Potassium channel subfamily K member 18

Overview
NamePotassium channel subfamily K member 18
Smed IDSMED30034472
Length (bp)1195
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium channel subfamily K member 18 (SMED30034472) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium channel subfamily K member 18 (SMED30034472) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034472

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30034472SMESG000019992.1 SmedASXL_002814SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30034472SMESG000019992.1 dd_Smed_v4_40463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034472SMESG000019992.1 dd_Smed_v4_40463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034472SMESG000019992.1 dd_Smed_v4_40463_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 64.6994 bits (156), Expect = 3.954e-11
Identity = 47/153 (30.72%), Postives = 71/153 (46.41%), Query Frame = 3
Query:   54 IFSCAGS-----ILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIG 497
            + SC G      +L  V Y L+G  +F+L+E Q E + + + +    R +E   NY          LD   +  F+    E   K  N   N T   N  +W    S  F+ TV+TTIGYG   P T  G+   + YA++GIP   + L+++G
Sbjct:    6 LCSCWGGRVLPLLLAYVCYLLLGATIFQLLERQAEAQSRDQFQLEKLRFLE---NYT--------CLDQWAMEQFVQVIMEAWVKGVNPKGNST---NPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALLGIPLNVIFLNHLG 144          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 65.0846 bits (157), Expect = 4.604e-11
Identity = 47/151 (31.13%), Postives = 70/151 (46.36%), Query Frame = 3
Query:   60 SCAGS-----ILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIG 497
            SC G      +L  V Y L+G  +F+L+E Q E + + + +    R +E   NY          LD   +  F+    E   K  N   N T   N  +W    S  F+ TV+TTIGYG   P T  G+   + YA++GIP   + L+++G
Sbjct:    8 SCWGGRVLPLLLAYVCYLLLGATIFQLLERQAEAQSRDQFQLEKLRFLE---NYT--------CLDQWAMEQFVQVIMEAWVKGVNPKGNST---NPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALLGIPLNVIFLNHLG 144          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 64.6994 bits (156), Expect = 5.478e-11
Identity = 47/153 (30.72%), Postives = 71/153 (46.41%), Query Frame = 3
Query:   54 IFSCAGS-----ILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIG 497
            + SC G      +L  V Y L+G  +F+L+E Q E + + + +    R +E   NY          LD   +  F+    E   K  N   N T   N  +W    S  F+ TV+TTIGYG   P T  G+   + YA++GIP   + L+++G
Sbjct:    6 LCSCWGGRVLPLLLAYVCYLLLGATIFQLLERQAEAQSRDQFQLEKLRFLE---NYT--------CLDQWAMEQFVQVIMEAWVKGVNPKGNST---NPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALLGIPLNVIFLNHLG 144          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK18 (potassium two pore domain channel subfamily K member 18 [Source:HGNC Symbol;Acc:HGNC:19439])

HSP 1 Score: 65.0846 bits (157), Expect = 5.788e-11
Identity = 47/163 (28.83%), Postives = 75/163 (46.01%), Query Frame = 3
Query:   75 ILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKK 563
            +  +V Y L+G  +F  IE+ Q   +        ++ +E+L   ILN  +  +     +L          L K+K + +N T       W+   S+ F  TV +T+GYG   P TR GK+L ++YA+ GIP  FL L++ G   +      Y   RK  F  +
Sbjct:   27 LCFLVTYALVGAVVFSAIEDGQ--VLVAADDGEFEKFLEELCR-ILNCSETVVEDRKQDLQG-------HLQKVKPQWFNRT-----THWSFLSSLFFCCTVFSTVGYGYIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILATILSTSYNRFRKFPFFTR 174          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 64.3142 bits (155), Expect = 5.903e-11
Identity = 47/153 (30.72%), Postives = 71/153 (46.41%), Query Frame = 3
Query:   54 IFSCAGS-----ILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIG 497
            + SC G      +L  V Y L+G  +F+L+E Q E + + + +    R +E   NY          LD   +  F+    E   K  N   N T   N  +W    S  F+ TV+TTIGYG   P T  G+   + YA++GIP   + L+++G
Sbjct:    6 LCSCWGGRVLPLLLAYVCYLLLGATIFQLLERQAEAQSRDQFQLEKLRFLE---NYT--------CLDQWAMEQFVQVIMEAWVKGVNPKGNST---NPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALLGIPLNVIFLNHLG 144          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-48 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q7YWY7])

HSP 1 Score: 127.102 bits (318), Expect = 7.840e-33
Identity = 116/395 (29.37%), Postives = 184/395 (46.58%), Query Frame = 3
Query:   33 LSRFTKFIFSCAGSILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKN-------EGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKKQKENFTRLI--HIKRSLPKQQEKKLKKVSSKL-RYKRKHPKGERNLVNWNNIDSDLFXXXXXXXXXXXXXXXXXXXXXXFNEWLIKNQSVNVSYLTYDREIPEQSETVEQVNLSYSQXXXXXXXXXXXXXXXXXXGALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKI-DSDNPKEKLIXXXXXXXXXXXXXSMCFKLMEEEIRYK 1184
            + +   F FS  G   ++V Y L+G  +FK +E   E  I+  +K   ++ V+ + N    + + N  LD       +L   +E+ + K        +G++G     +  WT  G+ L+SLTVITTIGYG    KT  GK LT++YAIIGIP   L L+NIG   +K F   Y    + KF         RLI  H KR     +  K+++ +S + R  R H     + V+   + +                                    +V  L   R   EQ E  E        + +PI++    ++ Y+ +G   F +WE   +L+  YFCFI+L+TIGFGD  P T + ++D  +EKL+    Y++ G+++ +MCF L +EE++ K
Sbjct:   17 VKKIIAFFFSHIGLCALVVGYALLGAVIFKAVEGPHEAEIQELVKSAREKAVDVVWN---ATFRVN-RLDSKQWKKTVL---DEVKRFKTVCMLSIRKGYDGKEYGKQAQWTFTGAFLYSLTVITTIGYGNTAAKTYIGKTLTMLYAIIGIPLMLLFLTNIGDVMAKIFRFLYAQSIRLKF---------RLILWHKKR-----KAAKIRRANSLVSRLTRGHRVKADSSVDSFGLGA----------------------------------GADVEDLLTARVEMEQLEVRETAAAQLESMTVPISLVVFTMLGYLGVGTTIFKVWEGWTFLESFYFCFISLTTIGFGDKFPSTSVSNTDEAQEKLVITSIYLLFGMALLAMCFNLAQEEVQNK 356          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-39 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A1EHR5])

HSP 1 Score: 93.5893 bits (231), Expect = 2.076e-20
Identity = 57/170 (33.53%), Postives = 92/170 (54.12%), Query Frame = 3
Query:   45 TKFIFSCAGSILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYI--LNSLKENISLDPSNLNNFLLKYTEEL--SKLKNEGWNGTFGENE-YSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFL 539
            T F  +  G   ++ +Y + G FMF+ +E   E  ++ K+K  S ++V+ +  +I   N ++E       N + + LK  E L    +  EG++    E   + WT  G++L+S+TV TTIGYG   PKT  G+ LTI+Y+I+GIP   L L+NI +  ++ F   Y  L
Sbjct:   20 TIFTITHVGLCFLVALYAVAGAFMFQAVEYPYELGLQGKVKNASLKVVDDIYRFINRKNVIEETAV---KNESQWALKEFEMLLVHAMNFEGYDEHDEERPTFQWTFSGALLYSITVFTTIGYGHICPKTDTGRLLTILYSILGIPLMLLCLANIAETLAQVFTYIYFKL 186          

HSP 2 Score: 70.4774 bits (171), Expect = 6.206e-13
Identity = 36/77 (46.75%), Postives = 55/77 (71.43%), Query Frame = 3
Query:  960 GALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIXXXXXXXXXXXXXSMCFKLMEEEIRYKWK 1190
            GA  F+ WE+ +    AY+CFITLSTIGFGDIVPG  +D +  +EKL+    Y++ G+++ +MCFKLM++++  K +
Sbjct:  508 GAWLFSWWENWNGFDGAYYCFITLSTIGFGDIVPGQALD-EGSQEKLVVCALYLLFGMALIAMCFKLMQDDVVQKAR 583          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-39 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A1EHR5])

HSP 1 Score: 93.5893 bits (231), Expect = 2.293e-20
Identity = 57/170 (33.53%), Postives = 92/170 (54.12%), Query Frame = 3
Query:   45 TKFIFSCAGSILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYI--LNSLKENISLDPSNLNNFLLKYTEEL--SKLKNEGWNGTFGENE-YSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFL 539
            T F  +  G   ++ +Y + G FMF+ +E   E  ++ K+K  S ++V+ +  +I   N ++E       N + + LK  E L    +  EG++    E   + WT  G++L+S+TV TTIGYG   PKT  G+ LTI+Y+I+GIP   L L+NI +  ++ F   Y  L
Sbjct:   20 TIFTITHVGLCFLVALYAVAGAFMFQAVEYPYELGLQGKVKNASLKVVDDIYRFINRKNVIEETAV---KNESQWALKEFEMLLVHAMNFEGYDEHDEERPTFQWTFSGALLYSITVFTTIGYGHICPKTDTGRLLTILYSILGIPLMLLCLANIAETLAQVFTYIYFKL 186          

HSP 2 Score: 70.4774 bits (171), Expect = 6.444e-13
Identity = 36/77 (46.75%), Postives = 55/77 (71.43%), Query Frame = 3
Query:  960 GALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIXXXXXXXXXXXXXSMCFKLMEEEIRYKWK 1190
            GA  F+ WE+ +    AY+CFITLSTIGFGDIVPG  +D +  +EKL+    Y++ G+++ +MCFKLM++++  K +
Sbjct:  508 GAWLFSWWENWNGFDGAYYCFITLSTIGFGDIVPGQALD-EGSQEKLVVCALYLLFGMALIAMCFKLMQDDVVQKAR 583          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-18 (TWiK family of potassium channels protein 18 [Source:UniProtKB/Swiss-Prot;Acc:Q18120])

