE VAIK EP  + +PQL  E++ Y+ILN  G + G P  ++FG    +N L+++LLGPSLEDLF+ C R FSVKT  M+A Q++DR   IH+H LIYRD+KP+NFL+ +                 S    N I+++DFG+AK+Y+DP T  HIPYRE KSL+GTARYMSINTH G+EQSRRDDLESLGH+F YF RGSLPWQGLKA + K +Y+KIG TK+   P D+L     P +  +YL+Y R L F E+PDY YL  L    L  N+ + D  +DW+
Sbjct:    5 SSQHIVGIHYAVGPKIGEGSFGVIFEGENILHSCQAQTGSKRDSSIIMANEPVAIKFEPRHSDAPQLRDEFRAYRILN--GCV-GIPHAYYFGQEGMHNILIIDLLGPSLEDLFEWCGRKFSVKTTCMVAKQMIDRVRAIHDHDLIYRDIKPDNFLISQYQRISPEGKVIKSCASSSNNDPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAPNNKLKYEKIGMTKQKLNPDDLLLNNAIPYQFATYLKYARSLKFDEDPDYDYLISLMDDALRLNDLKDDGHYDWM 333          
BLAST of casein kinase I isoform X3 vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 69.707 bits (169), Expect = 6.914e-13
Identity = 66/241 (27.39%), Postives = 114/241 (47.30%), Query Frame = 1
Query:  130 GKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSE----GIIDGFPKVFFFGLCNRYN--ALVME-LLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMS---INTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPI 822
            G+ IG G+FG + L  N+   E +A+K   +   S Q        + L SE      +D    V + G  N+ N  +L +E + G S+  L     R F    +  +  Q+L    Y+H+  +++RD+K +N L+ +  + K     + DFG++++ KD  +N+ +  R      GT  +M+   ++T  G   S + D+ SLG + +  F G  PW  L   ++     KIG +K + PI
Sbjct: 1178 GEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICK-----ISDFGISRKSKDIYSNSDMTMR------GTVFWMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPWSNL---EVVAAMFKIGKSKSAPPI 1401          
BLAST of casein kinase I isoform X3 vs. Ensembl Nematostella
Match: EDO34289 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPP6])

HSP 1 Score: 478.404 bits (1230), Expect = 8.533e-166
Identity = 232/362 (64.09%), Postives = 279/362 (77.07%), Query Frame = 1
Query:  103 VIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKT-----QKTSSSATLSQDT--------KITAFTDTTNQTRRSSQRNQSFVHELVTPAM--PKEDKI 1143
            ++VGPNF+VGKKIG GNFGELRLGKNLYNNEHVAIKLEPMK+R+PQLHLEY+FYK L   G  +G P+V +FG C +YNALVMELLGPSLEDLFD CNR FS+KTV M+A+QL+ R EY+H+  +IYRD+KPENFL+GRKS  K  TI +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE HP EM +YLRYVR+LDF+E PDY YL+ LF  ++ R  +  D++FDW  K         +     ++DT        +IT+ T  TN++ +  +   +  H L +P M  P  D++
Sbjct:   40 MMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKLEPMKSRAPQLHLEYRFYKAL---GNAEGIPQVHYFGPCGKYNALVMELLGPSLEDLFDLCNRQFSLKTVLMVALQLISRIEYVHSKNMIYRDIKPENFLIGRKSAGKEKTINIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENHPEEMATYLRYVRRLDFFETPDYEYLRKLFRDLMERKGYVEDFEFDWTHKQIPSPLNSVTHGGDHTKDTRNYPRTSERITS-TSGTNKSVQDRKGAWAEPHGLKSPGMLAPTADRL 397          
BLAST of casein kinase I isoform X3 vs. Ensembl Nematostella
Match: EDO34742 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNG2])