HSP 1 Score: 88.9669 bits (219), Expect = 4.207e-19
Identity = 63/201 (31.34%), Postives = 103/201 (51.24%), Query Frame = 3
Query:   12 LEIIKRGLSR-FTKFIFSCAG--SILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKN--EGWNGTFG------ENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFY--LFLRKSKFLKKQKEN 575
            + I+ +G+S   T F  +  G   ++++V YTL+G ++F +IE + ER + ++ +K    ++ + + Y +N L+             L+   EE ++       +  T G      + +  WT  GSI + +TV TTIGYG   P T WG+F TI+YA IGIP T LSL  +G  F+K  C      FL+ ++ + K   N
Sbjct:    1 MAIVAQGVSTILTTFQKTFKGLLPLIILVAYTLLGAWIFWMIEGENEREMLIEQQKERDELIRR-TVYKINQLQ-------IKRQRRLMTAEEEYNRTAKVLTTFQETLGIVPADMDKDIHWTFLGSIFYCMTVYTTIGYGNIVPGTGWGRFATILYAFIGIPLTVLSLYCLGSLFAKG-CKMLWRFFLKSTRVVSKDLSN 192          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-18 (TWiK family of potassium channels protein 18 [Source:UniProtKB/Swiss-Prot;Acc:Q18120])

HSP 1 Score: 88.9669 bits (219), Expect = 4.207e-19
Identity = 63/201 (31.34%), Postives = 103/201 (51.24%), Query Frame = 3
Query:   12 LEIIKRGLSR-FTKFIFSCAG--SILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKN--EGWNGTFG------ENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFY--LFLRKSKFLKKQKEN 575
            + I+ +G+S   T F  +  G   ++++V YTL+G ++F +IE + ER + ++ +K    ++ + + Y +N L+             L+   EE ++       +  T G      + +  WT  GSI + +TV TTIGYG   P T WG+F TI+YA IGIP T LSL  +G  F+K  C      FL+ ++ + K   N
Sbjct:    1 MAIVAQGVSTILTTFQKTFKGLLPLIILVAYTLLGAWIFWMIEGENEREMLIEQQKERDELIRR-TVYKINQLQ-------IKRQRRLMTAEEEYNRTAKVLTTFQETLGIVPADMDKDIHWTFLGSIFYCMTVYTTIGYGNIVPGTGWGRFATILYAFIGIPLTVLSLYCLGSLFAKG-CKMLWRFFLKSTRVVSKDLSN 192          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: sand (gene:FBgn0033257 transcript:FBtr0088780)

HSP 1 Score: 100.523 bits (249), Expect = 3.705e-23
Identity = 67/179 (37.43%), Postives = 95/179 (53.07%), Query Frame = 3
Query:    9 SLEIIKRGLSRFTKFIFSCAGSILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSL----KENISLDPSN-----LNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAF 518
            + E  K     FT F+FS  G IL++  Y + G F+F+ IE  +  R  LK +K  + I    S   L+ +     ENIS    +     +N+ LL Y   + K + +G       +   W+  G+ L+SLTVITTIGYG  TP +  GK +TI+YAIIG+P   L LSNIG   +K+F
Sbjct:   15 AFERFKDHCRHFTAFMFSNVGIILLVTFYIIGGAFIFQSIEIFEYER--LKSEKPHRFIARNFSGECLSRIWELTAENISFFDHHAYRRRVNDVLLDYQRAIVKKQLKG------PDVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSF 185          

HSP 2 Score: 68.5514 bits (166), Expect = 2.073e-12
Identity = 35/75 (46.67%), Postives = 52/75 (69.33%), Query Frame = 3
Query:  960 GALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKI---DSDNPKEKLIXXXXXXXXXXXXXSMCFKLMEEEI 1175
            GAL F  WED +YL  +YFC I+LS+IGFGD+VPG ++   D D  +   I    Y+++G++V +MCF LM+E++
Sbjct:  301 GALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSFILCAIYLLLGMAVIAMCFNLMQEQV 375          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG9194 (gene:FBgn0035192 transcript:FBtr0072651)

HSP 1 Score: 92.4337 bits (228), Expect = 6.018e-20
Identity = 49/147 (33.33%), Postives = 85/147 (57.82%), Query Frame = 3
Query:   93 YTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNS----LKENISLDPSNLNNFLLKYTEE-LSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAF 518
            Y + G ++F+ +E   E  +K  ++     + E +  ++L+     L+E+  +  +N++  L  + ++ L+ +K +GW+G     +  WT  GS+ +S+ VITTIGYG  +P+T WGK  TI YAI+GIP   + LSNIG   + +F
Sbjct:   51 YCVGGAYLFQHLERPHELEVKRDIQNLRVNLTENI--WLLSDDAVVLRESDWM--ANVSKHLANFEKQILTAIKADGWDGDEDLRKSQWTFAGSLFYSIIVITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMATSF 193          

HSP 2 Score: 56.225 bits (134), Expect = 3.218e-8
Identity = 30/71 (42.25%), Postives = 47/71 (66.20%), Query Frame = 3
Query:  960 GALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIXXXXXXXXXXXXXSMCFKLMEEE 1172
            GA+ F  WE+  +L  AYFCFITL+TIGFGD VP   +  D  ++ + +   Y++ G+++ +M F L++EE
Sbjct:  635 GAVLFAYWENWSFLDSAYFCFITLTTIGFGDFVPAKGV-KDESEQSIAYCSLYLLFGIALLAMSFNLVQEE 704          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG1688 (gene:FBgn0027589 transcript:FBtr0088495)

HSP 1 Score: 84.7297 bits (208), Expect = 2.369e-17
Identity = 67/256 (26.17%), Postives = 115/256 (44.92%), Query Frame = 3
Query:   21 IKRGLSRFTKFIFSCAGSILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKL--SNYILNSLKEN--ISLDPSNLNNF---LLKYTEELSK---------LKNEGWNGTFGENEY------SWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAF-CGFYLFLRKSKFLKKQKENFTRLIHIKRSLPKQQEKKLKKVSSKLRYKRKHPKGERNLVNWNNIDSD 719
            ++R      K +FS  G +L+++ Y+++GG +F L+E  Q+      + K+ +  + +L      LN L E     L    L  F   ++  T + S          L +EG     G   Y      SW+   ++L+S+TVITTIG+G  TP+T  GK  TI YA++G+P   + LS++G   +    C    ++R    L++ +E      H ++S P          ++  R K    + +R + N      D
Sbjct:   62 LRRCCGHLLKLLFSTPGLVLLVIGYSVLGGLLFPLLEAPQDISKSAAIAKSREDCLRELWIITEKLNVLYERNWTMLVHEQLRRFEGSIVAATRQGSAGSSGGGGAGLFHEGSASALGHFGYDAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQC---TYVRLCCQLQRHQE------HRRKSTPGTSTPSASSAANS-REKDTDKRSKRRMANCKGCQYD 307          

HSP 2 Score: 53.9138 bits (128), Expect = 1.658e-7
Identity = 29/77 (37.66%), Postives = 48/77 (62.34%), Query Frame = 3
Query:  960 GALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIXXXXXXXXXXXXXSMCFKLMEEEIRYKWK 1190
            G + F +WE+   +  AYFCF+TLSTIG+GD VP      + P+ +L     Y+++GL + +M F ++E ++ +K K
Sbjct:  831 GTVIFALWENWSLVDGAYFCFVTLSTIGYGDFVPARSF--NGPELQLYACCAYLLLGLVLVAMSFSILETQLMWKCK 905          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG10864 (gene:FBgn0038621 transcript:FBtr0083654)

HSP 1 Score: 82.0333 bits (201), Expect = 7.478e-17
Identity = 49/173 (28.32%), Postives = 86/173 (49.71%), Query Frame = 3
Query:   21 IKRGLSRFTKFIFSCAGSILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVE---KLSNYILNSLKENISLD----PSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAF 518
            +KR    F  F+ +  G   +IV+Y + G F F  IE Q        + +T+  ++E     S  + +  +++  +D        N+ L +Y  +++ +   G+ G     E  W+   +++F L+VIT IGYG   P+T WGK  T++YA  GIP   L   N+G+  +++F
Sbjct:   36 VKRCCRNFVTFMCTQVGVGALIVIYAICGAFAFMHIERQ-------FVDETAGHVMELRQNCSQQLWSITEQHNIIDRRRWTEATNDVLREYQSQIAGVVKHGYVGR--SPEQIWSFPAALMFCLSVITMIGYGNMVPRTPWGKGFTVIYATFGIPLYILYFLNMGRVLARSF 199          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG34396 (gene:FBgn0085425 transcript:FBtr0112645)

HSP 1 Score: 79.7221 bits (195), Expect = 9.846e-16
Identity = 52/162 (32.10%), Postives = 86/162 (53.09%), Query Frame = 3
Query:   63 CAGSILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKEN-ISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRK 545
            C   ++ + +    GG +F+  E   E   K +++K  +  +++L +   N  +E+  SL    L +F     +EL+ L   G     G+   SW      +F  TVITTIGYG  TPKT  G+ LTIVYAIIGIP   + L+++G+ F++     ++++R+
Sbjct:  526 CIAYLICMAMLLGFGGLLFRYTEGAAENIYKCEVRKVKRDFIDRLWDVSHNMREEDWKSLARQKLRSF----EDELNNLAELGLRRYPGQK--SWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRR 681          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 73.9442 bits (180), Expect = 5.906e-14
Identity = 47/161 (29.19%), Postives = 77/161 (47.83%), Query Frame = 3
Query:   75 ILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQ----HFSKAFCGFYLFLRK 545
            IL +V+Y ++G  +F+ IE +  R    ++    Q+++E + N+           D S   + + K  + L     E       E ++ WT   S+ F  TV TT+GYG   P T  GK   ++YA++GIP   L +S++G       SKA+    LF R+
Sbjct:   27 ILSLVLYAVLGALVFRAIEYKNPRNESEEILSIVQKVMEIVQNHT----------DTSEQKHLINKAKDILDDYCYEK------ERDHGWTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAYTRLNLFFRR 171          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 71.633 bits (174), Expect = 2.961e-13
Identity = 47/161 (29.19%), Postives = 75/161 (46.58%), Query Frame = 3
Query:   75 ILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQ----HFSKAFCGFYLFLRK 545
            IL +V+Y ++G  +F+ IE    R    ++    Q+++E + N+           D S   + + K    L     E       E ++ WT   S+ F  TV TT+GYG   P T  GK   ++YA++GIP   L +S++G       SKA+    LF R+
Sbjct:   27 ILSLVLYAVLGALVFRAIEYTNPRNESEEILSIVQKVMEIVQNHT----------DASEQKHLINKAKYILDDYCYEK------ERDHGWTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAYTRLNLFFRR 171          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 71.633 bits (174), Expect = 2.988e-13
Identity = 47/161 (29.19%), Postives = 75/161 (46.58%), Query Frame = 3
Query:   75 ILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQ----HFSKAFCGFYLFLRK 545
            IL +V+Y ++G  +F+ IE    R    ++    Q+++E + N+           D S   + + K    L     E       E ++ WT   S+ F  TV TT+GYG   P T  GK   ++YA++GIP   L +S++G       SKA+    LF R+
Sbjct:   27 ILSLVLYAVLGALVFRAIEYTNPRNESEEILSIVQKVMEIVQNHT----------DASEQKHLINKAKYILDDYCYEK------ERDHGWTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAYTRLNLFFRR 171          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk1a (potassium channel, subfamily K, member 1a [Source:ZFIN;Acc:ZDB-GENE-070620-26])

HSP 1 Score: 67.781 bits (164), Expect = 4.632e-12
Identity = 41/146 (28.08%), Postives = 71/146 (48.63%), Query Frame = 3
Query:   75 ILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEE----LSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQ 500
            +L  V+Y + G  +F  +E   E +++ +++   Q+ +E           +N  L    L  FL+K  E     +S L N   N       ++W    ++ F+ TV++T GYG   P +  GK   I+Y+++GIPFT L L+ + Q
Sbjct:   27 VLAYVLYLIFGALVFSAVELPYEEQLRQELRTVKQQFLE-----------DNECLSNDRLEEFLIKALEASNYGVSVLNNASSN-------WNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVVGIPFTLLFLTAVVQ 154          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk1a (potassium channel, subfamily K, member 1a [Source:ZFIN;Acc:ZDB-GENE-070620-26])

HSP 1 Score: 67.781 bits (164), Expect = 4.632e-12
Identity = 41/146 (28.08%), Postives = 71/146 (48.63%), Query Frame = 3
Query:   75 ILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEE----LSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQ 500
            +L  V+Y + G  +F  +E   E +++ +++   Q+ +E           +N  L    L  FL+K  E     +S L N   N       ++W    ++ F+ TV++T GYG   P +  GK   I+Y+++GIPFT L L+ + Q
Sbjct:   27 VLAYVLYLIFGALVFSAVELPYEEQLRQELRTVKQQFLE-----------DNECLSNDRLEEFLIKALEASNYGVSVLNNASSN-------WNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVVGIPFTLLFLTAVVQ 154          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: kcnk6 (potassium channel, two pore domain subfamily K, member 6 [Source:NCBI gene;Acc:100145504])

HSP 1 Score: 70.0922 bits (170), Expect = 7.397e-13
Identity = 47/148 (31.76%), Postives = 74/148 (50.00%), Query Frame = 3
Query:   87 VVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEE----LSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAF 518
            V+Y L+G  +  +IE+  E  ++ ++++        L +  LN   E+  ++ S+L  FL K        +S L N         N+  W +  S+ F+ T++TT+GYG  TP T  GK   I YA+IG+PFT L LS+  Q     F
Sbjct:   15 VIYLLLGALVISVIESPYEASLRDELRQ--------LKSVFLN---ESPCVNVSSLEAFLEKIINANKYGVSVLHN-------ASNDSKWDIASSMFFASTLVTTVGYGYTTPLTDSGKAFCIFYALIGVPFTMLVLSSFVQRLMVMF 144          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: kcnk6 (potassium channel, two pore domain subfamily K, member 6 [Source:NCBI gene;Acc:100145504])

HSP 1 Score: 70.0922 bits (170), Expect = 9.673e-13
Identity = 47/148 (31.76%), Postives = 74/148 (50.00%), Query Frame = 3
Query:   87 VVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEE----LSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAF 518
            V+Y L+G  +  +IE+  E  ++ ++++        L +  LN   E+  ++ S+L  FL K        +S L N         N+  W +  S+ F+ T++TT+GYG  TP T  GK   I YA+IG+PFT L LS+  Q     F
Sbjct:   33 VIYLLLGALVISVIESPYEASLRDELRQ--------LKSVFLN---ESPCVNVSSLEAFLEKIINANKYGVSVLHN-------ASNDSKWDIASSMFFASTLVTTVGYGYTTPLTDSGKAFCIFYALIGVPFTMLVLSSFVQRLMVMF 162          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: bcdin3d (BCDIN3 domain containing RNA methyltransfease [Source:Xenbase;Acc:XB-GENE-5859380])

HSP 1 Score: 62.3882 bits (150), Expect = 2.459e-10
Identity = 36/146 (24.66%), Postives = 68/146 (46.58%), Query Frame = 3
Query:   78 LMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKA 515
            +  +VY L+G  +F+++E + E   K   ++           + L+ LK    L    L++ + +   +  K            +  +W +  S  F+ TV+TTIGYG  +P+T  G+   ++YA+ GIP   + L  +G+  S+ 
Sbjct:   14 MAFMVYLLVGALVFQVLEKEAEDTAKTDTER-----------HRLDFLKNYTCLTKEALDHLVNQVITDAVKQGIHPLENQTKNSHSNWDMSSSFFFAGTVVTTIGYGTLSPRTPGGQIFCVLYALFGIPLNVIVLGRVGKILSRV 148          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: stk26 (serine/threonine kinase 26 [Source:Xenbase;Acc:XB-GENE-982067])

HSP 1 Score: 61.2326 bits (147), Expect = 6.246e-10
Identity = 49/156 (31.41%), Postives = 67/156 (42.95%), Query Frame = 3
Query:   54 IFSCAGSILMIV-------VYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQ 500
            IF C   I + V       +Y  +G  MF+++E Q E   + + +    R    L NY          LD + L  F+    E   K  N   N T   N  +W    S  F+ TVITTIGYG   P T  G+   + YA+ GIP     L+ IG+
Sbjct:    4 IFQCRRQISLSVALSLGYFLYLFLGAMMFQILEKQAESNTRDQFQVAKLRF---LQNYT--------CLDVNALEQFVQIIMEAWEKGLNPKGNAT---NPSNWDFSNSFFFAGTVITTIGYGNLYPSTVAGQVFCVFYALFGIPLNLAFLNLIGK 145          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: stk26 (serine/threonine kinase 26 [Source:Xenbase;Acc:XB-GENE-982067])

HSP 1 Score: 60.8474 bits (146), Expect = 6.738e-10
Identity = 44/137 (32.12%), Postives = 61/137 (44.53%), Query Frame = 3
Query:   90 VYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQ 500
            +Y  +G  MF+++E Q E   + + +    R    L NY          LD + L  F+    E   K  N   N T   N  +W    S  F+ TVITTIGYG   P T  G+   + YA+ GIP     L+ IG+
Sbjct:   22 LYLFLGAMMFQILEKQAESNTRDQFQVAKLRF---LQNYT--------CLDVNALEQFVQIIMEAWEKGLNPKGNAT---NPSNWDFSNSFFFAGTVITTIGYGNLYPSTVAGQVFCVFYALFGIPLNLAFLNLIGK 144          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk18 (potassium channel, subfamily K, member 18 [Source:MGI Symbol;Acc:MGI:2685627])

HSP 1 Score: 68.9366 bits (167), Expect = 2.654e-12
Identity = 41/142 (28.87%), Postives = 69/142 (48.59%), Query Frame = 3
Query:   75 ILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQ 500
            +  +V Y L+G  +F  +E + +   +   +      ++K  + + N LK N+++   +  N      E L  LK +            W+   ++ F  TV +T+GYG   P TR GKFL ++YA+ GIP  FL L++IG 
Sbjct:   38 LCCLVTYALVGAALFSAVEGRPDPEAEENPE------LKKFLDDLCNILKCNLTVVEGSRKNL----CEHLQHLKPQWLKAP-----QDWSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGD 164          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk15 (potassium channel, subfamily K, member 15 [Source:MGI Symbol;Acc:MGI:2675209])

HSP 1 Score: 67.0106 bits (162), Expect = 6.271e-12
Identity = 45/145 (31.03%), Postives = 67/145 (46.21%), Query Frame = 3
Query:   66 AGSILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQ 500
            A  IL I+ Y L+G  +F  +E++ ER        + QR++ +         K   S D             EL +L  +      G     W   GS  F++TVITTIGYG A P T  GK   + YA++GIP T ++  ++G+
Sbjct:    9 AALILCILSYLLVGAAVFDALESEAER--------SRQRLLARKRGEFRR--KYRFSADDYR----------ELERLALQAEPHRAGRQ---WRFAGSFYFAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPLTLVTFQSLGE 130          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk15 (potassium channel, subfamily K, member 15 [Source:MGI Symbol;Acc:MGI:2675209])

HSP 1 Score: 67.0106 bits (162), Expect = 8.365e-12
Identity = 46/145 (31.72%), Postives = 68/145 (46.90%), Query Frame = 3
Query:   66 AGSILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQ 500
            A  IL I+ Y L+G  +F  +E++ ER        + QR++ +         K   S D          Y  EL +L  +      G     W   GS  F++TVITTIGYG A P T  GK   + YA++GIP T ++  ++G+
Sbjct:   28 AALILCILSYLLVGAAVFDALESEAER--------SRQRLLARKRGEFRR--KYRFSAD---------DY-RELERLALQAEPHRAGRQ---WRFAGSFYFAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPLTLVTFQSLGE 149          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk16 (potassium channel, subfamily K, member 16 [Source:MGI Symbol;Acc:MGI:1921821])

HSP 1 Score: 65.0846 bits (157), Expect = 2.290e-11
Identity = 44/141 (31.21%), Postives = 67/141 (47.52%), Query Frame = 3
Query:   75 ILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIG 497
            +L  + Y L+G  +F+L+E Q E + + + +    R +E   NY          LD   L  F+    E   K  N   N T   N  +W    S  F+ TV+TTIGYG   P T  G+   + YA++GIP   + L+++G
Sbjct:   18 LLAYICYLLLGATIFQLLEKQAEAQSRDQFQLEKLRFLE---NYT--------CLDQQALEQFVQVILEAWVKGVNPKGNST---NPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALMGIPLNVVFLNHLG 144          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk9 (potassium channel, subfamily K, member 9 [Source:MGI Symbol;Acc:MGI:3521816])