HSP 1 Score: 339.732 bits (870), Expect = 2.399e-112
Identity = 162/291 (55.67%), Postives = 217/291 (74.57%), Query Frame = 1
Query:  109 VGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDW 981
            VG  +++G+KIGSG+FG++ LG ++   E VAIKLE +KT+ PQLH+E KFYK++   G+  G P + + G    YN LVMELLGPSLEDLF+ CNR FS+KTV ++A Q + R EY+H+   I+RD+KP+NFL+G    KK N +++IDFGLAK+Y+DP T+ HIPYRE+K+LTGTARY SINTHLG EQSRRDDLESLG++ MYF  GSLPWQGLKA   +++Y++I + K STPI++LC+G P E  +YL   R L F ++PDY+YL+ LF  +  R  +  D+ FDW
Sbjct:    5 VGNKYRLGRKIGSGSFGDIYLGTSISTGEEVAIKLECVKTKHPQLHIEAKFYKMMQG-GV--GIPTIKWCGTEGDYNVLVMELLGPSLEDLFNFCNRKFSIKTVLLLADQTISRIEYVHSKNFIHRDIKPDNFLMGLG--KKGNLVYIIDFGLAKKYRDPRTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGFPSEFATYLNNCRSLRFDDKPDYSYLRQLFRNLFHRQGYTYDYVFDW 290          
BLAST of casein kinase I isoform X3 vs. Ensembl Nematostella
Match: EDO46523 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPJ6])

HSP 1 Score: 337.421 bits (864), Expect = 3.408e-112
Identity = 169/318 (53.14%), Postives = 218/318 (68.55%), Query Frame = 1
Query:   73 SVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKH-NTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLS 1023
            S   S + S   VG  +++ +KIGSG+FG++ L  N  N E VA+KLE  K R PQL  E K YKIL   G+  G P V ++G    YN LVMELLGPSLEDLF+ C+R F++KTV M+A Q++ R EY+HN   I+RD+KP+NFL+G   + KH N +F+IDFGLAK+Y+D  T  HIPYRE K+LTGTARY SIN HLG EQSRRDD+ESLG++ MYF R SLPWQGLKA   K++Y+KI + K STP+++LC+G P E   YL Y R L F E PDY YL+ LF  +    N++ D+ FDW +  QK + +   S
Sbjct:    3 SSSGSANRSEFEVGGKYRLVRKIGSGSFGDIYLAINTTNGEEVAVKLESQKARHPQLLYESKLYKILQG-GV--GIPSVRYYGQERDYNVLVMELLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHNKNFIHRDIKPDNFLMG---VGKHCNKLFLIDFGLAKKYRDSRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNYQYDYIFDWTMLKQKAAQATATS 314          
BLAST of casein kinase I isoform X3 vs. Ensembl Nematostella
Match: EDO48738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIM1])

HSP 1 Score: 319.316 bits (817), Expect = 2.603e-105
Identity = 166/337 (49.26%), Postives = 219/337 (64.99%), Query Frame = 1
Query:   82 SSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKH-NTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDT-TNQTRRSSQR 1086
            S+  S F++ G  +++ +KIGSG+FG++ L  +  N E  A+KLE  K R PQL  E K YKIL       G P +  F   N YN LVM+LLGPSLEDLF+ CNR F++KTV M+A Q++ R EY+HN   I+RD+KP+NFL+G   + +H N +++IDFGLAK+Y+D  T  HI YRE K+LTGTARY SIN HLG EQSRRDD+ESLG++ MYF R +LPWQGLKA   K++Y+KI + K STP+++LC+G P E   YL Y + L F E PDY YL+ LF  +    N + D+ FDW    QK+     +      T  T   T Q RR + R
Sbjct:    2 STPKSEFIVQG-KYRLVRKIGSGSFGDIYLCVHTENGEEKAVKLESQKARHPQLLYESKLYKILAGG---SGIPAIRHFSQENDYNVLVMDLLGPSLEDLFNFCNRKFNMKTVLMLADQMIARIEYVHNKNFIHRDIKPDNFLMG---IGRHCNKLYLIDFGLAKKYRDSRTKQHISYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRSNLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFSMYLNYCKGLRFEEAPDYMYLRQLFRILFRTLNHQYDYIFDWTTLKQKSGCQGAVPGTAVATPGTAPHTAQYRRETSR 331          
BLAST of casein kinase I isoform X3 vs. Ensembl Nematostella
Match: EDO46789 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP40])