HSP 1 Score: 64.3142 bits (155), Expect = 8.776e-11
Identity = 46/143 (32.17%), Postives = 65/143 (45.45%), Query Frame = 3
Query:   75 ILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTE-ELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQ 500
            I     Y L+G  +F  +E+  E R + K+K    R+  K           NIS D          Y + EL  L++E            W   GS  F++TVITTIGYG A P T  GK   + YA++GIP T +   ++G+
Sbjct:   12 IACTFTYLLVGAAVFDALESDHEMREEEKLKAEEVRLRGKY----------NISSD---------DYQQLELVILQSEPHRAGV-----QWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGE 130          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q18120|TWK18_CAEEL (TWiK family of potassium channels protein 18 OS=Caenorhabditis elegans OX=6239 GN=twk-18 PE=1 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 5.352e-18
Identity = 63/201 (31.34%), Postives = 103/201 (51.24%), Query Frame = 3
Query:   12 LEIIKRGLSR-FTKFIFSCAG--SILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKN--EGWNGTFG------ENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFY--LFLRKSKFLKKQKEN 575
            + I+ +G+S   T F  +  G   ++++V YTL+G ++F +IE + ER + ++ +K    ++ + + Y +N L+             L+   EE ++       +  T G      + +  WT  GSI + +TV TTIGYG   P T WG+F TI+YA IGIP T LSL  +G  F+K  C      FL+ ++ + K   N
Sbjct:    1 MAIVAQGVSTILTTFQKTFKGLLPLIILVAYTLLGAWIFWMIEGENEREMLIEQQKERDELIRR-TVYKINQLQ-------IKRQRRLMTAEEEYNRTAKVLTTFQETLGIVPADMDKDIHWTFLGSIFYCMTVYTTIGYGNIVPGTGWGRFATILYAFIGIPLTVLSLYCLGSLFAKG-CKMLWRFFLKSTRVVSKDLSN 192          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|P34410|TWK7_CAEEL (TWiK family of potassium channels protein 7 OS=Caenorhabditis elegans OX=6239 GN=twk-7 PE=3 SV=3)

HSP 1 Score: 75.0998 bits (183), Expect = 2.312e-13
Identity = 58/207 (28.02%), Postives = 99/207 (47.83%), Query Frame = 3
Query:   30 GLSRFTKFIFSCAGSILMIVVYTLMGGFMFKLIENQQERRIK---LKMKKTSQ-RIVEKL---------SNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFC---GFYL---FLRKSKFLKKQKENFTRLIH 593
            G+ +F K +      +L+   YT++G  +F  +E   E+ +K   LK+  T Q   V+ L           Y   SL E       N+++ L    E+     NE       E   +WT   SI F++TV+TTIGYG   P T  G+   I+++++GIP T ++++++G+  S+      G YL   +L  S+  K+++E+     H
Sbjct:  154 GIRKFAKLVLPHVALVLLTCTYTVIGALIFYSVEQPHEQMMKEQQLKLIYTRQNEFVDDLIRLAAGNETKRYEWESLAER---HMHNMSDQLFVAFEKYFLTSNEVKKNAATE---TWTFSSSIFFAVTVVTTIGYGNPVPVTNIGRIWCILFSLLGIPLTLVTIADLGKFLSEHLVWLYGNYLKLKYLILSRHRKERREHVCEHCH 354          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q6Q1P3|KCNKI_RAT (Potassium channel subfamily K member 18 OS=Rattus norvegicus OX=10116 GN=Kcnk18 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.290e-11
Identity = 43/141 (30.50%), Postives = 73/141 (51.77%), Query Frame = 3
Query:   75 ILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIG 497
            +  +V Y L+G  +F  +E + +   +   +      ++K  + + N LK N+++   +  +      E L +LK + W   F   E  W+   ++ F  TV +T+GYG   P TR GKFL ++YA+ GIP  FL L++IG
Sbjct:   49 LCCLVTYALVGAALFSAVEGRPDPEAEENPE------LKKFLDKLCNILKCNLTVVEGSRKDL----CEHLQQLKPQ-W---FKAPE-DWSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIG 174          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q6VV64|KCNKI_MOUSE (Potassium channel subfamily K member 18 OS=Mus musculus OX=10090 GN=Kcnk18 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.857e-11
Identity = 41/142 (28.87%), Postives = 69/142 (48.59%), Query Frame = 3
Query:   75 ILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQ 500
            +  +V Y L+G  +F  +E + +   +   +      ++K  + + N LK N+++   +  N      E L  LK +            W+   ++ F  TV +T+GYG   P TR GKFL ++YA+ GIP  FL L++IG 
Sbjct:   38 LCCLVTYALVGAALFSAVEGRPDPEAEENPE------LKKFLDDLCNILKCNLTVVEGSRKNL----CEHLQHLKPQWLKAP-----QDWSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGD 164          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q8R5I0|KCNKF_RAT (Potassium channel subfamily K member 15 OS=Rattus norvegicus OX=10116 GN=Kcnk15 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 4.397e-11
Identity = 45/145 (31.03%), Postives = 67/145 (46.21%), Query Frame = 3
Query:   66 AGSILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQ 500
            A  IL I+ Y L+G  +F  +E++ ER        + QR++ +         K   S D             EL +L  +      G     W   GS  F++TVITTIGYG A P T  GK   + YA++GIP T ++  ++G+
Sbjct:    9 AALILCILSYLLVGAAVFDALESEAER--------SRQRLLARKRGEFRR--KYRFSADDYR----------ELERLALQAEPHRAGRQ---WRFAGSFYFAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPLTLVTFQSLGE 130          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: R7U1G0 (Uncharacterized protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_62385 PE=3 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 4.100e-50
Identity = 134/391 (34.27%), Postives = 205/391 (52.43%), Query Frame = 3
Query:   39 RFTKFIFSCAGSILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKE---NISLDPSNLNNFLLKYTEELS-KLKNEGWNGT--FGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKKQKENFTRLIHIKRSLPKQQEKKLKKVSSKLRYKRKHPKGERNLVNWNNIDSDLFXXXXXXXXXXXXXXXXXXXXXXFNEWL-IKNQSVNVSYLTYDREIPEQSETVEQVNLSYSQXXXXXXXXXXXXXXXXXXGALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIXXXXXXXXXXXXXSMCFKLMEEEIRYKWK 1190
            +F  F+FS  G   ++V Y+++GGF+F+ IE   E + K ++++  + IVE+L +     LKE   N +   + +   L  Y +EL   +K +GW+G     E+   W+  G++L+++TVITTIGYG   PKT  G+ +TIVYA+IGIP TFL LSNIG   + AF  FY  +    F  K+ E               +++K +++  + R  + H  G    ++   ID D                     + +  E+  +K  ++N     +D E  ++   V  V +S             +I  YI  G++ FT+WED DYL  +YFCFITLSTIGFGDIVPGT +      EKL+  V ++  GLS+ +MCF LM+EE++ K K
Sbjct:   17 KFVTFLFSHIGLAALVVGYSILGGFLFRWIEAPSEWQEKYRIREVREDIVEQLQS-TATHLKEGQINATSFENKVRGVLFHYQKELILAVKEKGWDGNDDMSESSVQWSFAGALLYAVTVITTIGYGHVAPKTSAGRIVTIVYALIGIPLTFLYLSNIGNFLADAFRLFYKKVCCDVFCCKKCE---------------RKRKRERLKMRRRIVKNHTMGNSTALHDMAIDMDC-----------------AYDQLELGEYTDLKGNALNFVDDPFDYEDEDEDAKV-TVPVSIC---------LILIAGYIFAGSVLFTLWEDWDYLTGSYFCFITLSTIGFGDIVPGTDMKEWASHEKLVLCVLWLAFGLSLLAMCFNLMQEEVKEKIK 364          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A4D5S293 (Putative potassium channel subfamily protein k member (Fragment) OS=Ixodes scapularis OX=6945 PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 1.296e-40
Identity = 120/388 (30.93%), Postives = 196/388 (50.52%), Query Frame = 3
Query:   39 RFTKFIFSCAGSILMIVVYTLMGGFMFKLIENQQE----RRIKLKMKKTSQRIVEKLSNYILNSL-KENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKKQKENFTRLIHIKRSLPKQQEKKLKKVSSKLRYKRKHPKGERNLVNWNNIDSDLFXXXXXXXXXXXXXXXXXXXXXXFNEWLIKNQSVNVSYLTYDREIPEQSETVEQVNLSYSQXXXXXXXXXXXXXXXXXXGALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDN-PKEKLIXXXXXXXXXXXXXSMCFKLMEEEIRYK 1184
            RFT F+FS  G   ++V Y+++G F F+ +E   E     ++ L  ++T +R+ E    +  N L +EN +   + +++ +L +   L     +G++G        W+  G+ L+SLTVITTIGYG   P+T WGK +TI+YAI+GIP   L L+NIG   +KAF   Y  L   +  +  +         +R  P      L++ ++   Y+  H      +V  N++D                            +  +++  V V  L  D      ++    V ++           F I+I YI  GA+ F++WE  ++L  +YFCF+TLSTIGFGD+VPG  + SD+  +EKL+    Y++VG+++ +MCF LM+EE+ YK
Sbjct:   26 RFTAFLFSHVGLCALVVGYSILGAFAFRALEAPYEVEKASQVILMREQTVRRLWEITDRF--NVLYRENWT---AAVSSEILDFQGRLIAAVKDGYDGKEIGTGQQWSFSGAFLYSLTVITTIGYGNIAPRTNWGKMVTILYAIVGIPLMLLYLTNIGDILAKAFRYVYGKLCTCRPAQHPQR--------RRRQPLPLHNHLQRNAAVENYRVHH------IVGHNSVD--------------------------LQDGKLRDDPVRVESLADDDVYEGGAKPRVSVPITLC---------FVIMIGYISGGAVIFSLWEGWEFLDGSYFCFVTLSTIGFGDLVPGDTVVSDSGSQEKLVICSLYLLVGMALIAMCFNLMQEEVIYK 359          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A194PRB2 (Potassium channel subfamily K member 18 OS=Papilio xuthus OX=66420 GN=RR46_11704 PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 1.926e-35
Identity = 112/400 (28.00%), Postives = 194/400 (48.50%), Query Frame = 3
Query:   48 KFIFSCAGSILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKY--TEELSKLKNE-------GWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKKQKENFTRLIHIKRSLPKQQEKKLKKVSSKLRYKRKH----PKGERNLVNWNNIDSDLFXXXXXXXXXXXXXXXXXXXXXXFN----------EWLIKNQSVNVSYLTYDRE-IPEQSETVEQVNLSYSQXXXXXXXXXXXXXXXXXXGALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIXXXXXXXXXXXXXSMCFKLMEEEI 1175
             F+FS  G I+++V YT+ G FMF+ IE   E      +++ +   +E+  N     L +N++L  +  N   LKY    ELSK +++       GW+G  G +   W+   + L+SLTVIT+IGYG  +P+T WGK +TI YA++G+P   L ++N+GQ  ++ F   Y                  L+ + R  P    +++ ++ ++L          P+G R+ V+ +++  D  I           D        D             + +++++ + SY+T+D + I         V + Y                 I+ G++ F +WE  D L  AYFCFI+LS+IGFGD VPG ++ +   +   I    Y+++G+++ +MCF LM+E++
Sbjct:   21 AFLFSNIGLIVLVVGYTVAGAFMFQAIEGASE------IERVNNMTLER--NNTAQYLWQNVTLALNLFNETALKYRLNIELSKYQSKIVTAVRNGWDG--GRSSRQWSFSSAFLYSLTVITSIGYGHLSPRTSWGKVMTIFYALLGMPLFLLYVTNVGQLLARWFKCLY-----------------ALVCLCRGCPGFGRRRVVRLRTQLETSEAESIECPEGWRHRVSESDVTPDYRIPPYAIYHQRRLDIRRLPHPLDPRYPHDRGWSEPAYRVESEASDFSYVTFDAQTITVPISVCVAVMVGY-----------------IMFGSMIFGLWEKWDQLDGAYFCFISLSSIGFGDFVPGERVYTPRIETSFIVCSLYLMLGIALGAMCFNLMQEQV 376          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A085M6W1 (Uncharacterized protein OS=Trichuris suis OX=68888 GN=M513_06073 PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.097e-32
Identity = 119/401 (29.68%), Postives = 214/401 (53.37%), Query Frame = 3
Query:   39 RFTKFIFSCAGSILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSN---LNNFLLK-YTEELSKLKN-EGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKF---LKKQKENFTRL---IHIKRSLPKQQEKKLKKVSSKLRYKRKHP---KGERN------LVNWNNIDSDLFXXXXXXXXXXXXXXXXXXXXXXFNEWLIKNQSVNVSYLTYDREIPEQSETVEQVNL--SYSQXXXXXXXXXXXXXXXXXXGALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIXXXXXXXXXXXXXSMCFKLMEEEI 1175
            +    +FS  G   ++  Y  MG  +F+ IE   E+ ++  M+  +Q I+++L    L   KE   L+P     L + LLK Y  +L    N EG++G   + +Y WT  G++L+S+T+ TTIGYG   PKT+ G+ +TI+YA+IGIP   L L+NI     + F   +++ R   F   +KKQ+    R    +    ++P+    K   +++ LR    +P   +G+++        +++N+DS+          ++S +  +     D  E +  ++  + + +  D +  E+S       L   Y   ++P+++    ++ +IL GA+ F +WE+ +    AYF F+TL+TIGFGD+VPG  +DS + +EKLI    Y++ G+++ +MCFKLM++++
Sbjct:   18 KVISLLFSHIGLCSLVASYAAMGAAVFRAIEFPLEQEVQGHMRNDTQLIMKEL----LKFTKEQAVLNPREWMELADGLLKDYETKLVHAVNFEGYDGEDEQIKYQWTFFGALLYSITIFTTIGYGHICPKTKLGRAITILYAMIGIPLMLLCLANIADSLVRLFT--FVYSRICCFYCRMKKQERWMKRANISVRYTNTVPRFNPCK-GNLNTSLRQSSTYPSFVEGKKSSSLRSKPTDFSNVDSNTVQLPKIVITNNSGETDVHWNLSDDEEVVGTSERSHEADVRSDFKRYEESAVKVPKRLVNQYRYEKVPVSVGILTVVLFILGGAVLFAVWENWNVFDGAYFSFVTLTTIGFGDMVPGKSLDSGS-QEKLIICSLYLLFGMALIAMCFKLMQDDV 410          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A0K0EYV5 (Potassium channel subfamily K member 18 (inferred by orthology to a human protein) OS=Strongyloides venezuelensis OX=75913 PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.513e-32
Identity = 113/384 (29.43%), Postives = 191/384 (49.74%), Query Frame = 3
Query:   33 LSRFTKFIFSCAGSILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKKQKENFTRLIHIKRSLPK-QQEKKLKKVSSKLRYKRKHPKGERNLV-NWNNIDSDLFXXXXXXXXXXXXXXXXXXXXXXFNEWLIKNQSVNVSYLTYDREIPEQSETVEQVNLSYSQXXXXXXXXXXXXXXXXXXGALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSD-NPKEKLIXXXXXXXXXXXXXSMCFKLMEEEI 1175
            + R   F FS  G   +++ Y L+G  +F+ +E   E+ ++ +++   QR V+   N      K N S     + + + K+ +       +G++G        WT  G+ L+SLTVITTIGYG  + KT +GK LTI++AIIGIP   L L+NIG   +K F   +L+ R  +F    K N   L H KR   K ++   L    ++ +  R++    R +V +  ++DS  F                           + N S +V  +   R   +Q E  E V     +I +P+ +    ++ Y++ GA+ F +WE   +L   YF +I+L+TIGFGD+ PG  + +D + ++KL+    Y++ G+++ +MCF L +EE+
Sbjct:   17 VKRIIAFFFSHVGLCALVIGYALLGAVVFRAVEGPHEQFVQSEIQIARQRAVDITWNATFRVNKLNKSQWQRVVFSQVKKFQKRTMWAIRKGYDGKEYGVSAQWTFTGAFLYSLTVITTIGYGNTSAKTYFGKTLTILFAIIGIPLMLLFLTNIGDVMAKIFR--FLYARSIRF----KYNVI-LWHKKRQAAKIRKANSLVAKLARAQTMRQYNGNLRGMVRDDTSLDSMGFG--------------------------VTNAS-DVREMLVARAHLDQLEVKESVEAQLQRISVPLFLVLLTMLAYLIAGAILFCLWEGWTFLDAFYFAYISLTTIGFGDLFPGASVGNDKDAQKKLVITSVYLLFGMALLAMCFNLAQEEV 366          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: KCNK4 (potassium channel subfamily K member 4-like [Source:NCBI gene;Acc:103026898])