HSP 1 Score: 128.257 bits (321), Expect = 3.658e-33
Identity = 85/278 (30.58%), Postives = 134/278 (48.20%), Query Frame = 1
Query:  154 FGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLF-DHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHI-PYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDW 981
            FGE+  G +    ++VAIKLE +      L +E    K L     +D   K    G    +N LVM L G +L +L        FS  T+  +  Q+L   + IH    ++RD+KP NF +G      H   +++DFGL++++   + N  + P R      GT RY SIN H  KE  R DDL S  ++ + F  G LPW+ +K        +++G  K++  I  L +  P E   ++ ++ KL + ++PDY  L  L  +I+ R   +    +DW
Sbjct:   26 FGEIYRGLDQVTKDYVAIKLESVHQSKQVLKMEVAVLKKLQG---VDHICKFISCGRNESFNYLVMSLQGSNLAELRRSQPKGVFSHSTMLRLGTQILKSVKSIHEAGFLHRDIKPSNFAMGNTPDTVH-ICYMLDFGLSRQF--TKANGEVRPPRNTAGFRGTVRYASINAHENKEMGRHDDLWSFFYLMVEFTVGQLPWRKMKDK------EQVGKMKKTYDIANLLKSMPGEFKQFVDHISKLKYEDKPDYKMLLGLLEQIIKRKGIKESDPYDW 291          
BLAST of casein kinase I isoform X3 vs. Ensembl Medaka
Match: csnk1g2b (casein kinase I [Source:NCBI gene;Acc:101172235])

HSP 1 Score: 475.707 bits (1223), Expect = 4.731e-165
Identity = 241/400 (60.25%), Postives = 292/400 (73.00%), Query Frame = 1
Query:   31 KTSGSTMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKIL-NSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLS---QDTKITAFTDTTNQTRRSSQ-----RNQSFVHELVTPAMPKEDKIIYETDVSIGCCGKCFGRKKQ 1203
            KT+GS    R S        +S  ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L NSEGI    P+V++FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R EY+H   LIYRDVKPENFLVGR   K+ +TI +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCEG P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  R+    D+++DW+ K+  T      S   Q  +      T NQ   S+       + +  H       P E ++  ET     CC  CF ++++
Sbjct:   20 KTTGSRTGGRSSGT------NSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGNSEGI----PQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGSKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCEGFPEEMATYLRYVRRLDFFEKPDYEYLRKLFTDLFDRSGHVFDYEYDWVGKSLPTPIGQIPSDTPQPPRDKTSHPTKNQVMSSTNGELNTDDPTAGHSNAPITAPTEVEVAEETK----CC--CFFKRRK 403          
BLAST of casein kinase I isoform X3 vs. Ensembl Medaka
Match: csnk1g2b (casein kinase I [Source:NCBI gene;Acc:101172235])

HSP 1 Score: 476.478 bits (1225), Expect = 8.011e-165
Identity = 231/351 (65.81%), Postives = 276/351 (78.63%), Query Frame = 1
Query:   31 KTSGSTMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKIL-NSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSS 1080
            KT+GS    R S        +S  ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L NSEGI    P+V++FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R EY+H   LIYRDVKPENFLVGR   K+ +TI +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCEG P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  R+    D+++DW+ K+  T     +  DT       T++ T+  S
Sbjct:   20 KTTGSRTGGRSSGT------NSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGNSEGI----PQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGSKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCEGFPEEMATYLRYVRRLDFFEKPDYEYLRKLFTDLFDRSGHVFDYEYDWVGKSLPT-PIGQIPSDTPQPPRDKTSHPTKNQS 359          
BLAST of casein kinase I isoform X3 vs. Ensembl Medaka
Match: CSNK1G2 (casein kinase I [Source:NCBI gene;Acc:101160101])

HSP 1 Score: 471.47 bits (1212), Expect = 2.984e-163
Identity = 232/389 (59.64%), Postives = 284/389 (73.01%), Query Frame = 1
Query:   49 MDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATL--SQDTKITAFTDTTNQTRRSSQRNQSFVHELVT--PAMPKEDKIIYETDVSIGCCGKCFGRKKQ 1203
            M  +YS     S  +S  ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L S    +G P+VF+FG C +YNA+V+ELLGPSLEDLFD C R FS+KTV MIAIQL+ R E++H   LIYRDVKPENFLVGR   K+ +TI +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  RN +  D+Q+DW  K   +     L  S +  + + +++ + T  SS   +    +        P    +  E      CC  CF ++++
Sbjct:   25 MSGKYSGRGAGS--NSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKQLGSS---EGIPQVFYFGPCGKYNAMVLELLGPSLEDLFDLCERTFSLKTVLMIAIQLITRMEFVHTRSLIYRDVKPENFLVGRPGSKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRDTPIEVLCESFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRNGYVFDFQYDWTGKPLVSMGEGRLLASAEASMHSHSESPSGTVMSSTNGELNTDDPTAGHSNAPIAANVEVEVADDTKCC--CFFKRRK 406          
BLAST of casein kinase I isoform X3 vs. Ensembl Medaka
Match: CSNK1G2 (casein kinase I [Source:NCBI gene;Acc:101160101])

HSP 1 Score: 471.47 bits (1212), Expect = 3.193e-163
Identity = 222/318 (69.81%), Postives = 259/318 (81.45%), Query Frame = 1
Query:   49 MDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKT 1002
            M  +YS     S  +S  ++VGPNF+VGKKIG GNFGELRLGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L S    +G P+VF+FG C +YNA+V+ELLGPSLEDLFD C R FS+KTV MIAIQL+ R E++H   LIYRDVKPENFLVGR   K+ +TI +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+ +  RN +  D+Q+DW  K   T
Sbjct:   25 MSGKYSGRGAGS--NSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKQLGSS---EGIPQVFYFGPCGKYNAMVLELLGPSLEDLFDLCERTFSLKTVLMIAIQLITRMEFVHTRSLIYRDVKPENFLVGRPGSKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRDTPIEVLCESFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRNGYVFDFQYDWTGKPLPT 337          
BLAST of casein kinase I isoform X3 vs. Ensembl Medaka
Match: csnk1g1 (casein kinase 1 gamma 1 [Source:NCBI gene;Acc:101164710])

HSP 1 Score: 468.389 bits (1204), Expect = 2.509e-161
Identity = 223/340 (65.59%), Postives = 274/340 (80.59%), Query Frame = 1
Query:  103 VIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTR-RSSQ----RNQSFVHE 1107
            ++VGPNF+VGKKIG GNFGEL+LGKNLY NE+VAIKLEP+K+R+PQLHLEY+FYK L   G  +G P+VF+FG C +YNA+V+ELLGPSLEDLFD C+R FS+KTV MIAIQL+ R EY+H+  LIYRDVKPENFL+GR+  KK + I +IDFGLAKEY DPET  HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMFMYF RGSLPWQGLKA+ LKERYQKIGDTKR+TPI++LCE  P EM +YLRYVR+LDF+E+PDY YL+ LF+++  R  +  D+ +DW+ + Q  +   ++  D+  +  T  ++  R R SQ    RNQ+ V +
Sbjct:   45 LMVGPNFRVGKKIGCGNFGELKLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKTL---GTSEGVPQVFYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYEYLRALFTELFERKGYTFDYTYDWVGR-QIPTPVGSVHIDSGASGVTRESHAHRDRPSQHPPIRNQTAVSD 380          
BLAST of casein kinase I isoform X3 vs. Planmine SMEST
Match: SMESG000020005.1 (SMESG000020005.1)

HSP 1 Score: 860.522 bits (2222), Expect = 0.000e+0
Identity = 409/410 (99.76%), Postives = 410/410 (100.00%), Query Frame = 1
Query:   19 SFSMKTSGSTMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQSFVHELVTPAMPKEDKIIYETDVSIGCCGKCFGRKKQNLYKNQYPHQNNDVR 1248
            SFSMKTSGSTMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQSFVHELVTPAMPKE+KIIYETDVSIGCCGKCFGRKKQNLYKNQYPHQNNDVR
Sbjct:   13 SFSMKTSGSTMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQSFVHELVTPAMPKEEKIIYETDVSIGCCGKCFGRKKQNLYKNQYPHQNNDVR 422          
BLAST of casein kinase I isoform X3 vs. Planmine SMEST
Match: SMESG000020005.1 (SMESG000020005.1)

HSP 1 Score: 854.358 bits (2206), Expect = 0.000e+0
Identity = 406/407 (99.75%), Postives = 407/407 (100.00%), Query Frame = 1
Query:   28 MKTSGSTMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQSFVHELVTPAMPKEDKIIYETDVSIGCCGKCFGRKKQNLYKNQYPHQNNDVR 1248
            MKTSGSTMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQSFVHELVTPAMPKE+KIIYETDVSIGCCGKCFGRKKQNLYKNQYPHQNNDVR
Sbjct:    1 MKTSGSTMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQSFVHELVTPAMPKEEKIIYETDVSIGCCGKCFGRKKQNLYKNQYPHQNNDVR 407          
BLAST of casein kinase I isoform X3 vs. Planmine SMEST
Match: SMESG000020005.1 (SMESG000020005.1)