HSP 1 Score: 75.485 bits (184), Expect = 2.217e-14
Identity = 46/145 (31.72%), Postives = 68/145 (46.90%), Query Frame = 3
Query:   84 IVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAF 518
            +++Y +MG  +F  +E   E       +K    + + L N     L+    +   NL+  L   TE +    N   N TF     SW L  +  FS T+ITTIGYG  +P+T+WGK   I YA++GIP     L+ +G H     
Sbjct:   76 VLLYLVMGALVFNALEAPAE-------EKQYNELYDNLRNTCSIFLESYSCISSENLHELLENITEAIEAGVNAK-NNTFSS---SWDLASAFFFSGTIITTIGYGNISPQTKWGKLFCICYALVGIPLFGFLLAGVGDHLGTGL 209          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: KCNK4 (potassium channel subfamily K member 4-like [Source:NCBI gene;Acc:103026898])

HSP 1 Score: 75.0998 bits (183), Expect = 2.661e-14
Identity = 46/145 (31.72%), Postives = 68/145 (46.90%), Query Frame = 3
Query:   84 IVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAF 518
            +++Y +MG  +F  +E   E       +K    + + L N     L+    +   NL+  L   TE +    N   N TF     SW L  +  FS T+ITTIGYG  +P+T+WGK   I YA++GIP     L+ +G H     
Sbjct:   30 VLLYLVMGALVFNALEAPAE-------EKQYNELYDNLRNTCSIFLESYSCISSENLHELLENITEAIEAGVNAK-NNTFSS---SWDLASAFFFSGTIITTIGYGNISPQTKWGKLFCICYALVGIPLFGFLLAGVGDHLGTGL 163          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: KCNK4 (potassium channel subfamily K member 4-like [Source:NCBI gene;Acc:103026898])

HSP 1 Score: 75.0998 bits (183), Expect = 2.668e-14
Identity = 46/145 (31.72%), Postives = 68/145 (46.90%), Query Frame = 3
Query:   84 IVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAF 518
            +++Y +MG  +F  +E   E       +K    + + L N     L+    +   NL+  L   TE +    N   N TF     SW L  +  FS T+ITTIGYG  +P+T+WGK   I YA++GIP     L+ +G H     
Sbjct:   13 VLLYLVMGALVFNALEAPAE-------EKQYNELYDNLRNTCSIFLESYSCISSENLHELLENITEAIEAGVNAK-NNTFSS---SWDLASAFFFSGTIITTIGYGNISPQTKWGKLFCICYALVGIPLFGFLLAGVGDHLGTGL 146          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: kcnk6 (potassium two pore domain channel subfamily K member 6 [Source:NCBI gene;Acc:103034804])

HSP 1 Score: 70.4774 bits (171), Expect = 4.220e-13
Identity = 51/164 (31.10%), Postives = 79/164 (48.17%), Query Frame = 3
Query:   33 LSRFTKFIFSCAGSILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEE----LSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSK 512
            +S F +      G +L  VVY L+G  +F  IE   E  +  ++     +I++ LS            ++ S L +FL K        +S L+N     + G N   W L  S+ F+ T++TT+GYG  TP +  GK  +IVYA+ G+PFT L L+   Q   +
Sbjct:    1 MSPFLRSFLLLGGLVLAYVVYLLLGALVFSAIERPVEDSLHSELSSLKAQILQ-LS-----------CINASTLEDFLEKVLRANKYGVSVLRNV----SVGSN---WDLASSLFFANTLVTTVGYGHTTPLSDAGKTFSIVYALFGVPFTMLVLTACVQRLMR 145          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: ENSAMXT00000047723.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:15897283:15919205:1 gene:ENSAMXG00000033807.1 transcript:ENSAMXT00000047723.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 8.889e-13
Identity = 46/161 (28.57%), Postives = 78/161 (48.45%), Query Frame = 3
Query:   66 AGSILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKS 548
            A  IL ++VY L+G  +F  IE  Q     L++ +  ++ V ++ N   N          +N++  +L+   E  K+  E +   + ++   W   GS+ F  TV TT+GYG   P T+ G+   I+YA +GIP   L ++++G   +  F   Y  L  S
Sbjct:  140 AALILSLIVYALLGAALFHAIEGTQSNDGTLEIHEGFRKFVHEVVNEARNKSTS------ANVSEEVLEAVGE--KILRE-FKAVWMQSSDRWHFYGSLFFCCTVFTTVGYGEIYPVTKAGRVACILYATVGIPLMLLVITDVGDILAVLFSNSYRRLHSS 291          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003416.1 (pep scaffold:Pmarinus_7.0:GL476517:78247:80718:1 gene:ENSPMAG00000003129.1 transcript:ENSPMAT00000003416.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 1.659e-15
Identity = 62/242 (25.62%), Postives = 104/242 (42.98%), Query Frame = 3
Query:  342 WTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKKQKENFTRLIHIKRSLPKQQEKKLKKVSSKLRYKRKHPKGERNLVN--WNNIDSDLFXXXXXXXXXXXXXXXXXXXXXXFNEWLIKNQSVNVSYLTYDREIPEQSETVEQVNLSYSQXXXXXXXXXXXXXXXXXXGALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVP 1061
            W   GS+ F  T+ TTIGYG   P T  GK + +VYA  GIP   L L+++G   ++     Y   R  + L   +       H     P+  +  L++  +K+    +H +GE + V+    +  SD+                             +     VS +    ++PE    V+++++ ++       + F I+  Y++ G      WE+  YL   YF F+T++TIG GDIVP
Sbjct:    2 WNFLGSLFFCCTIFTTIGYGHIAPSTDGGKIMCMVYATFGIPIMLLVLADVGDLLARTLTTIYTSFRH-RLLPGARCGRQ---HPPGDGPEGND--LQRSRTKIDDSHRH-EGEDDAVDVPLKSPGSDVEGG--------------------------RELPATVS-IAEGADVPEADREVKELDVPFT-------LIFLIVFVYLMFGTFLLPCWEEWSYLDAFYFVFVTMTTIGLGDIVP 202          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: kcnk7 (potassium channel, subfamily K, member 7 [Source:ZFIN;Acc:ZDB-GENE-110304-2])