HSP 1 Score: 839.336 bits (2167), Expect = 0.000e+0
Identity = 399/400 (99.75%), Postives = 400/400 (100.00%), Query Frame = 1
Query:   49 MDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQSFVHELVTPAMPKEDKIIYETDVSIGCCGKCFGRKKQNLYKNQYPHQNNDVR 1248
            MDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQSFVHELVTPAMPKE+KIIYETDVSIGCCGKCFGRKKQNLYKNQYPHQNNDVR
Sbjct:    1 MDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRSSQRNQSFVHELVTPAMPKEEKIIYETDVSIGCCGKCFGRKKQNLYKNQYPHQNNDVR 400          
BLAST of casein kinase I isoform X3 vs. Planmine SMEST
Match: SMESG000052702.1 (SMESG000052702.1)

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 258/345 (74.78%), Postives = 295/345 (85.51%), Query Frame = 1
Query:   43 STMDNRYSNMS-VHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEG-IIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTR 1071
            ST  NRYS  S V   GDS+F++VGPN++VGKKIG GNFGELRLGKNLY NEHVAIKLEPMKTR+PQLHLEY+FY++LNS      GFPKVF+FG C RYNALV+ELLGPSLEDLFDHCNR FS+KTV M+AIQLL+R EY+HN RLIYRDVKPENFLVGR+S  KHN I++IDFGLAKEY DP+TN HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMF+YF RGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCE  P E+ +YLRYVR+LDF+EEPDY Y++DLF  +L +NNWECDW+FDW+  T++ S++ T   D K     DT+NQ +
Sbjct:    4 STDQNRYSKSSNVPGGGDSNFLMVGPNYRVGKKIGCGNFGELRLGKNLYTNEHVAIKLEPMKTRAPQLHLEYRFYRMLNSNSNPPTGFPKVFYFGPCGRYNALVLELLGPSLEDLFDHCNRQFSLKTVLMLAIQLLERMEYVHNKRLIYRDVKPENFLVGRQSSNKHNIIYMIDFGLAKEYIDPDTNKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFLYFLRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEKFPQELATYLRYVRRLDFFEEPDYKYIRDLFYSLLKKNNWECDWEFDWL--TKQNSNTNTFLTDNK-NGLADTSNQIK 345          
BLAST of casein kinase I isoform X3 vs. Planmine SMEST
Match: SMESG000052702.1 (SMESG000052702.1)

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 258/345 (74.78%), Postives = 295/345 (85.51%), Query Frame = 1
Query:   43 STMDNRYSNMS-VHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGKNLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNS-EGIIDGFPKVFFFGLCNRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRLIYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDLFSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTR 1071
            ST  NRYS  S V   GDS+F++VGPN++VGKKIG GNFGELRLGKNLY NEHVAIKLEPMKTR+PQLHLEY+FY++LNS      GFPKVF+FG C RYNALV+ELLGPSLEDLFDHCNR FS+KTV M+AIQLL+R EY+HN RLIYRDVKPENFLVGR+S  KHN I++IDFGLAKEY DP+TN HIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE+LGHMF+YF RGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCE  P E+ +YLRYVR+LDF+EEPDY Y++DLF  +L +NNWECDW+FDW+  T++ S++ T   D K     DT+NQ +
Sbjct:    4 STDQNRYSKSSNVPGGGDSNFLMVGPNYRVGKKIGCGNFGELRLGKNLYTNEHVAIKLEPMKTRAPQLHLEYRFYRMLNSNSNPPTGFPKVFYFGPCGRYNALVLELLGPSLEDLFDHCNRQFSLKTVLMLAIQLLERMEYVHNKRLIYRDVKPENFLVGRQSSNKHNIIYMIDFGLAKEYIDPDTNKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFLYFLRGSLPWQGLKANDLKERYQKIGDTKRSTPIDILCEKFPQELATYLRYVRRLDFFEEPDYKYIRDLFYSLLKKNNWECDWEFDWL--TKQNSNTNTFLTDNK-NGLADTSNQIK 345          
The following BLAST results are available for this feature:
BLAST of casein kinase I isoform X3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CSNK1G37.227e-16359.54casein kinase 1 gamma 3 [Source:HGNC Symbol;Acc:HG... [more]
CSNK1G11.036e-16164.79casein kinase 1 gamma 1 [Source:HGNC Symbol;Acc:HG... [more]
CSNK1G22.028e-16159.15casein kinase 1 gamma 2 [Source:HGNC Symbol;Acc:HG... [more]
CSNK1G32.084e-16166.08casein kinase 1 gamma 3 [Source:HGNC Symbol;Acc:HG... [more]
CSNK1G12.153e-16166.47casein kinase 1 gamma 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of casein kinase I isoform X3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk-15.503e-15765.86Casein kinase I gamma [Source:UniProtKB/Swiss-Pro... [more]
kin-191.511e-10551.40Casein kinase I isoform alpha [Source:UniProtKB/S... [more]
kin-191.511e-10551.40Casein kinase I isoform alpha [Source:UniProtKB/S... [more]
kin-201.107e-10453.61Casein kinase I isoform delta [Source:UniProtKB/S... [more]
kin-201.107e-10453.61Casein kinase I isoform delta [Source:UniProtKB/S... [more]
back to top
BLAST of casein kinase I isoform X3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gish3.061e-16263.43gene:FBgn0250823 transcript:FBtr0083265[more]
gish5.210e-16164.88gene:FBgn0250823 transcript:FBtr0083263[more]
gish2.429e-15865.35gene:FBgn0250823 transcript:FBtr0100331[more]
gish3.122e-15762.32gene:FBgn0250823 transcript:FBtr0083262[more]
gish3.122e-15762.32gene:FBgn0250823 transcript:FBtr0083261[more]
back to top
BLAST of casein kinase I isoform X3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk1g16.031e-16465.38casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494... [more]
csnk1g14.433e-16366.18casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494... [more]
csnk1g2b2.520e-16261.05casein kinase 1, gamma 2b [Source:ZFIN;Acc:ZDB-GEN... [more]
csnk1g2a3.366e-16259.10casein kinase 1, gamma 2a [Source:ZFIN;Acc:ZDB-GEN... [more]
csnk1g2a3.366e-16259.10casein kinase 1, gamma 2a [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of casein kinase I isoform X3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sap304.595e-16271.01Sin3A associated protein 30kDa [Source:Xenbase;Acc... [more]
sap305.747e-16259.54Sin3A associated protein 30kDa [Source:Xenbase;Acc... [more]
sap301.047e-16171.01Sin3A associated protein 30kDa [Source:Xenbase;Acc... [more]
sap301.082e-16171.01Sin3A associated protein 30kDa [Source:Xenbase;Acc... [more]
sap301.490e-16165.50Sin3A associated protein 30kDa [Source:Xenbase;Acc... [more]
back to top
BLAST of casein kinase I isoform X3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Csnk1g13.703e-16463.23casein kinase 1, gamma 1 [Source:MGI Symbol;Acc:MG... [more]
Csnk1g11.233e-16363.23casein kinase 1, gamma 1 [Source:MGI Symbol;Acc:MG... [more]
Csnk1g11.388e-16363.23casein kinase 1, gamma 1 [Source:MGI Symbol;Acc:MG... [more]
Csnk1g12.910e-16364.89casein kinase 1, gamma 1 [Source:MGI Symbol;Acc:MG... [more]
Csnk1g22.983e-16360.25casein kinase 1, gamma 2 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of casein kinase I isoform X3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q62761|KC1G1_RAT1.396e-16365.17Casein kinase I isoform gamma-1 OS=Rattus norvegic... [more]
sp|Q5PRD4|KC1G1_DANRE4.553e-16365.38Casein kinase I isoform gamma-1 OS=Danio rerio OX=... [more]
sp|Q8BVP5|KC1G2_MOUSE2.087e-16260.25Casein kinase I isoform gamma-2 OS=Mus musculus OX... [more]
sp|A7E3X2|KC1G1_BOVIN2.162e-16264.80Casein kinase I isoform gamma-1 OS=Bos taurus OX=9... [more]
sp|Q8BTH8|KC1G1_MOUSE3.209e-16264.27Casein kinase I isoform gamma-1 OS=Mus musculus OX... [more]
back to top
BLAST of casein kinase I isoform X3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267E9625.406e-17365.14Protein kinase domain-containing protein (Fragment... [more]