HSP 1 Score: 71.2478 bits (173), Expect = 3.672e-14
Identity = 40/138 (28.99%), Postives = 68/138 (49.28%), Query Frame = 3
Query:   87 VVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQ 500
             +Y ++G  +F  +E   E R+++ +++     V           +++  L    L  FL    E  +   +   N T G +   W    ++ F+ TV+TT+GYG   P +  GK L I+YA++GIPFT L L++I Q
Sbjct:   17 ALYLVLGAIVFSTLERPYEERLRMDVRRLRDAFV-----------RQHACLSDEALEGFLRDALEARTHGVSALRNATAGPH---WDFVSALFFASTVLTTVGYGHTVPLSDAGKALCILYAVLGIPFTLLLLTSIVQ 140          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 65.4698 bits (158), Expect = 2.805e-12
Identity = 40/136 (29.41%), Postives = 69/136 (50.74%), Query Frame = 3
Query:   87 VVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGE--NEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLS 488
            V Y L G  +F+++E   E+ I+       QR+ +  + +I N    +  +D   L+ FL    +E+   ++ G     G+  +  +W    ++LF++TV+TTIGYG   P + WG+     YA++GIP     LS
Sbjct:   13 VAYLLAGAAVFQVLELPAEQNIR-------QRLTDSWAAFIQN----HSCVDDGTLDLFL----QEVLDARSHGVRVAAGQASSPSNWDFSSALLFTVTVVTTIGYGSTAPGSTWGRASCAFYALLGIPLNLQLLS 133          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 64.6994 bits (156), Expect = 3.887e-12
Identity = 40/136 (29.41%), Postives = 69/136 (50.74%), Query Frame = 3
Query:   87 VVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGE--NEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLS 488
            V Y L G  +F+++E   E+ I+       QR+ +  + +I N    +  +D   L+ FL    +E+   ++ G     G+  +  +W    ++LF++TV+TTIGYG   P + WG+     YA++GIP     LS
Sbjct:   23 VAYLLAGAAVFQVLELPAEQNIR-------QRLTDSWAAFIQN----HSCVDDGTLDLFL----QEVLDARSHGVRVAAGQASSPSNWDFSSALLFTVTVVTTIGYGSTAPGSTWGRASCAFYALLGIPLNLQLLS 143          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: KCNK10 (potassium two pore domain channel subfamily K member 10 [Source:HGNC Symbol;Acc:HGNC:6273])

HSP 1 Score: 53.9138 bits (128), Expect = 2.333e-8
Identity = 23/59 (38.98%), Postives = 32/59 (54.24%), Query Frame = 3
Query:  342 WTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAF 518
            W L  +  F+ TV+TTIGYG  +P T WG+     YA++GIP     L+ +G      F
Sbjct:  102 WDLGSAFFFAGTVLTTIGYGNVSPSTDWGRIFCTAYALVGIPIFGFLLAGVGDQLGTIF 160          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO35923 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK42])

HSP 1 Score: 87.0409 bits (214), Expect = 7.667e-20
Identity = 59/173 (34.10%), Postives = 87/173 (50.29%), Query Frame = 3
Query:   90 VYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKKQKENFTRLIHIKRSL 608
            VY L G  +F+ IE+ +ERR +   +   Q ++EK           NIS    ++ N      +E+SK  +EG+   F  N   W+  GS+ F+ TV+TTIGYG   P T WG+   I YAI GIP T L L +IG+  ++    F+  + +  F +  K      IH+K  L
Sbjct:    2 VYLLFGAAVFQTIESGEERRERHHFEFVRQNLIEKY----------NIS--EKDMRNLF----KEISKAIDEGY---FDVNYDRWSFAGSLFFTGTVVTTIGYGQMAPATVWGRVFCIFYAIFGIPITGLMLKSIGERITEGIADFWRIIDRRLFNRDPKS-----IHMKTVL 150          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO47668 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLC5])

HSP 1 Score: 70.8626 bits (172), Expect = 9.002e-14
Identity = 47/151 (31.13%), Postives = 80/151 (52.98%), Query Frame = 3
Query:   87 VVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIG----QHFSKAFCGF 527
            ++Y +MG  +F+ +E+  E++ + +++K  QRI  K  N     +KE               + + + K  + G    + E    W+  GS+ FS TVITTIGYG  +P+T +G+   ++YA+ GIP T+L L+++G    +H S    GF
Sbjct:   20 ILYLVMGMVVFRFLESGHEKKEREQVQKDIQRIRHKF-NISRKEMKE---------------FVDVVQKAASFGLTQDWLEK---WSYTGSLFFSGTVITTIGYGHLSPETFFGRIFCMLYALFGIPITWLMLTSLGKKIVEHISSFLQGF 151          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO37267 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG83])

HSP 1 Score: 66.6254 bits (161), Expect = 9.274e-13
Identity = 53/205 (25.85%), Postives = 85/205 (41.46%), Query Frame = 3
Query:   75 ILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGEN------EYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKKQKENFTRLIHIKRSLPKQQEKKLKKVSSKLRYKRKH 671
            + ++  Y L+G F+F+L+E +                           L+E + +      N L KY   +S+     W  TF  N         W    S +F++  +TTIGYG   PKT  G+   I YA++GIP T L+L  IG   S+  C    FL + + LK+ +     L     S+       L  ++S + Y++  
Sbjct:   15 VFLLTGYLLIGAFIFQLLERKN----------------------FATELRETVEIR----RNILAKY--NISRHDASRWARTFLSNPLMENISLEWNFGNSFVFAMVTVTTIGYGNIVPKTFGGRLFCIFYALLGIPGTCLTLKAIGDKISEKLCALIKFL-EMRVLKRPRPQHLELKTAVTSIVMAVCVVLPLLASVVYYRKSE 190          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO47667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLC4])

HSP 1 Score: 63.929 bits (154), Expect = 5.412e-12
Identity = 45/157 (28.66%), Postives = 77/157 (49.04%), Query Frame = 3
Query:   93 YTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYS--WTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGF--YLFLRKSK 551
            Y  +G  +F+ +E + E   +  M     +             ++  ++   ++  FL    E + ++ + G++      E+S  W+L GS+ F+ TV+TTIGYG  TP T  G+   I YA++GIP T+L LS + Q  +   C    YL+ R S+
Sbjct:    7 YIFLGAVIFQALEAKNEMAERRAMSFARLK------------FQQRYNISDEDMKVFL----ERIEEIVDHGFS-----REWSRRWSLLGSLFFAGTVVTTIGYGHVTPCTISGRVFCIFYALVGIPLTWLLLSTLAQGVNNMICASIRYLYDRFSR 142          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO33193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSX6])

HSP 1 Score: 63.929 bits (154), Expect = 1.185e-11
Identity = 27/60 (45.00%), Postives = 36/60 (60.00%), Query Frame = 3
Query:  327 ENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHF 506
             N Y W+  GS+ F+ TVITTIGYG   P+T  GK   ++YA +GIP       +IG+ F
Sbjct:   74 ANLYQWSFAGSVYFATTVITTIGYGHTVPRTPRGKIFCMIYAAVGIPLALTMFQSIGERF 133          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: KCNK4 (potassium channel subfamily K member 4 [Source:NCBI gene;Acc:101166075])

HSP 1 Score: 75.0998 bits (183), Expect = 2.589e-14
Identity = 45/143 (31.47%), Postives = 77/143 (53.85%), Query Frame = 3
Query:   84 IVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEK-LSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYS-WTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHF 506
            +++Y ++G  +F+ +E   ER+I+ + +K   R+ E  L N+          ++P +L +FL K  E +     EG   +  E  ++ W L  +  FS T+ITTIG+G  +P+T  GK   I YA++GIP   + L+ +G H 
Sbjct:   13 VLLYLVLGAVVFRTLEIPNERKIQEESEKQLSRVREHFLGNFSC--------VEPESLLDFLQKVEEVI-----EGLGSSSNETSFTKWDLASAFFFSGTIITTIGFGNISPQTDGGKLFCIFYALVGIPMFGILLAGVGDHL 142          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: KCNK4 (potassium channel subfamily K member 4 [Source:NCBI gene;Acc:101166075])

HSP 1 Score: 73.1738 bits (178), Expect = 8.101e-14
Identity = 44/142 (30.99%), Postives = 74/142 (52.11%), Query Frame = 3
Query:   84 IVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEK-LSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHF 506
            +++Y ++G  +F+ +E   ER+I+ + +K   R+ E  L N+          ++P +L +FL +  E L    NE        +   W L  +  FS T+ITTIG+G  +P+T  GK   I YA++GIP   + L+ +G H 
Sbjct:   13 VLLYLVLGAVVFRTLEIPNERKIQEESEKQLSRVREHFLGNFS--------CVEPESLLDFLQEVIEGLGSSSNE-------TSFTKWDLASAFFFSGTIITTIGFGNISPQTDGGKLFCIFYALVGIPMFGILLAGVGDHL 139          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk6 (potassium two pore domain channel subfamily K member 6 [Source:NCBI gene;Acc:101164174])

HSP 1 Score: 65.4698 bits (158), Expect = 1.496e-11
Identity = 45/147 (30.61%), Postives = 73/147 (49.66%), Query Frame = 3
Query:   66 AGSILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFG--ENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQ 500
            +G +L  V+Y L G  +F  IE   E R++  M+  ++   E L+   +N+         ++L  FLLK         N+      G      +W L  S+ F+ T++TT+GYG  +P +  GK  +I YA++G+PFT L L+   Q
Sbjct:   12 SGFVLFYVIYLLFGALVFSSIERPVEERLRHDMQVLTE---EFLNRSCVNA---------ASLELFLLKVLR-----ANKYGVSVIGNFSGATNWDLPSSMFFANTLVTTVGYGHTSPLSDAGKAFSIFYALLGVPFTMLVLTACVQ 141          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk10b (potassium two pore domain channel subfamily K member 10 [Source:NCBI gene;Acc:101162012])

HSP 1 Score: 65.855 bits (159), Expect = 2.912e-11
Identity = 48/170 (28.24%), Postives = 77/170 (45.29%), Query Frame = 3
Query:   78 LMIVVYTLMGGFMFKLIEN--QQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELS---KLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKKQKE 572
            +++V+Y + G   FK +E   +  ++  L ++K S              L+ +  + P  LN  +    + +S   +  +  +N +F      W L  +  F+ TVITTIGYG   P T+ GK   I YAI GIP     L+ IG      F    L + K +F +K K+
Sbjct:  105 IVVVLYLICGALAFKALEQPFETNQKTSLTLQKAS-------------FLERHPCVSPDELNTIIEHAMDAVSPGLRPLDTTYNSSF------WDLSSAFFFAGTVITTIGYGNIAPSTQGGKIFCIFYAIFGIPLFGFLLAGIGDQLGTIFVKSILKVEK-RFRQKHKQ 254          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk3b (potassium channel subfamily K member 3 [Source:NCBI gene;Acc:101165434])

HSP 1 Score: 65.0846 bits (157), Expect = 3.796e-11
Identity = 43/142 (30.28%), Postives = 71/142 (50.00%), Query Frame = 3
Query:   75 ILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQ 500
            I+ I+ Y ++G  +F+ +E++QER  + K++    R  E L  Y  N  + N      +L   +L+     + ++              W   GS  F++TVITTIGYG A P T  GK   + YA++GIP T +   ++G+
Sbjct:   12 IVSILTYLVVGAAVFETLESKQERSQRRKLEA---RKYELLRRY--NLTRANFE----DLELVVLQLKPHKAGVQ--------------WKFAGSFYFAITVITTIGYGHAAPSTDSGKVFCMFYALLGIPLTLVMFQSLGE 130          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000019992.1 (SMESG000019992.1)

HSP 1 Score: 607.06 bits (1564), Expect = 0.000e+0
Identity = 370/371 (99.73%), Postives = 371/371 (100.00%), Query Frame = 3
Query:   81 MIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKKQKENFTRLIHIKRSLPKQQEKKLKKVSSKLRYKRKHPKGERNLVNWNNIDSDLFXXXXXXXXXXXXXXXXXXXXXXFNEWLIKNQSVNVSYLTYDREIPEQSETVEQVNLSYSQXXXXXXXXXXXXXXXXXXGALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIXXXXXXXXXXXXXSMCFKLMEEEIRYKWKT 1193
            MIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKKQKENFTRLIHIKRSLPKQQEKKLKKVSSKLRYKRKHPKGERNLVNWNNIDSDLFIYSIESDESSSSDDAIPEIEEDFNEWLIKNQSVNVSYLTYDREIPEQSETVEQVNLSYSQIRIPIAITFAI+ICYILIGALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIFVVFYVVVGLSVFSMCFKLMEEEIRYKWKT
Sbjct:    1 MIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKKQKENFTRLIHIKRSLPKQQEKKLKKVSSKLRYKRKHPKGERNLVNWNNIDSDLFIYSIESDESSSSDDAIPEIEEDFNEWLIKNQSVNVSYLTYDREIPEQSETVEQVNLSYSQIRIPIAITFAIMICYILIGALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIFVVFYVVVGLSVFSMCFKLMEEEIRYKWKT 371          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000019992.1 (SMESG000019992.1)

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 363/364 (99.73%), Postives = 364/364 (100.00%), Query Frame = 3
Query:  102 MGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKKQKENFTRLIHIKRSLPKQQEKKLKKVSSKLRYKRKHPKGERNLVNWNNIDSDLFXXXXXXXXXXXXXXXXXXXXXXFNEWLIKNQSVNVSYLTYDREIPEQSETVEQVNLSYSQXXXXXXXXXXXXXXXXXXGALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIXXXXXXXXXXXXXSMCFKLMEEEIRYKWKT 1193
            MGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKKQKENFTRLIHIKRSLPKQQEKKLKKVSSKLRYKRKHPKGERNLVNWNNIDSDLFIYSIESDESSSSDDAIPEIEEDFNEWLIKNQSVNVSYLTYDREIPEQSETVEQVNLSYSQIRIPIAITFAI+ICYILIGALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIFVVFYVVVGLSVFSMCFKLMEEEIRYKWKT
Sbjct:    1 MGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKKQKENFTRLIHIKRSLPKQQEKKLKKVSSKLRYKRKHPKGERNLVNWNNIDSDLFIYSIESDESSSSDDAIPEIEEDFNEWLIKNQSVNVSYLTYDREIPEQSETVEQVNLSYSQIRIPIAITFAIMICYILIGALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIFVVFYVVVGLSVFSMCFKLMEEEIRYKWKT 364          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000019992.1 (SMESG000019992.1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 343/344 (99.71%), Postives = 344/344 (100.00%), Query Frame = 3
Query:  162 MKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKKQKENFTRLIHIKRSLPKQQEKKLKKVSSKLRYKRKHPKGERNLVNWNNIDSDLFXXXXXXXXXXXXXXXXXXXXXXFNEWLIKNQSVNVSYLTYDREIPEQSETVEQVNLSYSQXXXXXXXXXXXXXXXXXXGALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIXXXXXXXXXXXXXSMCFKLMEEEIRYKWKT 1193
            MKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKKQKENFTRLIHIKRSLPKQQEKKLKKVSSKLRYKRKHPKGERNLVNWNNIDSDLFIYSIESDESSSSDDAIPEIEEDFNEWLIKNQSVNVSYLTYDREIPEQSETVEQVNLSYSQIRIPIAITFAI+ICYILIGALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIFVVFYVVVGLSVFSMCFKLMEEEIRYKWKT
Sbjct:    1 MKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKKQKENFTRLIHIKRSLPKQQEKKLKKVSSKLRYKRKHPKGERNLVNWNNIDSDLFIYSIESDESSSSDDAIPEIEEDFNEWLIKNQSVNVSYLTYDREIPEQSETVEQVNLSYSQIRIPIAITFAIMICYILIGALFFTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIFVVFYVVVGLSVFSMCFKLMEEEIRYKWKT 344          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000068804.1 (SMESG000068804.1)

HSP 1 Score: 116.316 bits (290), Expect = 6.360e-28
Identity = 91/275 (33.09%), Postives = 136/275 (49.45%), Query Frame = 3
Query:   12 LEIIKRGLSRFTKFIFSCAGSILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKENISLD-----------------PSN---LNNFL----LKYTEELSK-LKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAF-------CGFYLFLRKSKFLKKQKENFTRLIH-----------IKRSLPKQQ-------EKKLKKVSSKL-RYKRKHPKGE 683
            +E  K+   RF  F+FS  G   ++V Y ++GGFMF+ +E   E         T +R+ +  +++I  ++K  ISL+                 P N   LNN+L    + YT  +   ++ EGWNG       +W+ EG++L+ LTVITTIGYG   PKT+ GKF+T++YA++GIP TFL LSNIG + +  F       C  Y  +   K  K      ++LI            IKR  PKQ        +K +K++  KL R+  K  K +
Sbjct:   60 IEKTKQCCKRFFTFLFSHIGLSAILVGYVIIGGFMFQSLEISNEIN-------TKKRVKDHRNDFIKATIKNLISLNLTWNNTDIMNNSSDINKPGNQTLLNNYLTMVIINYTNNVIFFMQEEGWNGNDDVTALNWSYEGALLYVLTVITTIGYGHVAPKTKLGKFITMLYALLGIPLTFLYLSNIGDYLADWFRFIYHKVCRKYCKMCCQKSRKHHSGLRSKLIKANAFPGMSKKVIKRDRPKQMIKPNNFFDKSIKQLREKLMRFPLKTKKSD 327          

HSP 2 Score: 103.99 bits (258), Expect = 7.258e-24
Identity = 55/73 (75.34%), Postives = 65/73 (89.04%), Query Frame = 3
Query:  972 FTIWEDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIXXXXXXXXXXXXXSMCFKLMEEEIRYKWK 1190
            FT+W D D+LKW+YFCFITLSTIGFGDIVPGTK+DS NPKEKLI V  YV++GLSVF+MCFKLM+EE+  K+K
Sbjct:  548 FTVWGDLDFLKWSYFCFITLSTIGFGDIVPGTKVDSKNPKEKLIIVSIYVIIGLSVFAMCFKLMQEEVVAKFK 620          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000019203.1 (SMESG000019203.1)

HSP 1 Score: 109.383 bits (272), Expect = 3.424e-26
Identity = 65/162 (40.12%), Postives = 93/162 (57.41%), Query Frame = 3
Query:   42 FTKFIFSCAGSILMIVVYTLMGGFMFKLIENQQERRIKLKMKKTSQRIVEKLSNYILNSLKE--NISLDPSNLNNFLLKYTEELSK-LKNEGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYAIIGIPFTFLSLSNIGQHFSKAF 518
            F   +FS  G   ++V YT++GGF+F  IE   E  +K +MK        KL   + + +K   N S   +N+   L ++     + +   GWNG +   E +W+ EGSIL+S+TVITTIGYG  TPKT+ G+  TI YAI GIP T L L+NIG + ++ F
Sbjct:   20 FCSCLFSHIGLSGLVVAYTILGGFLFYNIEISGEINVKNQMKIVRNETENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIF 181          

HSP 2 Score: 99.7525 bits (247), Expect = 9.762e-23
Identity = 55/79 (69.62%), Postives = 61/79 (77.22%), Query Frame = 3
Query:  960 GALFFTIW-EDNDYLKWAYFCFITLSTIGFGDIVPGTKIDSDNPKEKLIXXXXXXXXXXXXXSMCFKLMEEEIRYKWKT 1193
            GA  FT W  DNDYLKW+YFCFITLSTIGFGDIVPG  +   NPKEKLI  V YV +GL VF+MCFKLME+EI  K K+
Sbjct:  341 GAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVPGISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKS 419          
The following BLAST results are available for this feature:
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNK163.954e-1130.72potassium two pore domain channel subfamily K memb... [more]
KCNK164.604e-1131.13potassium two pore domain channel subfamily K memb... [more]
KCNK165.478e-1130.72potassium two pore domain channel subfamily K memb... [more]
KCNK185.788e-1128.83potassium two pore domain channel subfamily K memb... [more]
KCNK165.903e-1130.72potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
twk-487.840e-3329.37TWiK family of potassium channels [Source:UniProt... [more]
twk-392.076e-2033.53TWiK family of potassium channels [Source:UniProt... [more]
twk-392.293e-2033.53TWiK family of potassium channels [Source:UniProt... [more]
twk-184.207e-1931.34TWiK family of potassium channels protein 18 [Sou... [more]
twk-184.207e-1931.34TWiK family of potassium channels protein 18 [Sou... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sand3.705e-2337.43gene:FBgn0033257 transcript:FBtr0088780[more]
CG91946.018e-2033.33gene:FBgn0035192 transcript:FBtr0072651[more]
CG16882.369e-1726.17gene:FBgn0027589 transcript:FBtr0088495[more]
CG108647.478e-1728.32gene:FBgn0038621 transcript:FBtr0083654[more]
CG343969.846e-1632.10gene:FBgn0085425 transcript:FBtr0112645[more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk185.906e-1429.19potassium channel, subfamily K, member 18 [Source:... [more]
kcnk182.961e-1329.19potassium channel, subfamily K, member 18 [Source:... [more]
kcnk182.988e-1329.19potassium channel, subfamily K, member 18 [Source:... [more]
kcnk1a4.632e-1228.08potassium channel, subfamily K, member 1a [Source:... [more]
kcnk1a4.632e-1228.08potassium channel, subfamily K, member 1a [Source:... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk67.397e-1331.76potassium channel, two pore domain subfamily K, me... [more]
kcnk69.673e-1331.76potassium channel, two pore domain subfamily K, me... [more]
bcdin3d2.459e-1024.66BCDIN3 domain containing RNA methyltransfease [Sou... [more]
stk266.246e-1031.41serine/threonine kinase 26 [Source:Xenbase;Acc:XB-... [more]
stk266.738e-1032.12serine/threonine kinase 26 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnk182.654e-1228.87potassium channel, subfamily K, member 18 [Source:... [more]
Kcnk156.271e-1231.03potassium channel, subfamily K, member 15 [Source:... [more]
Kcnk158.365e-1231.72potassium channel, subfamily K, member 15 [Source:... [more]
Kcnk162.290e-1131.21potassium channel, subfamily K, member 16 [Source:... [more]
Kcnk98.776e-1132.17potassium channel, subfamily K, member 9 [Source:M... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q18120|TWK18_CAEEL5.352e-1831.34TWiK family of potassium channels protein 18 OS=Ca... [more]
sp|P34410|TWK7_CAEEL2.312e-1328.02TWiK family of potassium channels protein 7 OS=Cae... [more]
sp|Q6Q1P3|KCNKI_RAT1.290e-1130.50Potassium channel subfamily K member 18 OS=Rattus ... [more]
sp|Q6VV64|KCNKI_MOUSE1.857e-1128.87Potassium channel subfamily K member 18 OS=Mus mus... [more]
sp|Q8R5I0|KCNKF_RAT4.397e-1131.03Potassium channel subfamily K member 15 OS=Rattus ... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7U1G04.100e-5034.27Uncharacterized protein (Fragment) OS=Capitella te... [more]
A0A4D5S2931.296e-4030.93Putative potassium channel subfamily protein k mem... [more]
A0A194PRB21.926e-3528.00Potassium channel subfamily K member 18 OS=Papilio... [more]
A0A085M6W11.097e-3229.68Uncharacterized protein OS=Trichuris suis OX=68888... [more]
A0A0K0EYV52.513e-3229.43Potassium channel subfamily K member 18 (inferred ... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNK42.217e-1431.72potassium channel subfamily K member 4-like [Sourc... [more]
KCNK42.661e-1431.72potassium channel subfamily K member 4-like [Sourc... [more]
KCNK42.668e-1431.72potassium channel subfamily K member 4-like [Sourc... [more]
kcnk64.220e-1331.10potassium two pore domain channel subfamily K memb... [more]
ENSAMXT00000047723.18.889e-1328.57pep primary_assembly:Astyanax_mexicanus-2.0:9:1589... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003416.11.659e-1525.62pep scaffold:Pmarinus_7.0:GL476517:78247:80718:1 g... [more]
kcnk73.672e-1428.99potassium channel, subfamily K, member 7 [Source:Z... [more]
KCNK162.805e-1229.41potassium two pore domain channel subfamily K memb... [more]
KCNK163.887e-1229.41potassium two pore domain channel subfamily K memb... [more]
KCNK102.333e-838.98potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO359237.667e-2034.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476689.002e-1431.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372679.274e-1325.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476675.412e-1228.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331931.185e-1145.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNK42.589e-1431.47potassium channel subfamily K member 4 [Source:NCB... [more]
KCNK48.101e-1430.99potassium channel subfamily K member 4 [Source:NCB... [more]
kcnk61.496e-1130.61potassium two pore domain channel subfamily K memb... [more]
kcnk10b2.912e-1128.24potassium two pore domain channel subfamily K memb... [more]
kcnk3b3.796e-1130.28potassium channel subfamily K member 3 [Source:NCB... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019992.10.000e+099.73SMESG000019992.1[more]
SMESG000019992.10.000e+099.73SMESG000019992.1[more]
SMESG000019992.10.000e+099.71SMESG000019992.1[more]
SMESG000068804.16.360e-2833.09SMESG000068804.1[more]
SMESG000019203.13.424e-2640.12SMESG000019203.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034472 ID=SMED30034472|Name=Potassium channel subfamily K member 18|organism=Schmidtea mediterranea sexual|type=transcript|length=1195bp
TCTTCCGATCTCTGGAAATAATAAAAAGAGGACTGTCGAGATTTACAAAA
TTTATTTTCTCATGCGCCGGTTCCATCTTGATGATTGTGGTTTACACTTT
GATGGGGGGGTTTATGTTCAAGTTAATTGAAAATCAACAAGAGAGAAGAA
TCAAACTCAAAATGAAGAAAACATCTCAACGGATTGTTGAAAAGTTGAGT
AATTATATTCTGAATTCACTGAAAGAAAACATCAGTTTGGATCCATCGAA
TTTAAACAATTTCCTTCTCAAATACACAGAGGAATTGAGTAAATTGAAAA
ACGAAGGATGGAATGGGACATTTGGAGAAAATGAATACAGTTGGACTCTT
GAAGGATCTATTTTATTTTCCCTGACTGTTATCACAACAATAGGATATGG
TGTAGCTACACCGAAAACCAGATGGGGGAAATTCTTGACCATCGTATACG
CCATAATCGGAATTCCGTTTACATTTTTGTCGTTGTCAAATATCGGTCAA
CATTTTAGCAAAGCGTTTTGTGGATTTTATCTTTTTTTAAGAAAGTCAAA
GTTTTTGAAAAAACAAAAGGAAAATTTCACTAGACTGATACATATAAAAC
GCTCACTTCCGAAGCAACAAGAAAAAAAATTGAAAAAAGTTTCTTCAAAA
TTACGATACAAGAGAAAACATCCCAAAGGAGAAAGAAATCTTGTTAATTG
GAATAATATTGACTCAGATTTGTTTATTTATTCAATTGAATCGGATGAAA
GCAGTTCCAGCGATGACGCAATTCCGGAAATTGAAGAAGATTTCAATGAA
TGGTTGATAAAAAACCAAAGTGTCAATGTCAGTTACTTAACCTATGACCG
AGAGATTCCGGAACAAAGTGAAACTGTCGAACAAGTGAACCTTTCTTATT
CACAAATCAGAATCCCCATCGCAATAACGTTTGCAATTATTATATGCTAT
ATTCTAATTGGGGCTCTCTTTTTCACAATTTGGGAAGACAATGATTACCT
GAAATGGGCTTACTTTTGTTTCATAACATTATCAACGATCGGATTCGGAG
ACATCGTTCCAGGCACAAAAATCGATTCAGATAATCCAAAAGAAAAATTA
ATTTTTGTTGTTTTTTATGTAGTAGTGGGCCTGTCGGTCTTTTCAATGTG
TTTCAAATTGATGGAGGAAGAAATAAGATACAAATGGAAAACGTT
back to top

protein sequence of SMED30034472-orf-1

>SMED30034472-orf-1 ID=SMED30034472-orf-1|Name=SMED30034472-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=397bp
FRSLEIIKRGLSRFTKFIFSCAGSILMIVVYTLMGGFMFKLIENQQERRI
KLKMKKTSQRIVEKLSNYILNSLKENISLDPSNLNNFLLKYTEELSKLKN
EGWNGTFGENEYSWTLEGSILFSLTVITTIGYGVATPKTRWGKFLTIVYA
IIGIPFTFLSLSNIGQHFSKAFCGFYLFLRKSKFLKKQKENFTRLIHIKR
SLPKQQEKKLKKVSSKLRYKRKHPKGERNLVNWNNIDSDLFIYSIESDES
SSSDDAIPEIEEDFNEWLIKNQSVNVSYLTYDREIPEQSETVEQVNLSYS
QIRIPIAITFAIIICYILIGALFFTIWEDNDYLKWAYFCFITLSTIGFGD
IVPGTKIDSDNPKEKLIFVVFYVVVGLSVFSMCFKLMEEEIRYKWKT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR0032802pore_dom_K_chnl
IPR013099K_chnl_dom
Vocabulary: biological process
TermDefinition
GO:0071805potassium ion transmembrane transport
GO:0006810transport
GO:0006811ion transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005267potassium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003280Two pore domain potassium channelPRINTSPR013332POREKCHANELcoord: 341..350
score: 75.16
coord: 122..150
score: 53.81
IPR013099Potassium channel domainPFAMPF07885Ion_trans_2coord: 309..384
e-value: 3.3E-18
score: 65.4
coord: 106..165
e-value: 6.2E-16
score: 58.1
NoneNo IPR availablePANTHERPTHR11003:SF276TWIK FAMILY OF POTASSIUM CHANNELScoord: 9..391
NoneNo IPR availablePANTHERPTHR11003POTASSIUM CHANNEL, SUBFAMILY Kcoord: 9..391
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 296..390
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 8..166
NoneNo IPR availableTMHMMTMhelixcoord: 364..381
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 330..349
NoneNo IPR availableTMHMMTMhelixcoord: 144..166
NoneNo IPR availableTMHMMTMhelixcoord: 301..323
NoneNo IPR availableTMHMMTMhelixcoord: 110..132