A0A267EHJ61.697e-17265.62Protein kinase domain-containing protein (Fragment... [more]
A0A1I8FVU82.674e-17264.97Protein kinase domain-containing protein OS=Macros... [more]
A0A267G3305.814e-17264.86Protein kinase domain-containing protein (Fragment... [more]
A0A1S3HI091.240e-17161.11casein kinase I isoform X3 OS=Lingula unguis OX=75... [more]
back to top
BLAST of casein kinase I isoform X3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CSNK1G16.433e-16664.53casein kinase I-like [Source:NCBI gene;Acc:1030431... [more]
CSNK1G11.997e-16565.61casein kinase I-like [Source:NCBI gene;Acc:1030431... [more]
CSNK1G11.997e-16565.61casein kinase I-like [Source:NCBI gene;Acc:1030431... [more]
CSNK1G12.633e-16566.28casein kinase I-like [Source:NCBI gene;Acc:1030431... [more]
CSNK1G16.624e-16565.61casein kinase I-like [Source:NCBI gene;Acc:1030431... [more]
back to top
BLAST of casein kinase I isoform X3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk1g2a1.547e-16258.91casein kinase 1, gamma 2a [Source:ZFIN;Acc:ZDB-GEN... [more]
csnk1g19.154e-12575.89casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494... [more]
ENSPMAT00000008477.11.145e-10753.42pep scaffold:Pmarinus_7.0:GL482342:316:9736:-1 gen... [more]
ENSPMAT00000001691.14.198e-6653.66pep scaffold:Pmarinus_7.0:GL476581:539457:546336:1... [more]
ENSPMAT00000004926.13.536e-2832.30pep scaffold:Pmarinus_7.0:GL480178:196:11423:1 gen... [more]
back to top
BLAST of casein kinase I isoform X3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YCK15.974e-10855.78Palmitoylated plasma membrane-bound casein kinase ... [more]
YCK21.997e-10648.67Palmitoylated plasma membrane-bound casein kinase ... [more]
HRR251.446e-9851.54Conserved casein kinase; regulates diverse events ... [more]
YCK31.883e-9848.80Palmitoylated vacuolar membrane-localized casein k... [more]
BCK16.914e-1327.39MAPKKK acting in the protein kinase C signaling pa... [more]
back to top
BLAST of casein kinase I isoform X3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO342898.533e-16664.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347422.399e-11255.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465233.408e-11253.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487382.603e-10549.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467893.658e-3330.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of casein kinase I isoform X3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk1g2b4.731e-16560.25casein kinase I [Source:NCBI gene;Acc:101172235][more]
csnk1g2b8.011e-16565.81casein kinase I [Source:NCBI gene;Acc:101172235][more]
CSNK1G22.984e-16359.64casein kinase I [Source:NCBI gene;Acc:101160101][more]
CSNK1G23.193e-16369.81casein kinase I [Source:NCBI gene;Acc:101160101][more]
csnk1g12.509e-16165.59casein kinase 1 gamma 1 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of casein kinase I isoform X3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020005.10.000e+099.76SMESG000020005.1[more]
SMESG000020005.10.000e+099.75SMESG000020005.1[more]
SMESG000020005.10.000e+099.75SMESG000020005.1[more]
SMESG000052702.10.000e+074.78SMESG000052702.1[more]
SMESG000052702.10.000e+074.78SMESG000052702.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034473 ID=SMED30034473|Name=casein kinase I isoform X3|organism=Schmidtea mediterranea sexual|type=transcript|length=1665bp
TATATAAATCTTATATGATCCTTTTCCATGAAAACATCTGGATCTACAAT
GGACAATAGATATTCAAATATGTCAGTACATTCTAGTGGAGATTCAAGTT
TTGTTATTGTTGGTCCAAATTTTAAAGTCGGTAAAAAGATTGGATCAGGA
AATTTCGGTGAATTAAGATTAGGAAAGAATCTGTACAATAATGAACATGT
TGCAATAAAATTAGAGCCAATGAAGACTCGATCTCCCCAATTGCATTTGG
AATACAAATTCTACAAGATTCTTAATTCAGAGGGCATCATTGATGGATTT
CCCAAGGTCTTTTTTTTCGGCCTTTGCAACAGATATAATGCCCTTGTCAT
GGAGTTGTTGGGCCCGTCCTTGGAGGATTTATTTGATCATTGCAATAGGG
CATTTTCTGTAAAAACTGTGGCAATGATTGCAATACAATTGCTGGATCGC
TTCGAATATATTCACAATCACAGACTCATTTATCGAGATGTGAAACCAGA
AAACTTTTTAGTCGGTCGAAAATCCTTGAAGAAACACAACACGATTTTCG
TGATAGATTTCGGTTTAGCCAAAGAATACAAAGATCCCGAAACAAATGCT
CATATTCCATACAGGGAACACAAAAGTCTAACAGGAACTGCTCGATACAT
GAGCATCAATACACATTTAGGAAAAGAACAGTCAAGGCGCGATGATTTGG
AATCACTAGGTCACATGTTTATGTATTTCTTTCGTGGTAGTCTTCCTTGG
CAAGGTCTGAAAGCAAATGATTTAAAAGAAAGATATCAGAAAATCGGAGA
CACAAAACGCTCTACTCCAATCGACATCCTCTGTGAAGGGCATCCTCCCG
AAATGATATCTTATTTACGCTACGTCAGGAAACTCGATTTCTATGAAGAA
CCAGATTACGCGTATCTGAAAGATTTGTTCAGTAAAATTCTCACTCGAAA
CAATTGGGAGTGTGATTGGCAGTTCGACTGGATCATTAAAACCCAGAAAA
CCTCATCCTCTGCAACTTTGTCACAGGACACAAAGATTACTGCCTTCACA
GACACCACGAATCAAACTCGTCGCAGTTCTCAGAGAAATCAGTCATTTGT
TCATGAATTAGTTACGCCTGCTATGCCGAAAGAAGACAAAATTATTTATG
AAACAGATGTTTCTATAGGATGCTGTGGGAAATGTTTCGGGAGAAAGAAA
CAGAACTTGTACAAAAACCAATATCCTCACCAGAATAACGATGTCAGACT
GTGATTATTATTATTATTATGTGAGACGATTAATGCGGACTGATGACAAT
GATGTGTTGCTGTTGTTGTATCATGGAATCCAATGATGTCTGTGTAAATA
TTGATGCTTTTATATTTATTATTATTATTATTATTAATCATTTTACTAAA
ATGAAAGATTTATATCCTTATTACGATAGATTGTTAAAATTTTTCATTGA
CATTTTTGTTTACTAGTTTTATTTGTTGTGATTGGTGTTTCGAATTGCTG
TTCATTAATTGGACGATTTTATTTACAATTACTTTTTAGTTTTGCATTTC
CAAACTTTTTTTGCCTTAATTAATAATTTGGTCTCGTCAATCGGTAAGTT
TTAATTGATGAAAAATTGTAATTTAAATGTGCCATGGCTTGTTTTCTGTA
AATAATGAACAATGG
back to top

protein sequence of SMED30034473-orf-1

>SMED30034473-orf-1 ID=SMED30034473-orf-1|Name=SMED30034473-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=409bp
MKTSGSTMDNRYSNMSVHSSGDSSFVIVGPNFKVGKKIGSGNFGELRLGK
NLYNNEHVAIKLEPMKTRSPQLHLEYKFYKILNSEGIIDGFPKVFFFGLC
NRYNALVMELLGPSLEDLFDHCNRAFSVKTVAMIAIQLLDRFEYIHNHRL
IYRDVKPENFLVGRKSLKKHNTIFVIDFGLAKEYKDPETNAHIPYREHKS
LTGTARYMSINTHLGKEQSRRDDLESLGHMFMYFFRGSLPWQGLKANDLK
ERYQKIGDTKRSTPIDILCEGHPPEMISYLRYVRKLDFYEEPDYAYLKDL
FSKILTRNNWECDWQFDWIIKTQKTSSSATLSQDTKITAFTDTTNQTRRS
SQRNQSFVHELVTPAMPKEDKIIYETDVSIGCCGKCFGRKKQNLYKNQYP
HQNNDVRL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0006897endocytosis
GO:0008360regulation of cell shape
GO:0016055Wnt signaling pathway
GO:0016310phosphorylation
GO:0018105peptidyl-serine phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm