PDZ ring finger protein 4

Overview
NamePDZ ring finger protein 4 (AHY82407.1)
Smed IDSMED30034470
Length (bp)2802
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PDZ ring finger protein 4 (SMED30034470) t-SNE clustered cells

Violin plots show distribution of expression levels for PDZ ring finger protein 4 (SMED30034470) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PDZ ring finger protein 4 (SMED30034470) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PDZ ring finger protein 4 (SMED30034470) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034470

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30034470h1SMcG0002061 dd_Smed_v4_5781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034470h1SMcG0002061 dd_Smed_v4_5781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034470h1SMcG0002061 dd_Smed_v4_5781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034470h1SMcG0002061 dd_Smed_v4_5781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30034470h1SMcG0002061 dd_Smed_v4_5781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034470h1SMcG0002061 dd_Smed_v4_5781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30034470h1SMcG0002061 dd_Smed_v4_5781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034470h1SMcG0002061 dd_Smed_v4_5781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034470 dd_Smed_v4_35942_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034470 dd_Smed_v4_35942_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034470 dd_Smed_v4_35942_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PDZ ring finger protein 4 vs. Ensembl Human
Match: PDZRN4 (PDZ domain containing ring finger 4 [Source:HGNC Symbol;Acc:HGNC:30552])

HSP 1 Score: 92.0485 bits (227), Expect = 3.074e-18
Identity = 111/365 (30.41%), Postives = 158/365 (43.29%), Query Frame = 2
Query:  587 ILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARRYSIS-------------NTSVKPTIPF--MMDLS-VNIPTQSTNDYILPYPSSVFGQPLHGYINSSQKTNQINNHTDSNHSLSS-----YSNNCALKSFLNDAIKNRD-DYSCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF--QKCGLEVKLLLGRPNI-ISKFNGNTNRNGNYSSEL-------------PPLEEVEYASVYDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSEC-----DSNQTSLK 1549
            I++VNGKDLS A+H++ +EAF +A EPI V+V RR  +S             N S +  I F  +M L+ +  PT    D I P+  S                       DS HSL       Y +N  + S   DA +  D +Y                                EV L +  S+E  GLT+ Y      D  ++ +Y+S ++PNS+A K+  IR GD+ILQIN  DV ++ + V+L    +C   + LL+ RP I + +      RN                    P   EVE     +E EG T+     +   +KDSG+GR TDE+ + +ESSE      D N TSLK
Sbjct:  279 IMEVNGKDLSKATHEEAVEAFRNAKEPIVVQVLRRTPLSRPAYGMASEVQLMNASTQTDITFEHIMALAKLRPPTPPVPD-ICPFLLS-----------------------DSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYE-------------------------------EVELCRVSSQEKLGLTVCYRT---DDEEDTGIYVSEVDPNSIAAKDGRIREGDRILQINGEDVQNREEAVALLSNDECK-RIVLLVARPEIQLDEGWLEDERNEFLEELNLEMLEEEHNEAMQPTANEVEQPKKQEEEEGTTDTATSSSNNHEKDSGVGR-TDESLRNDESSEQENAAEDPNSTSLK 583          

HSP 2 Score: 72.0182 bits (175), Expect = 4.620e-12
Identity = 69/235 (29.36%), Postives = 113/235 (48.09%), Query Frame = 2
Query: 1817 NTSAYSTGADSTRSSPLTMELPPTISSASFLSL--KIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRM-----ASSTIL-----HQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQL------IKSDKL-DSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            ++SAY+T A+S RS+PLT++  P  S    ++L  K ++R+        +   S   T      ++Q  ++ S    L  S++     A S  +     +  SS  +  IP H+       +Y  Y  L                 I+Q + VE   Y  +QL       +S K  + KMEW VK R DGTRYIT+RP+R+R++K+R  K+ EER+  T ++D  +++ + R W+
Sbjct:  735 SSSAYNT-AESCRSTPLTVDRSPDSSLPRVINLTNKKNLRSTMAATQSSSGQSSKESTSTKAKTTEQGCSAESKEKVLEGSKLPDQEKAVSEHIPYLSPYHSSSYRYANIPAHA------RHYQSYMQL-----------------IQQKSAVE---YAQSQLSLVSMCKESQKCSEPKMEWKVKIRSDGTRYITKRPVRDRILKERALKIKEERSGMTTDDDTMSEMKMGRYWS 942          
BLAST of PDZ ring finger protein 4 vs. Ensembl Human
Match: PDZRN4 (PDZ domain containing ring finger 4 [Source:HGNC Symbol;Acc:HGNC:30552])

HSP 1 Score: 89.7373 bits (221), Expect = 1.109e-17
Identity = 110/370 (29.73%), Postives = 160/370 (43.24%), Query Frame = 2
Query:  572 RMDFIILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARRYSIS-------------NTSVKPTIPF--MMDLS-VNIPTQSTNDYILPYPSSVFGQPLHGYINSSQKTNQINNHTDSNHSL-----SSYSNNCALKSFLNDAIKNRD-DYSCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF--QKCGLEVKLLLGRPNI-ISKFNGNTNRNGNYSSEL-------------PPLEEVEYASVYDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSEC-----DSNQTSLK 1549
            ++ + + +VNGKDLS A+H++ +EAF +A EPI V+V RR  +S             N S +  I F  +M L+ +  PT    D I P+  S                       DS HSL       Y +N  + S   DA +  D +Y                                EV L +  S+E  GLT+ Y      D  ++ +Y+S ++PNS+A K+  IR GD+ILQIN  DV ++ + V+L    +C   + LL+ RP I + +      RN                    P   EVE     +E EG T+     +   +KDSG+GR TDE+ + +ESSE      D N TSLK
Sbjct:   16 KLLYEVSQVNGKDLSKATHEEAVEAFRNAKEPIVVQVLRRTPLSRPAYGMASEVQLMNASTQTDITFEHIMALAKLRPPTPPVPD-ICPFLLS-----------------------DSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYE-------------------------------EVELCRVSSQEKLGLTVCYRT---DDEEDTGIYVSEVDPNSIAAKDGRIREGDRILQINGEDVQNREEAVALLSNDECK-RIVLLVARPEIQLDEGWLEDERNEFLEELNLEMLEEEHNEAMQPTANEVEQPKKQEEEEGTTDTATSSSNNHEKDSGVGR-TDESLRNDESSEQENAAEDPNSTSLK 325          

HSP 2 Score: 71.633 bits (174), Expect = 5.273e-12
Identity = 69/235 (29.36%), Postives = 113/235 (48.09%), Query Frame = 2
Query: 1817 NTSAYSTGADSTRSSPLTMELPPTISSASFLSL--KIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRM-----ASSTIL-----HQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQL------IKSDKL-DSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            ++SAY+T A+S RS+PLT++  P  S    ++L  K ++R+        +   S   T      ++Q  ++ S    L  S++     A S  +     +  SS  +  IP H+       +Y  Y  L                 I+Q + VE   Y  +QL       +S K  + KMEW VK R DGTRYIT+RP+R+R++K+R  K+ EER+  T ++D  +++ + R W+
Sbjct:  477 SSSAYNT-AESCRSTPLTVDRSPDSSLPRVINLTNKKNLRSTMAATQSSSGQSSKESTSTKAKTTEQGCSAESKEKVLEGSKLPDQEKAVSEHIPYLSPYHSSSYRYANIPAHA------RHYQSYMQL-----------------IQQKSAVE---YAQSQLSLVSMCKESQKCSEPKMEWKVKIRSDGTRYITKRPVRDRILKERALKIKEERSGMTTDDDTMSEMKMGRYWS 684          
BLAST of PDZ ring finger protein 4 vs. Ensembl Human
Match: PDZRN4 (PDZ domain containing ring finger 4 [Source:HGNC Symbol;Acc:HGNC:30552])

HSP 1 Score: 88.9669 bits (219), Expect = 2.019e-17
Identity = 110/362 (30.39%), Postives = 155/362 (42.82%), Query Frame = 2
Query:  596 VNGKDLSTASHQQVLEAFNSASEPIFVEVARRYSIS-------------NTSVKPTIPF--MMDLS-VNIPTQSTNDYILPYPSSVFGQPLHGYINSSQKTNQINNHTDSNHSL-----SSYSNNCALKSFLNDAIKNRD-DYSCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF--QKCGLEVKLLLGRPNI-ISKFNGNTNRNGNYSSEL-------------PPLEEVEYASVYDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSEC-----DSNQTSLK 1549
            VNGKDLS A+H++ +EAF +A EPI V+V RR  +S             N S +  I F  +M L+ +  PT    D I P+  S                       DS HSL       Y +N  + S   DA +  D +Y                                EV L +  S+E  GLT+ Y      D  ++ +Y+S ++PNS+A K+  IR GD+ILQIN  DV ++ + V+L    +C   + LL+ RP I + +      RN                    P   EVE     +E EG T+     +   +KDSG+GR TDE+ + +ESSE      D N TSLK
Sbjct:   22 VNGKDLSKATHEEAVEAFRNAKEPIVVQVLRRTPLSRPAYGMASEVQLMNASTQTDITFEHIMALAKLRPPTPPVPD-ICPFLLS-----------------------DSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYE-------------------------------EVELCRVSSQEKLGLTVCYRT---DDEEDTGIYVSEVDPNSIAAKDGRIREGDRILQINGEDVQNREEAVALLSNDECK-RIVLLVARPEIQLDEGWLEDERNEFLEELNLEMLEEEHNEAMQPTANEVEQPKKQEEEEGTTDTATSSSNNHEKDSGVGR-TDESLRNDESSEQENAAEDPNSTSLK 323          

HSP 2 Score: 71.633 bits (174), Expect = 5.542e-12
Identity = 69/235 (29.36%), Postives = 113/235 (48.09%), Query Frame = 2
Query: 1817 NTSAYSTGADSTRSSPLTMELPPTISSASFLSL--KIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRM-----ASSTIL-----HQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQL------IKSDKL-DSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            ++SAY+T A+S RS+PLT++  P  S    ++L  K ++R+        +   S   T      ++Q  ++ S    L  S++     A S  +     +  SS  +  IP H+       +Y  Y  L                 I+Q + VE   Y  +QL       +S K  + KMEW VK R DGTRYIT+RP+R+R++K+R  K+ EER+  T ++D  +++ + R W+
Sbjct:  475 SSSAYNT-AESCRSTPLTVDRSPDSSLPRVINLTNKKNLRSTMAATQSSSGQSSKESTSTKAKTTEQGCSAESKEKVLEGSKLPDQEKAVSEHIPYLSPYHSSSYRYANIPAHA------RHYQSYMQL-----------------IQQKSAVE---YAQSQLSLVSMCKESQKCSEPKMEWKVKIRSDGTRYITKRPVRDRILKERALKIKEERSGMTTDDDTMSEMKMGRYWS 682          
BLAST of PDZ ring finger protein 4 vs. Ensembl Human
Match: PDZRN3 (PDZ domain containing ring finger 3 [Source:HGNC Symbol;Acc:HGNC:17704])

HSP 1 Score: 72.0182 bits (175), Expect = 1.527e-12
Identity = 57/172 (33.14%), Postives = 91/172 (52.91%), Query Frame = 2
Query: 1064 LRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNII--SKFNGNTNRNGNYSSELPPLEEVEY------ASV-----YDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSECDSN 1534
            L +  S++  GLT+ Y      D  +  +YIS I+PNS+A K+  IR GD+I+QIN I+V ++ + V+L   +      LL+ RP +     +  +   +      +  LEE  +      ASV     +DE  G T+     + Q +KDSG+GR TDE+ + +ESSE ++N
Sbjct:   19 LYRMNSQDKLGLTVCYRT---DDEDDIGIYISEIDPNSIAAKDGRIREGDRIIQINGIEVQNREEAVALLTSEENKNFSLLIARPELQLDEGWMDDDRNDFLDDLHMDMLEEQHHQAMQFTASVLQQKKHDEDGGTTDTATILSNQHEKDSGVGR-TDESTRNDESSEQENN 186          

HSP 2 Score: 62.3882 bits (150), Expect = 1.743e-9
Identity = 28/71 (39.44%), Postives = 48/71 (67.61%), Query Frame = 2
Query: 2252 YINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            +I+A    +D L   + W VK R DGTRYIT+RP+R+R++++R  K+ EER+  T ++D  +++ + R W+
Sbjct:  222 FISADCTDADYL--GIPWKVKIRSDGTRYITKRPVRDRLLRERALKIREERSGMTTDDDAVSEMKMGRYWS 290          
BLAST of PDZ ring finger protein 4 vs. Ensembl Human
Match: PDZRN3 (PDZ domain containing ring finger 3 [Source:HGNC Symbol;Acc:HGNC:17704])

HSP 1 Score: 72.4034 bits (176), Expect = 1.796e-12
Identity = 57/172 (33.14%), Postives = 91/172 (52.91%), Query Frame = 2
Query: 1064 LRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNII--SKFNGNTNRNGNYSSELPPLEEVEY------ASV-----YDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSECDSN 1534
            L +  S++  GLT+ Y      D  +  +YIS I+PNS+A K+  IR GD+I+QIN I+V ++ + V+L   +      LL+ RP +     +  +   +      +  LEE  +      ASV     +DE  G T+     + Q +KDSG+GR TDE+ + +ESSE ++N
Sbjct:  120 LYRMNSQDKLGLTVCYRT---DDEDDIGIYISEIDPNSIAAKDGRIREGDRIIQINGIEVQNREEAVALLTSEENKNFSLLIARPELQLDEGWMDDDRNDFLDDLHMDMLEEQHHQAMQFTASVLQQKKHDEDGGTTDTATILSNQHEKDSGVGR-TDESTRNDESSEQENN 287          
BLAST of PDZ ring finger protein 4 vs. Ensembl Celegans
Match: C50F7.6 (pep chromosome:WBcel235:IV:7720566:7723199:-1 gene:WBGene00016846.1 transcript:C50F7.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C50F7.6)

HSP 1 Score: 52.373 bits (124), Expect = 1.054e-6
Identity = 23/55 (41.82%), Postives = 38/55 (69.09%), Query Frame = 2
Query: 2300 EWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            +W VK+R DG+RYI +RPIR++++K RE ++  ER   + ++D  ++L L R  T
Sbjct:  285 KWKVKRRCDGSRYIVKRPIRSQILKKREAQVYRERAPISTDDDAMSELKLGRYHT 339          
BLAST of PDZ ring finger protein 4 vs. Ensembl Celegans
Match: C50F7.6 (pep chromosome:WBcel235:IV:7720568:7722408:-1 gene:WBGene00016846.1 transcript:C50F7.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C50F7.6)

HSP 1 Score: 51.9878 bits (123), Expect = 1.144e-6
Identity = 23/55 (41.82%), Postives = 38/55 (69.09%), Query Frame = 2
Query: 2300 EWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            +W VK+R DG+RYI +RPIR++++K RE ++  ER   + ++D  ++L L R  T
Sbjct:  200 KWKVKRRCDGSRYIVKRPIRSQILKKREAQVYRERAPISTDDDAMSELKLGRYHT 254          
BLAST of PDZ ring finger protein 4 vs. Ensembl Fly
Match: Slip1 (gene:FBgn0024728 transcript:FBtr0310536)

HSP 1 Score: 54.6842 bits (130), Expect = 4.070e-7
Identity = 29/72 (40.28%), Postives = 43/72 (59.72%), Query Frame = 2
Query: 2258 NAQLIKSDKLDS-KMEWVVKKRPDGTRYITRRPIRNR--MMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            NA L+  +  +   M W VK+RPDGTRYI +RP+RNR  +   +  + NE    TT E+D  +++ + R WT
Sbjct:  569 NATLLNGESAEEIPMVWKVKRRPDGTRYIVKRPVRNRPQVALRKNMRYNE---VTTTEDDTISEVKIGRYWT 637          
BLAST of PDZ ring finger protein 4 vs. Ensembl Fly
Match: Slip1 (gene:FBgn0024728 transcript:FBtr0089090)

HSP 1 Score: 54.6842 bits (130), Expect = 4.338e-7
Identity = 26/58 (44.83%), Postives = 37/58 (63.79%), Query Frame = 2
Query: 2297 MEWVVKKRPDGTRYITRRPIRNR--MMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            M W VK+RPDGTRYI +RP+RNR  +   +  + NE    TT E+D  +++ + R WT
Sbjct:  689 MVWKVKRRPDGTRYIVKRPVRNRPQVALRKNMRYNE---VTTTEDDTISEVKIGRYWT 743          
BLAST of PDZ ring finger protein 4 vs. Ensembl Zebrafish
Match: BX640588.1 (pep chromosome:GRCz11:CHR_ALT_CTG6_1_42:44244096:44258433:-1 gene:ENSDARG00000115237.1 transcript:ENSDART00000180410.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX640588.1)

HSP 1 Score: 70.0922 bits (170), Expect = 8.609e-12
Identity = 68/233 (29.18%), Postives = 113/233 (48.50%), Query Frame = 2
Query: 1796 LPPASGSNTS-AYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSST---RTKYNLSNSDQKS---TSGSSTNNLTESRMASSTILHQFSST--GFPEIP-QHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            LP  S  ++S AY+TG +S RS+PLT+EL P  S          +R  N    +   + S++   R    L +  Q++   T G  T  L ES + +   + +        P+ P +H+       +Y  Y  L +      K +  + SQ+   +   D        + S  L  KMEW VK R DGTRYIT+RP+R++++K+R  ++ EER+  T ++D  +++ + R W+
Sbjct:  503 LPEKSDKDSSSAYNTG-ESCRSTPLTLELSPDNS----------LRRGNESQAEAGASSSTSGPSRILKPLLSPVQEACSPTRGRPTL-LKESEVGTQPEVRERKGGRHAHPQSPYKHAHIPAHAQHYQSYMQLIQQ-----KSVEYAQSQMSLVSMCRDP-------VTSADLGPKMEWKVKIRSDGTRYITKRPVRDKLLKERALRIREERSGMTTDDDAVSEMKMGRYWS 711          

HSP 2 Score: 65.855 bits (159), Expect = 1.897e-10
Identity = 48/159 (30.19%), Postives = 82/159 (51.57%), Query Frame = 2
Query: 1091 FGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNII--SKFNGNTNRNGNYSSELPPLEEVEYASV-----------YDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSE 1522
             G T+ Y      D  E+ +Y+S I+PNS+A K+  IR GD+I+QIN I++ ++ + V+L   +    V LLL RP I     +  +   +      +  LE+  + ++           ++E  G T+     +   +KDSG+GR TD++ + +ESSE
Sbjct:  183 LGFTVCYRT---DDEDETGIYVSEIDPNSIAAKDGRIREGDRIIQINGIEIQNREEAVALLTSEEHPNVCLLLARPEIQLDEGWMDDDRNDYLDDLHMDMLEQQHHQAMQFTASMLQQKKHEEDGGTTDTATLLSHHHEKDSGVGR-TDDSTRNDESSE 337          

HSP 3 Score: 53.9138 bits (128), Expect = 8.529e-7
Identity = 43/127 (33.86%), Postives = 60/127 (47.24%), Query Frame = 2
Query:  518 YVPLIKFVHTRLNYYY*NRMDFIIL--KVNGKDLSTASHQQVLEAFNSASEPIFVEVARRY------------SISNTSVKPTIPF--MMDLSVNIPTQST-----NDYILPYPSSVFGQPLHGYIN 835
            YVP++  +         N+  ++ L  +VNGKDLS A+H Q +EAF  A EPI V+V RR              + + S +  I F  +M LS  +PT ST       Y+LP   S    P H Y +
Sbjct:   41 YVPVVFILGL-------NQCSYVCLFQQVNGKDLSKATHDQAVEAFRMAKEPIMVQVLRRAPRPKPTGPTGEGQVVDISTQTDITFQHIMALS-KLPTSSTPVDVLEQYLLPEGHS----PAHEYFD 155          
BLAST of PDZ ring finger protein 4 vs. Ensembl Zebrafish
Match: pdzrn3b (PDZ domain containing RING finger 3b [Source:NCBI gene;Acc:100005518])

HSP 1 Score: 70.4774 bits (171), Expect = 8.666e-12
Identity = 68/233 (29.18%), Postives = 113/233 (48.50%), Query Frame = 2
Query: 1796 LPPASGSNTS-AYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSST---RTKYNLSNSDQKS---TSGSSTNNLTESRMASSTILHQFSST--GFPEIP-QHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            LP  S  ++S AY+TG +S RS+PLT+EL P  S          +R  N    +   + S++   R    L +  Q++   T G  T  L ES + +   + +        P+ P +H+       +Y  Y  L +      K +  + SQ+   +   D        + S  L  KMEW VK R DGTRYIT+RP+R++++K+R  ++ EER+  T ++D  +++ + R W+
Sbjct:  713 LPEKSDKDSSSAYNTG-ESCRSTPLTLELSPDNS----------LRRGNESQAEAGASSSTSGPSRILKPLLSPVQEACSPTRGRPTL-LKESEVGTQPEVRERKGGRHAHPQSPYKHAHIPAHAQHYQSYMQLIQQ-----KSVEYAQSQMSLVSMCRDP-------VTSADLGPKMEWKVKIRSDGTRYITKRPVRDKLLKERALRIREERSGMTTDDDAVSEMKMGRYWS 921          

HSP 2 Score: 67.3958 bits (163), Expect = 6.517e-11
Identity = 47/146 (32.19%), Postives = 73/146 (50.00%), Query Frame = 2
Query: 1091 FGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSE 1522
             G T+ Y      D  E+ +Y+S I+PNS+A K+  IR GD+I+QIN I++ ++ + V+L   +    V LLL RP I  K                          ++E  G T+     +   +KDSG+GR TD++ + +ESSE
Sbjct:  432 LGFTVCYRT---DDEDETGIYVSEIDPNSIAAKDGRIREGDRIIQINGIEIQNREEAVALLTSEEHPNVCLLLARPEIQKK--------------------------HEEDGGTTDTATLLSHHHEKDSGVGR-TDDSTRNDESSE 547          

HSP 3 Score: 55.8398 bits (133), Expect = 2.858e-7
Identity = 39/102 (38.24%), Postives = 51/102 (50.00%), Query Frame = 2
Query:  587 ILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARRY------------SISNTSVKPTIPF--MMDLSVNIPTQST-----NDYILPYPSSVFGQPLHGYIN 835
            I++VNGKDLS A+H Q +EAF  A EPI V+V RR              + + S +  I F  +M LS  +PT ST       Y+LP   S    P H Y +
Sbjct:  303 IMEVNGKDLSKATHDQAVEAFRMAKEPIMVQVLRRAPRPKPTGPTGEGQVVDISTQTDITFQHIMALS-KLPTSSTPVDVLEQYLLPEGHS----PAHEYFD 399          
BLAST of PDZ ring finger protein 4 vs. Ensembl Zebrafish
Match: pdzrn3b (PDZ domain containing RING finger 3b [Source:NCBI gene;Acc:100005518])

HSP 1 Score: 70.4774 bits (171), Expect = 8.944e-12
Identity = 68/233 (29.18%), Postives = 113/233 (48.50%), Query Frame = 2
Query: 1796 LPPASGSNTS-AYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSST---RTKYNLSNSDQKS---TSGSSTNNLTESRMASSTILHQFSST--GFPEIP-QHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            LP  S  ++S AY+TG +S RS+PLT+EL P  S          +R  N    +   + S++   R    L +  Q++   T G  T  L ES + +   + +        P+ P +H+       +Y  Y  L +      K +  + SQ+   +   D        + S  L  KMEW VK R DGTRYIT+RP+R++++K+R  ++ EER+  T ++D  +++ + R W+
Sbjct:  752 LPEKSDKDSSSAYNTG-ESCRSTPLTLELSPDNS----------LRRGNESQAEAGASSSTSGPSRILKPLLSPVQEACSPTRGRPTL-LKESEVGTQPEVRERKGGRHAHPQSPYKHAHIPAHAQHYQSYMQLIQQ-----KSVEYAQSQMSLVSMCRDP-------VTSADLGPKMEWKVKIRSDGTRYITKRPVRDKLLKERALRIREERSGMTTDDDAVSEMKMGRYWS 960          

HSP 2 Score: 65.855 bits (159), Expect = 2.249e-10
Identity = 48/159 (30.19%), Postives = 82/159 (51.57%), Query Frame = 2
Query: 1091 FGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNII--SKFNGNTNRNGNYSSELPPLEEVEYASV-----------YDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSE 1522
             G T+ Y      D  E+ +Y+S I+PNS+A K+  IR GD+I+QIN I++ ++ + V+L   +    V LLL RP I     +  +   +      +  LE+  + ++           ++E  G T+     +   +KDSG+GR TD++ + +ESSE
Sbjct:  432 LGFTVCYRT---DDEDETGIYVSEIDPNSIAAKDGRIREGDRIIQINGIEIQNREEAVALLTSEEHPNVCLLLARPEIQLDEGWMDDDRNDYLDDLHMDMLEQQHHQAMQFTASMLQQKKHEEDGGTTDTATLLSHHHEKDSGVGR-TDDSTRNDESSE 586          

HSP 3 Score: 55.8398 bits (133), Expect = 2.887e-7
Identity = 39/102 (38.24%), Postives = 51/102 (50.00%), Query Frame = 2
Query:  587 ILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARRY------------SISNTSVKPTIPF--MMDLSVNIPTQST-----NDYILPYPSSVFGQPLHGYIN 835
            I++VNGKDLS A+H Q +EAF  A EPI V+V RR              + + S +  I F  +M LS  +PT ST       Y+LP   S    P H Y +
Sbjct:  303 IMEVNGKDLSKATHDQAVEAFRMAKEPIMVQVLRRAPRPKPTGPTGEGQVVDISTQTDITFQHIMALS-KLPTSSTPVDVLEQYLLPEGHS----PAHEYFD 399          
BLAST of PDZ ring finger protein 4 vs. Ensembl Zebrafish
Match: pdzrn3b (PDZ domain containing RING finger 3b [Source:NCBI gene;Acc:100005518])

HSP 1 Score: 70.4774 bits (171), Expect = 9.156e-12
Identity = 68/233 (29.18%), Postives = 113/233 (48.50%), Query Frame = 2
Query: 1796 LPPASGSNTS-AYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSST---RTKYNLSNSDQKS---TSGSSTNNLTESRMASSTILHQFSST--GFPEIP-QHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            LP  S  ++S AY+TG +S RS+PLT+EL P  S          +R  N    +   + S++   R    L +  Q++   T G  T  L ES + +   + +        P+ P +H+       +Y  Y  L +      K +  + SQ+   +   D        + S  L  KMEW VK R DGTRYIT+RP+R++++K+R  ++ EER+  T ++D  +++ + R W+
Sbjct:  723 LPEKSDKDSSSAYNTG-ESCRSTPLTLELSPDNS----------LRRGNESQAEAGASSSTSGPSRILKPLLSPVQEACSPTRGRPTL-LKESEVGTQPEVRERKGGRHAHPQSPYKHAHIPAHAQHYQSYMQLIQQ-----KSVEYAQSQMSLVSMCRDP-------VTSADLGPKMEWKVKIRSDGTRYITKRPVRDKLLKERALRIREERSGMTTDDDAVSEMKMGRYWS 931          

HSP 2 Score: 66.2402 bits (160), Expect = 1.770e-10
Identity = 48/159 (30.19%), Postives = 82/159 (51.57%), Query Frame = 2
Query: 1091 FGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNII--SKFNGNTNRNGNYSSELPPLEEVEYASV-----------YDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSE 1522
             G T+ Y      D  E+ +Y+S I+PNS+A K+  IR GD+I+QIN I++ ++ + V+L   +    V LLL RP I     +  +   +      +  LE+  + ++           ++E  G T+     +   +KDSG+GR TD++ + +ESSE
Sbjct:  403 LGFTVCYRT---DDEDETGIYVSEIDPNSIAAKDGRIREGDRIIQINGIEIQNREEAVALLTSEEHPNVCLLLARPEIQLDEGWMDDDRNDYLDDLHMDMLEQQHHQAMQFTASMLQQKKHEEDGGTTDTATLLSHHHEKDSGVGR-TDDSTRNDESSE 557          

HSP 3 Score: 55.8398 bits (133), Expect = 2.544e-7
Identity = 39/102 (38.24%), Postives = 51/102 (50.00%), Query Frame = 2
Query:  587 ILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARRY------------SISNTSVKPTIPF--MMDLSVNIPTQST-----NDYILPYPSSVFGQPLHGYIN 835
            I++VNGKDLS A+H Q +EAF  A EPI V+V RR              + + S +  I F  +M LS  +PT ST       Y+LP   S    P H Y +
Sbjct:  274 IMEVNGKDLSKATHDQAVEAFRMAKEPIMVQVLRRAPRPKPTGPTGEGQVVDISTQTDITFQHIMALS-KLPTSSTPVDVLEQYLLPEGHS----PAHEYFD 370          
BLAST of PDZ ring finger protein 4 vs. Ensembl Zebrafish
Match: PDZD4 (si:ch73-162j3.4 [Source:ZFIN;Acc:ZDB-GENE-090313-136])

HSP 1 Score: 68.9366 bits (167), Expect = 1.850e-11
Identity = 51/161 (31.68%), Postives = 79/161 (49.07%), Query Frame = 2
Query: 1064 LRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSECDSNQTS 1543
            L K   ++  GLT+ Y      D  +  +Y+  + PNS+A K+  IR GD+ILQIN +DV ++ + V++  ++    + LLL RP+  SK +   +      +  P L                NN  +      DSG+GR TDE+ + EESSE   + TS
Sbjct:  127 LYKSCQQDKLGLTVCYRT---DDEEDLGIYVGEVNPNSIAAKDGRIREGDRILQINGVDVQNREEAVAILTREDSTNISLLLARPHHRSKASSLLSDVSGIRANRPNLWHTAL-----------NNSQEL-----DSGVGR-TDESTRCEESSELAEDATS 267          

HSP 2 Score: 58.151 bits (139), Expect = 4.410e-8
Identity = 22/54 (40.74%), Postives = 38/54 (70.37%), Query Frame = 2
Query: 2303 WVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            W VK R DG+RY+ +RP+R+R++K R  K+ EER+  T ++D  +++ + R W+
Sbjct:  539 WKVKIRSDGSRYVAKRPVRDRLLKARAMKIREERSGMTTDDDAVSEMKMGRYWS 592          
BLAST of PDZ ring finger protein 4 vs. Ensembl Xenopus
Match: frem2 (FRAS1 related extracellular matrix protein 2 [Source:Xenbase;Acc:XB-GENE-1004431])

HSP 1 Score: 78.9518 bits (193), Expect = 2.998e-14
Identity = 67/240 (27.92%), Postives = 116/240 (48.33%), Query Frame = 2
Query: 1796 LPPASGSNTS-AYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSD--------QKSTSGSSTNNLTESRMASSTIL-HQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIK-------SDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            LP  S  ++S AY+TG +S RS+PLT+E+ P  S          +R  N +   D+   S  R    L ++D        ++ TS +  +  ++ +++ S    ++ S      IP H+       +Y  Y  L                 I+Q + VE   Y  +Q+         S+ ++ +MEW VK R DGTRYIT+RP+R++++K+R  K+ EER+  T ++D  +++ + R W+
Sbjct:  745 LPEKSDKDSSSAYNTG-ESCRSTPLTLEISPDNS----------LRRKNLQTHGDSRESSPARYHLPLKDTDPSKQAENKERKTSDAGKSQTSQDKLSGSYAPPYRHSPYKHAHIPAHA------QHYQSYMQL-----------------IQQKSAVE---YAQSQMSLVSMCKDLSNSIEPRMEWKVKVRSDGTRYITKRPVRDKLLKERAIKIKEERSGMTTDDDAISEMKMGRYWS 947          

HSP 2 Score: 69.707 bits (169), Expect = 1.908e-11
Identity = 52/168 (30.95%), Postives = 88/168 (52.38%), Query Frame = 2
Query: 1064 LRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLE-VKLLLGRPNII--SKFNGNTNRNGNYSSELPPLEEVEYASV-----------YDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSE 1522
            L +  S++  GLT+ Y      D  ++ +Y+S I+PNS+A K+  IR GD+I+QIN IDV++  + V+L      + V LL+ RP +     +  +   +      +  LEE  + ++            +E  G T+     +  ++KDSG+GR TDE+ + +ESSE
Sbjct:  421 LYRMNSQDKLGLTVCYRT---DDEDDTGIYVSEIDPNSIAAKDGRIREGDRIIQINGIDVNNHEEAVALLTSEDTKNVFLLVARPELQLDEGWMDDDRNDFLDDLHMDMLEEQHHQAMQFTASMLQQKKLEEDGGTTDTATLLSNHLEKDSGVGR-TDESTRNDESSE 584          

HSP 3 Score: 52.373 bits (124), Expect = 4.816e-6
Identity = 27/66 (40.91%), Postives = 40/66 (60.61%), Query Frame = 2
Query:  587 ILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARRYSISNTSVKPTIPFMMDLSVNIPTQSTNDYI 784
            I++VNGKDLS A+H Q +EAF +A EPI V+V RR   +     P    ++D+     T+ T ++I
Sbjct:  301 IIEVNGKDLSRATHDQAVEAFKTAKEPIVVQVLRRTPRTKVFSPPADVQLLDMGTQ--TEITFEHI 364          
BLAST of PDZ ring finger protein 4 vs. Ensembl Xenopus
Match: pip5k1c (phosphatidylinositol-4-phosphate 5-kinase, type I, gamma [Source:Xenbase;Acc:XB-GENE-5823861])

HSP 1 Score: 77.411 bits (189), Expect = 6.652e-14
Identity = 68/235 (28.94%), Postives = 117/235 (49.79%), Query Frame = 2
Query: 1796 LPPASGSNTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSS--TNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQ---IEQNNCVEDHEYINAQL------IKSDKL-DSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            L  +   ++SAY+T A+S RS+PL ++  P  S    +S+  + +N     + ++F+        ++ NS  KST+G     N   ++++  S +  Q  +    EI          HY   Y      F   P       S    I+QN+ VE   Y  +QL       ++ +L + +MEW VK R DGTRYIT+RP+R++++K+R  K+ EER+  T ++D  +++ + R W+
Sbjct:  466 LERSDKDSSSAYNT-AESCRSTPLNIDRSPDSSLQRIISI-TNKKNLRSTIVTNHFSSGIN----SIENSPSKSTAGGQRIINEFQDTKLQCSRLSEQ-KNQSIEEI----------HYLSPYHSSEYKFGNLPVHARHYQSYMQLIQQNSAVE---YTQSQLNLVTMCKETQRLTEPRMEWKVKIRSDGTRYITKRPVRDKLLKERALKIKEERSGMTTDDDTMSEMKMGRYWS 680          

HSP 2 Score: 65.855 bits (159), Expect = 3.013e-10
Identity = 48/167 (28.74%), Postives = 82/167 (49.10%), Query Frame = 2
Query: 1079 SREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF--QKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELP--------------PLEEVEYASVYDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSECD 1528
            S++  GLT+ Y      D  ++ +Y+S ++PN  A ++  IR GD+ILQIN  D+ ++ + V+L    +C   + LL+ RP +        +    +  EL                  EV+     +E +G T+     +   +KDSG+GR TDE+ + +ESSE +
Sbjct:  151 SQDRLGLTVCYRT---DDEEDTGIYVSEVDPNGTAARDGRIREGDRILQINGQDIQNREEAVALLSSDECK-RITLLVARPELQLDEGWMDDERNEFLEELNNQKLGEQHNEAMQYKANEVQQQKKREEEDGTTDTATSSSNNHEKDSGVGR-TDESQRNDESSEVE 312          
BLAST of PDZ ring finger protein 4 vs. Ensembl Xenopus
Match: frem2 (FRAS1 related extracellular matrix protein 2 [Source:Xenbase;Acc:XB-GENE-1004431])

HSP 1 Score: 72.4034 bits (176), Expect = 3.009e-12
Identity = 67/253 (26.48%), Postives = 116/253 (45.85%), Query Frame = 2
Query: 1796 LPPASGSNTS-AYSTGADSTRSSPLTMELPPTIS-------------SASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSD--------QKSTSGSSTNNLTESRMASSTIL-HQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIK-------SDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            LP  S  ++S AY+TG +S RS+PLT+E+ P  S               +  S        N +   D+   S  R    L ++D        ++ TS +  +  ++ +++ S    ++ S      IP H+       +Y  Y  L                 I+Q + VE   Y  +Q+         S+ ++ +MEW VK R DGTRYIT+RP+R++++K+R  K+ EER+  T ++D  +++ + R W+
Sbjct:  745 LPEKSDKDSSSAYNTG-ESCRSTPLTLEISPDNSLRRVADVINCPNAEGAAGSAPCSAPQKNLQTHGDSRESSPARYHLPLKDTDPSKQAENKERKTSDAGKSQTSQDKLSGSYAPPYRHSPYKHAHIPAHA------QHYQSYMQL-----------------IQQKSAVE---YAQSQMSLVSMCKDLSNSIEPRMEWKVKVRSDGTRYITKRPVRDKLLKERAIKIKEERSGMTTDDDAISEMKMGRYWS 970          

HSP 2 Score: 70.0922 bits (170), Expect = 1.693e-11
Identity = 52/168 (30.95%), Postives = 88/168 (52.38%), Query Frame = 2
Query: 1064 LRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLE-VKLLLGRPNII--SKFNGNTNRNGNYSSELPPLEEVEYASV-----------YDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSE 1522
            L +  S++  GLT+ Y      D  ++ +Y+S I+PNS+A K+  IR GD+I+QIN IDV++  + V+L      + V LL+ RP +     +  +   +      +  LEE  + ++            +E  G T+     +  ++KDSG+GR TDE+ + +ESSE
Sbjct:  421 LYRMNSQDKLGLTVCYRT---DDEDDTGIYVSEIDPNSIAAKDGRIREGDRIIQINGIDVNNHEEAVALLTSEDTKNVFLLVARPELQLDEGWMDDDRNDFLDDLHMDMLEEQHHQAMQFTASMLQQKKLEEDGGTTDTATLLSNHLEKDSGVGR-TDESTRNDESSE 584          

HSP 3 Score: 52.373 bits (124), Expect = 4.601e-6
Identity = 27/66 (40.91%), Postives = 40/66 (60.61%), Query Frame = 2
Query:  587 ILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARRYSISNTSVKPTIPFMMDLSVNIPTQSTNDYI 784
            I++VNGKDLS A+H Q +EAF +A EPI V+V RR   +     P    ++D+     T+ T ++I
Sbjct:  301 IIEVNGKDLSRATHDQAVEAFKTAKEPIVVQVLRRTPRTKVFSPPADVQLLDMGTQ--TEITFEHI 364          
BLAST of PDZ ring finger protein 4 vs. Ensembl Xenopus
Match: frem2 (FRAS1 related extracellular matrix protein 2 [Source:Xenbase;Acc:XB-GENE-1004431])

HSP 1 Score: 72.4034 bits (176), Expect = 3.283e-12
Identity = 67/253 (26.48%), Postives = 116/253 (45.85%), Query Frame = 2
Query: 1796 LPPASGSNTS-AYSTGADSTRSSPLTMELPPTIS-------------SASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSD--------QKSTSGSSTNNLTESRMASSTIL-HQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIK-------SDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            LP  S  ++S AY+TG +S RS+PLT+E+ P  S               +  S        N +   D+   S  R    L ++D        ++ TS +  +  ++ +++ S    ++ S      IP H+       +Y  Y  L                 I+Q + VE   Y  +Q+         S+ ++ +MEW VK R DGTRYIT+RP+R++++K+R  K+ EER+  T ++D  +++ + R W+
Sbjct:  706 LPEKSDKDSSSAYNTG-ESCRSTPLTLEISPDNSLRRVADVINCPNAEGAAGSAPCSAPQKNLQTHGDSRESSPARYHLPLKDTDPSKQAENKERKTSDAGKSQTSQDKLSGSYAPPYRHSPYKHAHIPAHA------QHYQSYMQL-----------------IQQKSAVE---YAQSQMSLVSMCKDLSNSIEPRMEWKVKVRSDGTRYITKRPVRDKLLKERAIKIKEERSGMTTDDDAISEMKMGRYWS 931          

HSP 2 Score: 71.2478 bits (173), Expect = 7.825e-12
Identity = 50/155 (32.26%), Postives = 79/155 (50.97%), Query Frame = 2
Query: 1064 LRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLE-VKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSE 1522
            L +  S++  GLT+ Y      D  ++ +Y+S I+PNS+A K+  IR GD+I+QIN IDV++  + V+L      + V LL+ RP +  K                           +E  G T+     +  ++KDSG+GR TDE+ + +ESSE
Sbjct:  421 LYRMNSQDKLGLTVCYRT---DDEDDTGIYVSEIDPNSIAAKDGRIREGDRIIQINGIDVNNHEEAVALLTSEDTKNVFLLVARPELQKKL--------------------------EEDGGTTDTATLLSNHLEKDSGVGR-TDESTRNDESSE 545          

HSP 3 Score: 52.373 bits (124), Expect = 4.798e-6
Identity = 27/66 (40.91%), Postives = 40/66 (60.61%), Query Frame = 2
Query:  587 ILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARRYSISNTSVKPTIPFMMDLSVNIPTQSTNDYI 784
            I++VNGKDLS A+H Q +EAF +A EPI V+V RR   +     P    ++D+     T+ T ++I
Sbjct:  301 IIEVNGKDLSRATHDQAVEAFKTAKEPIVVQVLRRTPRTKVFSPPADVQLLDMGTQ--TEITFEHI 364          
BLAST of PDZ ring finger protein 4 vs. Ensembl Xenopus
Match: frem2 (FRAS1 related extracellular matrix protein 2 [Source:Xenbase;Acc:XB-GENE-1004431])

HSP 1 Score: 72.4034 bits (176), Expect = 3.439e-12
Identity = 67/253 (26.48%), Postives = 116/253 (45.85%), Query Frame = 2
Query: 1796 LPPASGSNTS-AYSTGADSTRSSPLTMELPPTIS-------------SASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSD--------QKSTSGSSTNNLTESRMASSTIL-HQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIK-------SDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            LP  S  ++S AY+TG +S RS+PLT+E+ P  S               +  S        N +   D+   S  R    L ++D        ++ TS +  +  ++ +++ S    ++ S      IP H+       +Y  Y  L                 I+Q + VE   Y  +Q+         S+ ++ +MEW VK R DGTRYIT+RP+R++++K+R  K+ EER+  T ++D  +++ + R W+
Sbjct:  716 LPEKSDKDSSSAYNTG-ESCRSTPLTLEISPDNSLRRVADVINCPNAEGAAGSAPCSAPQKNLQTHGDSRESSPARYHLPLKDTDPSKQAENKERKTSDAGKSQTSQDKLSGSYAPPYRHSPYKHAHIPAHA------QHYQSYMQL-----------------IQQKSAVE---YAQSQMSLVSMCKDLSNSIEPRMEWKVKVRSDGTRYITKRPVRDKLLKERAIKIKEERSGMTTDDDAISEMKMGRYWS 941          

HSP 2 Score: 70.0922 bits (170), Expect = 1.565e-11
Identity = 52/168 (30.95%), Postives = 88/168 (52.38%), Query Frame = 2
Query: 1064 LRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLE-VKLLLGRPNII--SKFNGNTNRNGNYSSELPPLEEVEYASV-----------YDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSE 1522
            L +  S++  GLT+ Y      D  ++ +Y+S I+PNS+A K+  IR GD+I+QIN IDV++  + V+L      + V LL+ RP +     +  +   +      +  LEE  + ++            +E  G T+     +  ++KDSG+GR TDE+ + +ESSE
Sbjct:  392 LYRMNSQDKLGLTVCYRT---DDEDDTGIYVSEIDPNSIAAKDGRIREGDRIIQINGIDVNNHEEAVALLTSEDTKNVFLLVARPELQLDEGWMDDDRNDFLDDLHMDMLEEQHHQAMQFTASMLQQKKLEEDGGTTDTATLLSNHLEKDSGVGR-TDESTRNDESSE 555          

HSP 3 Score: 52.373 bits (124), Expect = 4.649e-6
Identity = 27/66 (40.91%), Postives = 40/66 (60.61%), Query Frame = 2
Query:  587 ILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARRYSISNTSVKPTIPFMMDLSVNIPTQSTNDYI 784
            I++VNGKDLS A+H Q +EAF +A EPI V+V RR   +     P    ++D+     T+ T ++I
Sbjct:  272 IIEVNGKDLSRATHDQAVEAFKTAKEPIVVQVLRRTPRTKVFSPPADVQLLDMGTQ--TEITFEHI 335          
BLAST of PDZ ring finger protein 4 vs. Ensembl Mouse
Match: Pdzrn4 (PDZ domain containing RING finger 4 [Source:MGI Symbol;Acc:MGI:3056996])

HSP 1 Score: 73.9442 bits (180), Expect = 7.778e-13
Identity = 70/238 (29.41%), Postives = 111/238 (46.64%), Query Frame = 2
Query: 1817 NTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQ---------------FSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQL-----IKSDKLDS--KMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            ++SAY+T A+S RS+PLT++  P  S    ++L    + N    +  + +     T+   S   + +  G S  +L E  + SS +L Q                SS  +  IP H+       +Y  Y  L                 I+Q + VE   Y  +QL      K  +  S  KMEW VK R DGTRYIT+RP+R+R++K+R  K+ EER+  T ++D  +++ + R W+
Sbjct:  713 SSSAYNT-AESCRSTPLTVDRSPDSSLPRMINLT--NKKNLRSMMTAHQSPPRQSTREYTSTKVKATDEGCSVESL-EKGLESSQLLDQEHTVSEHPPYLSPYHSSSYRYANIPAHA------RHYQSYMQL-----------------IQQKSAVE---YAQSQLSLVSMCKESQRGSEPKMEWKVKIRSDGTRYITKRPVRDRLLKERALKIKEERSGMTTDDDTMSEMKMGRYWS 920          

HSP 2 Score: 67.781 bits (164), Expect = 5.685e-11
Identity = 54/174 (31.03%), Postives = 86/174 (49.43%), Query Frame = 2
Query: 1079 SREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF--QKCGLEVKLLLGRPNI-----------------------ISKFNGNTNRNGNYSSEL-PPLEEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSE 1522
            S+E  GLT+ Y      D  ++ +Y+S ++PNS+A K+  IR GD+ILQIN  D+ ++ + V+L    +C   + LL+ RP++                           N    R    +SEL  P ++ E     D    ++NN+      +KDSG+GR TDE+ + +ESSE
Sbjct:  391 SQEKLGLTVCYRT---DDEEDTGIYVSEVDPNSIAAKDGRIREGDRILQINGEDIQNREEAVALLSSDECK-RIVLLIARPDMQLDEGWLEDERNEFLEELNSELLEEDHNEGAQRT---ASELQQPKKQEEEEGTTDTATSSSNNQ------EKDSGVGR-TDESLRNDESSE 550          

HSP 3 Score: 51.2174 bits (121), Expect = 7.990e-6
Identity = 28/66 (42.42%), Postives = 40/66 (60.61%), Query Frame = 2
Query:  587 ILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARRYSISNTSVKPTIPFMMDLSVNIPTQSTNDYI 784
            I+ VNG+DLS A+H++ +EAF +A EPI V+V RR  +S    +PT  + M   V +   ST   I
Sbjct:  260 IIAVNGRDLSKATHEEAVEAFRTAKEPIVVQVLRRTPLS----RPT--YGMTPEVQLTNASTQTDI 319          
BLAST of PDZ ring finger protein 4 vs. Ensembl Mouse
Match: Pdzrn4 (PDZ domain containing RING finger 4 [Source:MGI Symbol;Acc:MGI:3056996])

HSP 1 Score: 73.1738 bits (178), Expect = 1.218e-12
Identity = 70/238 (29.41%), Postives = 111/238 (46.64%), Query Frame = 2
Query: 1817 NTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQ---------------FSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQL-----IKSDKLDS--KMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            ++SAY+T A+S RS+PLT++  P  S    ++L    + N    +  + +     T+   S   + +  G S  +L E  + SS +L Q                SS  +  IP H+       +Y  Y  L                 I+Q + VE   Y  +QL      K  +  S  KMEW VK R DGTRYIT+RP+R+R++K+R  K+ EER+  T ++D  +++ + R W+
Sbjct:  474 SSSAYNT-AESCRSTPLTVDRSPDSSLPRMINLT--NKKNLRSMMTAHQSPPRQSTREYTSTKVKATDEGCSVESL-EKGLESSQLLDQEHTVSEHPPYLSPYHSSSYRYANIPAHA------RHYQSYMQL-----------------IQQKSAVE---YAQSQLSLVSMCKESQRGSEPKMEWKVKIRSDGTRYITKRPVRDRLLKERALKIKEERSGMTTDDDTMSEMKMGRYWS 681          

HSP 2 Score: 68.5514 bits (166), Expect = 3.170e-11
Identity = 54/171 (31.58%), Postives = 88/171 (51.46%), Query Frame = 2
Query: 1079 SREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF--QKCGLEVKLLLGRPNI-ISKFNGNTNRNGNY-------------------SSEL-PPLEEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSE 1522
            S+E  GLT+ Y      D  ++ +Y+S ++PNS+A K+  IR GD+ILQIN  D+ ++ + V+L    +C   + LL+ RP++ + +      RN                      +SEL  P ++ E     D    ++NN+      +KDSG+GR TDE+ + +ESSE
Sbjct:  152 SQEKLGLTVCYRT---DDEEDTGIYVSEVDPNSIAAKDGRIREGDRILQINGEDIQNREEAVALLSSDECK-RIVLLIARPDMQLDEGWLEDERNEFLEELNSELLEEDHNEGAQRTASELQQPKKQEEEEGTTDTATSSSNNQ------EKDSGVGR-TDESLRNDESSE 311          
BLAST of PDZ ring finger protein 4 vs. Ensembl Mouse
Match: Pdzrn3 (PDZ domain containing RING finger 3 [Source:MGI Symbol;Acc:MGI:1933157])

HSP 1 Score: 70.4774 bits (171), Expect = 4.921e-12
Identity = 56/172 (32.56%), Postives = 91/172 (52.91%), Query Frame = 2
Query: 1064 LRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNII--SKFNGNTNRNGNYSSELPPLEEVEY------ASV-----YDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSECDSN 1534
            L +  S++  GLT+ Y      D  +  +YIS I+PNS+A K+  IR GD+I+QIN I+V ++ + V+L   +      LL+ RP +     +  +   +      +  LEE  +      ASV     ++E  G T+     + Q +KDSG+GR TDE+ + +ESSE ++N
Sbjct:  139 LYRMNSQDKLGLTVCYRT---DDEDDIGIYISEIDPNSIAAKDGRIREGDRIIQINGIEVQNREEAVALLTSEENKNFSLLIARPELQLDEGWMDDDRNDFLDDLHMDMLEEQHHQAMQFTASVLQQKKHEEDGGTTDTATILSNQHEKDSGVGR-TDESTRNDESSEQENN 306          
BLAST of PDZ ring finger protein 4 vs. Ensembl Mouse
Match: Pdzrn3 (PDZ domain containing RING finger 3 [Source:MGI Symbol;Acc:MGI:1933157])

HSP 1 Score: 69.707 bits (169), Expect = 1.642e-11
Identity = 56/172 (32.56%), Postives = 91/172 (52.91%), Query Frame = 2
Query: 1064 LRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNII--SKFNGNTNRNGNYSSELPPLEEVEY------ASV-----YDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSECDSN 1534
            L +  S++  GLT+ Y      D  +  +YIS I+PNS+A K+  IR GD+I+QIN I+V ++ + V+L   +      LL+ RP +     +  +   +      +  LEE  +      ASV     ++E  G T+     + Q +KDSG+GR TDE+ + +ESSE ++N
Sbjct:  422 LYRMNSQDKLGLTVCYRT---DDEDDIGIYISEIDPNSIAAKDGRIREGDRIIQINGIEVQNREEAVALLTSEENKNFSLLIARPELQLDEGWMDDDRNDFLDDLHMDMLEEQHHQAMQFTASVLQQKKHEEDGGTTDTATILSNQHEKDSGVGR-TDESTRNDESSEQENN 589          

HSP 2 Score: 69.3218 bits (168), Expect = 1.849e-11
Identity = 27/63 (42.86%), Postives = 47/63 (74.60%), Query Frame = 2
Query: 2276 SDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            S+ ++ +MEW VK R DGTRYIT+RP+R+R++++R  K+ EER+  T ++D  +++ + R W+
Sbjct:  909 SNSVEPRMEWKVKIRSDGTRYITKRPVRDRLLRERALKIREERSGLTTDDDAMSEMKMGRYWS 971          

HSP 3 Score: 51.6026 bits (122), Expect = 5.607e-6
Identity = 22/35 (62.86%), Postives = 28/35 (80.00%), Query Frame = 2
Query:  587 ILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARR 691
            I++VNGKDLS A+H Q +EAF +A EPI V+V RR
Sbjct:  304 IIEVNGKDLSRATHDQAVEAFKTAKEPIVVQVLRR 338          
BLAST of PDZ ring finger protein 4 vs. Ensembl Mouse
Match: Pdzd4 (PDZ domain containing 4 [Source:MGI Symbol;Acc:MGI:2443483])

HSP 1 Score: 64.3142 bits (155), Expect = 5.494e-10
Identity = 25/57 (43.86%), Postives = 41/57 (71.93%), Query Frame = 2
Query: 2294 KMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            +MEW VK R DGTRY+ +RP+R+R++K R  K+ EER+  T ++D  +++ + R W+
Sbjct:  624 RMEWKVKVRSDGTRYVAKRPVRDRLLKARALKIREERSGMTTDDDAVSEMKMGRYWS 680          

HSP 2 Score: 63.1586 bits (152), Expect = 1.324e-9
Identity = 49/164 (29.88%), Postives = 82/164 (50.00%), Query Frame = 2
Query: 1091 FGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRP--NIISKFN-----------GNTNRNGNYSSEL--PPLEEV--EYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSECD 1528
             GL + Y      D     +Y+  + PNS+A K+  IR GD+I+QIN +DV ++ + V++  Q+    + LL+ RP   +  ++            G+ N     + +L  PP++++  +     D   G  N++      D DSG+GR TDE+ + EESSE D
Sbjct:  148 LGLMVCYRTDEEEDLG---IYVGEVNPNSIAAKDGRIREGDRIIQINGMDVQNREEAVAILSQEENTNISLLVARPESQLAKRWKDSDRDDFLDDFGSENEGDLRARKLKSPPVQQIGNDEKGAPDGGPGLNNSQ------DLDSGVGR-TDESTRNEESSEHD 301          
BLAST of PDZ ring finger protein 4 vs. UniProt/SwissProt
Match: sp|Q6ZMN7|PZRN4_HUMAN (PDZ domain-containing RING finger protein 4 OS=Homo sapiens OX=9606 GN=PDZRN4 PE=2 SV=3)

HSP 1 Score: 92.0485 bits (227), Expect = 1.476e-17
Identity = 111/365 (30.41%), Postives = 158/365 (43.29%), Query Frame = 2
Query:  587 ILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARRYSIS-------------NTSVKPTIPF--MMDLS-VNIPTQSTNDYILPYPSSVFGQPLHGYINSSQKTNQINNHTDSNHSLSS-----YSNNCALKSFLNDAIKNRD-DYSCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF--QKCGLEVKLLLGRPNI-ISKFNGNTNRNGNYSSEL-------------PPLEEVEYASVYDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSEC-----DSNQTSLK 1549
            I++VNGKDLS A+H++ +EAF +A EPI V+V RR  +S             N S +  I F  +M L+ +  PT    D I P+  S                       DS HSL       Y +N  + S   DA +  D +Y                                EV L +  S+E  GLT+ Y      D  ++ +Y+S ++PNS+A K+  IR GD+ILQIN  DV ++ + V+L    +C   + LL+ RP I + +      RN                    P   EVE     +E EG T+     +   +KDSG+GR TDE+ + +ESSE      D N TSLK
Sbjct:  279 IMEVNGKDLSKATHEEAVEAFRNAKEPIVVQVLRRTPLSRPAYGMASEVQLMNASTQTDITFEHIMALAKLRPPTPPVPD-ICPFLLS-----------------------DSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYE-------------------------------EVELCRVSSQEKLGLTVCYRT---DDEEDTGIYVSEVDPNSIAAKDGRIREGDRILQINGEDVQNREEAVALLSNDECK-RIVLLVARPEIQLDEGWLEDERNEFLEELNLEMLEEEHNEAMQPTANEVEQPKKQEEEEGTTDTATSSSNNHEKDSGVGR-TDESLRNDESSEQENAAEDPNSTSLK 583          

HSP 2 Score: 72.0182 bits (175), Expect = 2.219e-11
Identity = 69/235 (29.36%), Postives = 113/235 (48.09%), Query Frame = 2
Query: 1817 NTSAYSTGADSTRSSPLTMELPPTISSASFLSL--KIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRM-----ASSTIL-----HQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQL------IKSDKL-DSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            ++SAY+T A+S RS+PLT++  P  S    ++L  K ++R+        +   S   T      ++Q  ++ S    L  S++     A S  +     +  SS  +  IP H+       +Y  Y  L                 I+Q + VE   Y  +QL       +S K  + KMEW VK R DGTRYIT+RP+R+R++K+R  K+ EER+  T ++D  +++ + R W+
Sbjct:  735 SSSAYNT-AESCRSTPLTVDRSPDSSLPRVINLTNKKNLRSTMAATQSSSGQSSKESTSTKAKTTEQGCSAESKEKVLEGSKLPDQEKAVSEHIPYLSPYHSSSYRYANIPAHA------RHYQSYMQL-----------------IQQKSAVE---YAQSQLSLVSMCKESQKCSEPKMEWKVKIRSDGTRYITKRPVRDRILKERALKIKEERSGMTTDDDTMSEMKMGRYWS 942          
BLAST of PDZ ring finger protein 4 vs. UniProt/SwissProt
Match: sp|Q9UPQ7|PZRN3_HUMAN (E3 ubiquitin-protein ligase PDZRN3 OS=Homo sapiens OX=9606 GN=PDZRN3 PE=1 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 3.707e-11
Identity = 57/172 (33.14%), Postives = 91/172 (52.91%), Query Frame = 2
Query: 1064 LRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNII--SKFNGNTNRNGNYSSELPPLEEVEY------ASV-----YDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSECDSN 1534
            L +  S++  GLT+ Y      D  +  +YIS I+PNS+A K+  IR GD+I+QIN I+V ++ + V+L   +      LL+ RP +     +  +   +      +  LEE  +      ASV     +DE  G T+     + Q +KDSG+GR TDE+ + +ESSE ++N
Sbjct:  422 LYRMNSQDKLGLTVCYRT---DDEDDIGIYISEIDPNSIAAKDGRIREGDRIIQINGIEVQNREEAVALLTSEENKNFSLLIARPELQLDEGWMDDDRNDFLDDLHMDMLEEQHHQAMQFTASVLQQKKHDEDGGTTDTATILSNQHEKDSGVGR-TDESTRNDESSEQENN 589          

HSP 2 Score: 67.781 bits (164), Expect = 4.154e-10
Identity = 26/57 (45.61%), Postives = 43/57 (75.44%), Query Frame = 2
Query: 2294 KMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            +MEW VK R DGTRYIT+RP+R+R++++R  K+ EER+  T ++D  +++ + R W+
Sbjct:  918 RMEWKVKIRSDGTRYITKRPVRDRLLRERALKIREERSGMTTDDDAVSEMKMGRYWS 974          
BLAST of PDZ ring finger protein 4 vs. UniProt/SwissProt
Match: sp|E7FDW2|PZR3B_DANRE (E3 ubiquitin-protein ligase PDZRN3-B OS=Danio rerio OX=7955 GN=pdzrn3b PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 6.752e-11
Identity = 68/233 (29.18%), Postives = 113/233 (48.50%), Query Frame = 2
Query: 1796 LPPASGSNTS-AYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSST---RTKYNLSNSDQKS---TSGSSTNNLTESRMASSTILHQFSST--GFPEIP-QHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            LP  S  ++S AY+TG +S RS+PLT+EL P  S          +R  N    +   + S++   R    L +  Q++   T G  T  L ES + +   + +        P+ P +H+       +Y  Y  L +      K +  + SQ+   +   D        + S  L  KMEW VK R DGTRYIT+RP+R++++K+R  ++ EER+  T ++D  +++ + R W+
Sbjct:  752 LPEKSDKDSSSAYNTG-ESCRSTPLTLELSPDNS----------LRRGNESQAEAGASSSTSGPSRILKPLLSPVQEACSPTRGRPTL-LKESEVGTQPEVRERKGGRHAHPQSPYKHAHIPAHAQHYQSYMQLIQQ-----KSVEYAQSQMSLVSMCRDP-------VTSADLGPKMEWKVKIRSDGTRYITKRPVRDKLLKERALRIREERSGMTTDDDAVSEMKMGRYWS 960          

HSP 2 Score: 65.855 bits (159), Expect = 1.698e-9
Identity = 48/159 (30.19%), Postives = 82/159 (51.57%), Query Frame = 2
Query: 1091 FGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNII--SKFNGNTNRNGNYSSELPPLEEVEYASV-----------YDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSE 1522
             G T+ Y      D  E+ +Y+S I+PNS+A K+  IR GD+I+QIN I++ ++ + V+L   +    V LLL RP I     +  +   +      +  LE+  + ++           ++E  G T+     +   +KDSG+GR TD++ + +ESSE
Sbjct:  432 LGFTVCYRT---DDEDETGIYVSEIDPNSIAAKDGRIREGDRIIQINGIEIQNREEAVALLTSEEHPNVCLLLARPEIQLDEGWMDDDRNDYLDDLHMDMLEQQHHQAMQFTASMLQQKKHEEDGGTTDTATLLSHHHEKDSGVGR-TDDSTRNDESSE 586          
BLAST of PDZ ring finger protein 4 vs. UniProt/SwissProt
Match: sp|Q69ZS0|PZRN3_MOUSE (E3 ubiquitin-protein ligase PDZRN3 OS=Mus musculus OX=10090 GN=Pdzrn3 PE=1 SV=3)

HSP 1 Score: 69.707 bits (169), Expect = 1.148e-10
Identity = 56/172 (32.56%), Postives = 91/172 (52.91%), Query Frame = 2
Query: 1064 LRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNII--SKFNGNTNRNGNYSSELPPLEEVEY------ASV-----YDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSECDSN 1534
            L +  S++  GLT+ Y      D  +  +YIS I+PNS+A K+  IR GD+I+QIN I+V ++ + V+L   +      LL+ RP +     +  +   +      +  LEE  +      ASV     ++E  G T+     + Q +KDSG+GR TDE+ + +ESSE ++N
Sbjct:  422 LYRMNSQDKLGLTVCYRT---DDEDDIGIYISEIDPNSIAAKDGRIREGDRIIQINGIEVQNREEAVALLTSEENKNFSLLIARPELQLDEGWMDDDRNDFLDDLHMDMLEEQHHQAMQFTASVLQQKKHEEDGGTTDTATILSNQHEKDSGVGR-TDESTRNDESSEQENN 589          

HSP 2 Score: 69.3218 bits (168), Expect = 1.294e-10
Identity = 27/63 (42.86%), Postives = 47/63 (74.60%), Query Frame = 2
Query: 2276 SDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            S+ ++ +MEW VK R DGTRYIT+RP+R+R++++R  K+ EER+  T ++D  +++ + R W+
Sbjct:  909 SNSVEPRMEWKVKIRSDGTRYITKRPVRDRLLRERALKIREERSGLTTDDDAMSEMKMGRYWS 971          
BLAST of PDZ ring finger protein 4 vs. UniProt/SwissProt
Match: sp|P68907|PZRN3_RAT (E3 ubiquitin-protein ligase PDZRN3 OS=Rattus norvegicus OX=10116 GN=Pdzrn3 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.188e-10
Identity = 56/172 (32.56%), Postives = 91/172 (52.91%), Query Frame = 2
Query: 1064 LRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNII--SKFNGNTNRNGNYSSELPPLEEVEY------ASV-----YDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSECDSN 1534
            L +  S++  GLT+ Y      D  +  +YIS I+PNS+A K+  IR GD+I+QIN I+V ++ + V+L   +      LL+ RP +     +  +   +      +  LEE  +      ASV     ++E  G T+     + Q +KDSG+GR TDE+ + +ESSE ++N
Sbjct:  421 LYRMNSQDKLGLTVCYRT---DDEDDIGIYISEIDPNSIAAKDGRIREGDRIIQINGIEVQNREEAVALLTSEENKNFSLLIARPELQLDEGWMDDDRNDFLDDLHMDMLEEQHHQAMQFTASVLQQKKHEEDGGTTDTATILSNQHEKDSGVGR-TDESTRNDESSEQENN 588          

HSP 2 Score: 68.5514 bits (166), Expect = 2.620e-10
Identity = 27/63 (42.86%), Postives = 46/63 (73.02%), Query Frame = 2
Query: 2276 SDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            S+  + +MEW VK R DGTRYIT+RP+R+R++++R  K+ EER+  T ++D  +++ + R W+
Sbjct:  908 SNSAEPRMEWKVKIRSDGTRYITKRPVRDRLLRERALKIREERSGLTTDDDAMSEMKMGRYWS 970          
BLAST of PDZ ring finger protein 4 vs. TrEMBL
Match: A0A023ZS19 (PDZ ring finger protein 4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 872.463 bits (2253), Expect = 0.000e+0
Identity = 489/490 (99.80%), Postives = 489/490 (99.80%), Query Frame = 2
Query:  734 MMDLSVNIPTQSTNDYILPYPSSVFGQPLHGYINSSQKTNQINNHTDSNHSLSSYSNNCALKSFLNDAIKNRDDYSCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSECDSNQTSLKKXXXXXXXXXXXXXXXXXXIAQLMQHLAIEYQQLQKLLHGSSDSSIPRVQALPPPTLFQSTSRIVPRMGTKLDPPQTKSPIPLPP-ASGSNTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPM 2200
            MMDLSVNIPTQSTNDYILPYPSSVFGQPLHGYINSSQKTNQINNHTDSNHSLSSYSNNCALKSFLNDAIKNRDDYSCGDLLKIEGILEEEEDAELDDDEEQVEIIKEEVVLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSECDSNQTSLKKSAQYQSSDSSGSRPDPQQIAQLMQHLAIEYQQLQKLLHGSSDSSIPRVQALPPPTLFQSTSRIVPRMGTKLDPPQTKSPIPLPP ASGSNTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPM
Sbjct:    1 MMDLSVNIPTQSTNDYILPYPSSVFGQPLHGYINSSQKTNQINNHTDSNHSLSSYSNNCALKSFLNDAIKNRDDYSCGDLLKIEGILEEEEDAELDDDEEQVEIIKEEVVLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSECDSNQTSLKKSAQYQSSDSSGSRPDPQQIAQLMQHLAIEYQQLQKLLHGSSDSSIPRVQALPPPTLFQSTSRIVPRMGTKLDPPQTKSPIPLPPAASGSNTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPM 490          
BLAST of PDZ ring finger protein 4 vs. TrEMBL
Match: A0A1I7RIJ2 (PDZ domain-containing protein OS=Bursaphelenchus xylophilus OX=6326 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 9.595e-20
Identity = 131/508 (25.79%), Postives = 214/508 (42.13%), Query Frame = 2
Query: 1091 FGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGL-EVKLLLGRPNIISKFNGNTNRNGNYSSELPPL----EEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTD-----EANKTEESSECDSNQTSLKKXXXXXXXXXXXXXXXXXXIAQLMQHLAIEYQQLQKLLHGSSDSSIPRVQALPPPTLFQSTSRIVPRMGTKLDPPQTKSPIPL-----------PPASG--------SNTSAYSTGADSTRSSP-----LTMELPPTISSASFLSLKIDVRNNN----------YKFLDDNF-NMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKP-----KPMSRSNSQIEQNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
             GLTL Y   +  D   ++++IS IEP SVA ++  IR+GDQILQIN   V  + + +  F +       LLL RP+     +          ++   L    + +   + YD    ++N EN   Q +KDSG+ R TD     +  +  +SS+ ++  ++L K                 + A+LM     E + +   L    D      Q   P  L  +  R   +M  K   P+ KSP PL            P  G        + +SAY+TG DS RS+P     + +E  P       LS++      N          Y+ +D    +++S   ++ L   + +         L   ++ +S+ L Q   T  P    ++S +       +   L K     P     KP + + S      CV  + Y      K  +  +  EW +K+R DG+RYITRRP+R++++K RE++LN ER   + ++D  +DL   + WT
Sbjct:  118 LGLTLCYGGTADDD---TDIFISQIEPGSVADRDGRIRIGDQILQINGQSVRGRDEAMRQFARGDTNHTSLLLARPSAEQDDDDEDVHVVVEEADPTELTTITKNLHTLAEYD----DSNTENSL-QHEKDSGVSRTTDSEPDVKGVEKGKSSDFENELSALHK----------EMENVRLECARLMNKHMTERKPMNSALVEMLDKI---NQPFIPTKLPAALDRRSNKMSVK---PEMKSPTPLRRTVKEFTAPKTPKMGKVGVTYDETTSSAYNTGGDSCRSTPNKNEYMHVETAPANQRPGTLSIQHRRVEPNLMSPTSSEHPYQTIDTPVASVTSPPVQFRLPQFNFQPPQEQKKGTLRRCQIQASSALPQI--TFRPGDIMYTSPEKLGETIALQQRLLKQSLGDPHASQLKPTTSAVS------CVTSNNYAKYYDNKVAEQPNTYEWKIKRRADGSRYITRRPLRSQVLKAREEQLNRERTGMSTDDDACSDLKTGKFWT 593          
BLAST of PDZ ring finger protein 4 vs. TrEMBL
Match: H0X8S8 (PDZ domain containing ring finger 4 OS=Otolemur garnettii OX=30611 GN=PDZRN4 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.333e-17
Identity = 99/341 (29.03%), Postives = 157/341 (46.04%), Query Frame = 2
Query:  581 FIILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARRYSISNTSVKPTIPFMMDLSVNIPTQSTNDYILPYPSSVFGQP----LHGYINSSQKTNQINNHTDSNHSLSS-----YSNNCALKSFLNDAIKNRD-DYSCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF--QKCGLEVKLLLGRPNI--------------ISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSE 1522
            ++++ VNGKDLS A+H++ +EAF +A EPI V+V RR  +S  S   T+P +  ++ +  T  T ++I+         P    +  ++ S           DS HSL       Y +N  + S   DA +  D +Y                                EV L +  S+E  GLT+ Y      D  ++ +Y+S ++PNS+A K+  IR GD+ILQIN  DV ++ + V+L    +C   + LL+ RP I              + + N    +  +  +   P  EVE     +E EG T+     +   +KDSG+GR TDE+ + +ESSE
Sbjct:   20 YVLILVNGKDLSKATHEEAVEAFRNAKEPIVVQVLRRTPLSRPSYG-TVPEVQLMNASTQTDITFEHIMALAKLRPPTPPVPDICPFLLS-----------DSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYE-------------------------------EVELCRVSSQEKLGLTVCYRT---DDEEDTGIYVSEVDPNSIAAKDGRIREGDRILQINGEDVQNREEAVALLSSDEC-RRIVLLVARPEIQLDEGWLEDERNEFLEELNLEMLKEQHNEAAQHPASEVEQPKKQEEEEGTTDTATSSSNNHEKDSGVGR-TDESLRNDESSE 312          

HSP 2 Score: 72.7886 bits (177), Expect = 3.307e-9
Identity = 66/226 (29.20%), Postives = 104/226 (46.02%), Query Frame = 2
Query: 1817 NTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQ---IEQNNCVEDHEYINAQLI-------KSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            ++SAY+T A+S RS+PLT++  P  S    ++L       N K      N+ ST      S+      S S+    TE   ++ +      S   P+  Q + +     Y   Y   +      P       S    I+Q + VE   Y  +QL             + KMEW VK R DGTRYIT+RP+R+R++K+R  K+ EER+  T ++D  +++ + R W+
Sbjct:  479 SSSAYNT-AESCRSTPLTVDRSPDSSLPRMINL------TNKK------NLRSTVAAQRSSSGHSGKESASAKTTTTEPGCSTESKEKALESKQLPDQEQTAGEAVP--YLSPYHGSSYRCANIPAHARHYQSYMQLIQQKSAVE---YAQSQLSLVSVCKEAQKGAEPKMEWKVKVRSDGTRYITKRPVRDRILKERALKIKEERSGMTTDDDTMSEMKMGRYWS 686          
BLAST of PDZ ring finger protein 4 vs. TrEMBL
Match: G5BGJ9 (PDZ domain-containing RING finger protein 4 OS=Heterocephalus glaber OX=10181 GN=GW7_19029 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.323e-16
Identity = 103/337 (30.56%), Postives = 153/337 (45.40%), Query Frame = 2
Query:  593 KVNGKDLSTASHQQVLEAFNSASEPIFVEVARRYSISNTSVKPTIPFMMDLSVNIPTQSTNDYILPYPSSVFGQP----LHGYINSSQKTNQINNHTDSNHSLSS-----YSNNCALKSFLNDAIKNRD-DYSCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF--QKCGLEVKLLLGRPNI-ISKFNGNTNRNGNYSSELPPLE-------------EVEYASVYDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSE 1522
            KVNGKDLS A+H++ +EAF +A EPI V+V RR  +S  S   T+P +  ++ +  T  T ++I+         P    +  ++ S           DS HSL       Y +N  L S   DA +  D +Y                                EV L +  S+E  GLT+ Y      D  ++ +Y+S ++PNS+A K+  IR GD+ILQIN  DVH++ + V+L   ++C   + LL+ RP I + +      RN         +              EVE     +E EG T+     +   +KDSG+GR TDE+   EESSE
Sbjct:   20 KVNGKDLSKATHEEAVEAFRNAKEPIVVQVLRRTPLSRPSYG-TVPEVQLMNASTQTDITFEHIMALAKLRPPTPPVPDICPFLLS-----------DSCHSLHPMEREFYEDNEYLSSLPADADRTEDFEYE-------------------------------EVELCRVNSQEKLGLTVCYRT---DDEEDTGIYVSEVDPNSIAAKDGRIREGDRILQINGEDVHNREEAVALLSSEECK-RIVLLVARPEIQLDEGWLEDERNEFLEELNLEMLEEQHNEAMQHTANEVEQPKKQEEEEGTTDTATSSSNNHEKDSGVGR-TDESLPNEESSE 308          

HSP 2 Score: 72.0182 bits (175), Expect = 5.546e-9
Identity = 75/236 (31.78%), Postives = 112/236 (47.46%), Query Frame = 2
Query: 1817 NTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFN----MSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTIL--HQFSSTGFPEI-PQHSSD------DTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQL-----IKSDKLDS--KMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            ++SAY+T A+S RS+PLT++  P  S    ++L       N K L          S   +K ++S   + +  G ST +  E  + SS  L   +  S   P + P HSS        T   +Y  Y  L                 I+Q + VE   Y  +QL      K  +  S  KMEW VK R DGTRYIT+RP+R+R++K+R  K+ EER+  T ++D  ++L + R W+
Sbjct:  473 SSSAYNT-AESCRSTPLTVDRSPDSSLPRTINL------TNKKNLRSTMAPRQPSSGQSSKESMSTRAKATEQGCSTES-QEKLLESSQRLDPEKTGSEPIPYLSPYHSSSYRCANIPTHARHYQSYMQL-----------------IQQKSAVE---YAQSQLSLVSVCKDPQKGSEPKMEWKVKIRSDGTRYITKRPVRDRILKERALKIKEERSGMTTDDDTMSELKMGRYWS 680          
BLAST of PDZ ring finger protein 4 vs. TrEMBL
Match: A0A402FLH3 (PDZ domain-containing protein OS=Paroedura picta OX=143630 GN=parPi_0020138 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.775e-16
Identity = 91/333 (27.33%), Postives = 145/333 (43.54%), Query Frame = 2
Query:  572 RMDFIILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARR------------YSISNTSVKPTIPF--MMDLSVNIPTQSTNDYILPYPSSVFGQPLHGYINSSQKTNQINNHTDSNHSLSSYSNNCALKSFLNDAIKNRDDYSCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF--QKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSE 1522
            ++ + + +VNG+DLS A+H++ +E F +A EPI V+V RR              +++ S +  I F  +M L+   PT      I P+  S     LH                  +H    Y  N  L S   DA +  +D+ C ++                              L + +S+E  GLT+ Y      D  ++ +YIS I+PNS+A ++  IR GD+ILQIN  DV ++ + V+L    +C  ++ LL+ RP                  E+ P +  E     D    ++NN       +KDSG+G  TDE+ + +ESSE
Sbjct:   16 KLLYEVSQVNGRDLSKATHEEAVEVFRNAKEPIVVQVLRRAPLLKAHGSSQDVQLTDASTQTDITFEHIMALAKLRPTTPPVPEICPFLLSDSCHSLHPV----------------DHEF--YEGNEYLSSLPTDADRT-EDFECEEIE-----------------------------LCRVKSQEKLGLTVCYRT---DDEEDTGIYISEIDPNSIAARDGRIREGDRILQINGQDVQNREEAVALLSSDECK-KIVLLVARP------------------EMQPKKHEEEEGTTDTATSSSNNN------EKDSGVG-PTDESQRNDESSE 271          

HSP 2 Score: 80.1073 bits (196), Expect = 1.488e-11
Identity = 76/256 (29.69%), Postives = 117/256 (45.70%), Query Frame = 2
Query: 1754 GTKLDPPQTKSPIPLPPASGSNTSAYSTGADSTRSSPLTMELPPTISSASFLS------LKIDVRNNNYKFLDDNFNMSSTRTKYNLSNS--DQKSTSGSSTNNLTESRMASSTILH----QFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQL------IKSDKL-DSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            G KLD       I  P  S  +TS+    A+S RS+PL ++  P  S    +S      L+  +  N       + + +S +TK    NS  ++K T   S  +  + R +   I +      SS  F  IP H+       +Y  Y  L                 I+Q + VE   Y  +QL       +S K  + KMEW VK R DGTRYIT+RP+R+R++K+R  K+ EER+  T ++D  +++ + R W+
Sbjct:  420 GGKLD-----DIIEHPEKSDKDTSSAYNTAESCRSTPLNVDRSPDSSLQRMISITNRKNLRSTIVANQLSSRHSSRDTTSNKTKATEQNSSLEEKETVSESGKSTEQERQSPEHIPYLSPYHSSSYRFGNIPAHAK------HYQSYMQL-----------------IQQKSAVE---YAQSQLSLVNMCKESQKCTEPKMEWKVKIRSDGTRYITKRPVRDRILKERALKIKEERSGMTTDDDTMSEMKMGRYWS 644          
BLAST of PDZ ring finger protein 4 vs. Ensembl Cavefish
Match: pdzrn3a (E3 ubiquitin-protein ligase PDZRN3 [Source:NCBI gene;Acc:103022706])

HSP 1 Score: 78.5666 bits (192), Expect = 2.278e-14
Identity = 54/167 (32.34%), Postives = 89/167 (53.29%), Query Frame = 2
Query: 1064 LRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLE-VKLLLGRPNIISKFNGNTNRNGNYSS-ELPPLEEVEYASVY-----------DEVEGNTNNENKFTQ-MDKDSGIGRGTDEANKTEESSE 1522
            L+K+ +++  GLTL Y      +  E+ +Y+S I+P S+A ++  +R GDQI+QIN +D+ +  + V++  K     V+LLL RP I        + +      E+  LE+    SV+           +E EG T+     +   +KDSG+GR TDE+ + +ESSE
Sbjct:  382 LQKRSTQDKLGLTLCYKT---DEEEETGIYVSEIDPGSIAAQDGRVREGDQIIQINGVDIQNHEEAVAVLSKGNCRNVRLLLARPEIQDDGWLEEDEHSFLEDLEMGTLEKQHCQSVHFTASMLHQREREEDEGTTDTATVLSNPHEKDSGVGR-TDESTRNDESSE 544          

HSP 2 Score: 62.3882 bits (150), Expect = 2.361e-9
Identity = 25/57 (43.86%), Postives = 40/57 (70.18%), Query Frame = 2
Query: 2294 KMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            KMEW VK R DGTRYIT+RP + +++++R  ++ EER   T ++D  ++L + R W+
Sbjct:  853 KMEWKVKIRSDGTRYITKRPAKEQLLRERALRIREERRGMTTDDDTVSELKMGRYWS 909          
BLAST of PDZ ring finger protein 4 vs. Ensembl Cavefish
Match: pdzrn3b (PDZ domain containing ring finger 3 [Source:NCBI gene;Acc:103033977])

HSP 1 Score: 73.559 bits (179), Expect = 7.836e-13
Identity = 57/170 (33.53%), Postives = 90/170 (52.94%), Query Frame = 2
Query: 1091 FGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNII--SKFNGNTNRNGNYSSELPPLEEVEYASV-----------YDEVEGNTNNENKFTQM-DKDSGIGRGTDEANKTEESSE----CDSNQTS 1543
             GLT+ Y      D  E+ +Y+S I+PNS+A ++  IR GD+I+QIN I+V ++ + V+L   +    V LL+ RP I     +  +   +      +  LEE  + ++           +DE  G T+     +Q  +KDSG+GR TDE+ + +ESSE    CD +QTS
Sbjct:  430 LGLTVCYRT---DDEDETGIYVSEIDPNSIAARDGRIREGDRIIQINGIEVQNREEAVALLTSEENQNVCLLVARPEIQLDEGWMDDDRNDFLDDLHMDMLEEQHHQAMQFTASMLEQKKHDEDGGTTDTATLLSQRHEKDSGLGR-TDESTRNDESSEQENLCD-DQTS 594          

HSP 2 Score: 66.6254 bits (161), Expect = 1.110e-10
Identity = 62/222 (27.93%), Postives = 101/222 (45.50%), Query Frame = 2
Query: 1817 NTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMA-----SSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEER-NYTTEEEDIHADLVLNRCWT 2464
            ++SAY+TG +S RS+PLT+EL P  S         DV              SS+R +  + +  Q+ +S +  +   E+             H  S      IP H+       +Y  Y  L     ++   +    SQ+   +   D          +  L+ KMEW VK R DGTRYIT+RP+R+R++++R  ++ EER    T ++D  ++L + R W+
Sbjct:  755 SSSAYNTG-ESCRSTPLTLELSPDNSLRRVGEGPADVGGAAL--------ASSSRIQKPMLSPVQEVSSRNRPSPTEETEPGPQPETKERNAHPRSVYKHAHIPAHA------RHYQSYMQLI----QQKSAVEYGQSQMSLASMCRD---------AAQDLEPKMEWKVKIRSDGTRYITKRPVRDRLLRERALRIREERSGGMTTDDDAVSELKMGRYWS 948          

HSP 3 Score: 53.1434 bits (126), Expect = 1.528e-6
Identity = 22/35 (62.86%), Postives = 29/35 (82.86%), Query Frame = 2
Query:  587 ILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARR 691
            I++VNGKDLS A+H+Q +EAF +A EPI V+V RR
Sbjct:  304 IMEVNGKDLSKATHEQAVEAFRTAKEPIMVQVLRR 338          
BLAST of PDZ ring finger protein 4 vs. Ensembl Cavefish
Match: PDZD4 (PDZ domain containing 4 [Source:HGNC Symbol;Acc:HGNC:21167])

HSP 1 Score: 67.781 bits (164), Expect = 3.890e-11
Identity = 54/171 (31.58%), Postives = 81/171 (47.37%), Query Frame = 2
Query: 1064 LRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPL--EEVEYASVYDEVEGN-------------TNNENKFTQMDKDSGIGRGTDEANKTEESSECD 1528
            L K   ++  GLT+ Y      D  +  +Y+  + PNS+A K   IR GD+ILQIN +DV ++ + V++  ++  +   LLL RP I         R     +E+  L  +E +   V   ++ N              NN  +      DSG+GR TDE+ K EESSE D
Sbjct:   90 LYKSSQQDKLGLTVCYRT---DDEEDQGIYVGEVNPNSIAAKAGRIRKGDRILQINGVDVQNREEAVAILTREDSINFSLLLARPEI--------ERRRGKDAEIKGLLNQEEQQQRVQAGLQENPLHRESPRLSLVTLNNSQEL-----DSGVGR-TDESTKNEESSEHD 243          

HSP 2 Score: 65.0846 bits (157), Expect = 2.828e-10
Identity = 32/91 (35.16%), Postives = 60/91 (65.93%), Query Frame = 2
Query: 2294 KMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWTXXXXXXXXXXXXXXXXXXXMITNCQPTDLPLNGQ 2566
            +MEW VK R DGTRY+ +RP+R+R++K R  K+ EER+  T ++D  +++ + R W+K ++++   K ++++ +R+ +  C+   L   GQ
Sbjct:  596 RMEWKVKIRSDGTRYVAKRPVRDRLLKARAMKIREERSGMTTDDDAVSEMKMGRYWSKEERKQQLLKAREQRRRREFMIQCRLDYLRDQGQ 686          
BLAST of PDZ ring finger protein 4 vs. Ensembl Cavefish
Match: PDZRN4 (PDZ domain containing ring finger 4 [Source:NCBI gene;Acc:103023148])

HSP 1 Score: 66.6254 bits (161), Expect = 9.741e-11
Identity = 69/235 (29.36%), Postives = 112/235 (47.66%), Query Frame = 2
Query: 1817 NTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGS-STNNLTESRMA------SSTILHQFSSTGFPEIPQ-HSSDDTECH--YYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLI--------KSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNY-TTEEEDIHADLVLNRCWT 2464
            ++SAY+T A+S+RS+PL M+  P  S    +SL       N K L  + +   T      S++ +++ SGS   +N +ES         SS    +   +  P + Q H   D   H  +Y  Y  L                 ++Q + VE   Y  +QL          S   + K+EW VK R DGTRYIT+RP+R+R++++R  K+ EER+   T ++D  +++ + R W+
Sbjct:  469 SSSAYNT-AESSRSTPLAMDRSPEHSLQRMVSL------TNQKNLKSSLSSLITGRGSPPSHAIRRAPSGSPDHSNPSESEQTPPAEEESSPRKGKVLGSRIPYLSQRHQQADVPAHARHYQSYMQL-----------------VQQRSAVE---YGQSQLSLLAAGGPQVSRPSEPKLEWKVKVRSDGTRYITKRPVRDRLLRERALKIKEERSSGMTTDDDAMSEMKMGRYWS 676          

HSP 2 Score: 60.4622 bits (145), Expect = 8.417e-9
Identity = 33/83 (39.76%), Postives = 49/83 (59.04%), Query Frame = 2
Query: 1079 SREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF--QKCGLEVKLLLGRPNI 1321
            S+E  GLTL Y      D  +  +Y+S I PNS+A ++  IR GD+ILQIN  DV  + + V++   ++C   + LL+ RP I
Sbjct:  151 SQEKLGLTLCYRT---DDEDDIAIYVSEIGPNSIAARDGRIREGDRILQINGQDVQDRQEAVAVLSSEEC-RNIVLLVARPEI 229          
BLAST of PDZ ring finger protein 4 vs. Ensembl Cavefish
Match: pdzrn4 (PDZ domain-containing RING finger protein 4 [Source:NCBI gene;Acc:103047366])

HSP 1 Score: 65.855 bits (159), Expect = 1.537e-10
Identity = 48/156 (30.77%), Postives = 75/156 (48.08%), Query Frame = 2
Query: 1079 SREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLE-VKLLLGRPNIISKFNGNTNRNGNYSSELPP--LEEVEYASVYDEVEGNTNNENKF----------TQMDKDSGIGRGTDEANKT 1507
            S+E  GLTL Y      D  ++ +Y+S + PNS+A ++  IR GD+ILQIN  DV  + + V+L        + LL+ RP            + ++  EL    LE+     +Y     N + ++K           T  DKDSG+G G +E ++T
Sbjct:  149 SQEKLGLTLCYRT---DDEEDTAIYVSQVGPNSIAARDGRIREGDRILQINGQDVQDREEAVALLSNEDTRNIVLLVTRPEAQMDDGWLDEEHHDFLEELKMDILEQRRKEDIYQ--SANCDKQSKLIEEDKATCSSTLQDKDSGMGYGGEEDSET 299          

HSP 2 Score: 57.7658 bits (138), Expect = 5.315e-8
Identity = 23/59 (38.98%), Postives = 40/59 (67.80%), Query Frame = 2
Query: 2291 SKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEER-NYTTEEEDIHADLVLNRCWT 2464
             ++EW VK R DGT+Y+ RRP R+R++++R  ++ EER    T ++D  ++L + R W+
Sbjct:  652 GRLEWKVKVRADGTKYVARRPARDRILRERALRIREERSGGMTTDDDAASELKMGRYWS 710          
BLAST of PDZ ring finger protein 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000743.1 (pep scaffold:Pmarinus_7.0:GL478474:22919:40568:-1 gene:ENSPMAG00000000678.1 transcript:ENSPMAT00000000743.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 5.871e-11
Identity = 25/57 (43.86%), Postives = 42/57 (73.68%), Query Frame = 2
Query: 2294 KMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            + EW VK R DG+RYIT+RP+R+R++K+R  K+ EER+  T ++D  +++ + R W+
Sbjct:  472 RGEWKVKVRSDGSRYITKRPVRDRLLKERAMKIKEERSGMTTDDDALSEMKMGRYWS 528          

HSP 2 Score: 55.4546 bits (132), Expect = 5.382e-8
Identity = 46/137 (33.58%), Postives = 69/137 (50.36%), Query Frame = 2
Query: 1163 IEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSE--LPPLEEVE------YASVYDEV----EGNTNNENKFTQMDKDSGIGRGTDEANKTE----ESSE 1522
            I+PNS+A K+  IR GD+ILQIN +D+  + + V+L   +    V LLL RP I        +    Y  +  +  LEE +       ASV  +     E +   ++     +KDSG+GR TDE+ + +    ESSE
Sbjct:    2 IDPNSIAAKDGRIREGDRILQINGVDIQGREEAVALLTNEKNRRVSLLLARPEIQLDEGWMEDERSEYLEDISMDVLEEQDNQDFEVNASVPQQQMRTPEDDGTTDSAHNGQEKDSGVGR-TDESTRNDNDENESSE 137          
BLAST of PDZ ring finger protein 4 vs. Ensembl Medaka
Match: pdzrn3b (PDZ domain containing ring finger 3 [Source:NCBI gene;Acc:101166295])

HSP 1 Score: 72.4034 bits (176), Expect = 1.721e-12
Identity = 65/235 (27.66%), Postives = 107/235 (45.53%), Query Frame = 2
Query: 1796 LPPASGSNTS-AYSTGADSTRSSPLTMELPP--TISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQL---------IKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            LP  S  ++S AY+TG +S RS+PLT+EL P  ++   +       +  +  + L    +          S    K + G+     T+ R  S       S      IP H+       +Y  Y  L                 I+Q + VE   Y  +Q+         + +  L+ KMEW VK R DGTRYIT+RP+R++++K+R  +++EER+  T ++D  ++L + R W+
Sbjct:  745 LPEKSDKDSSSAYNTG-ESCRSTPLTLELSPDNSLRRCAENQATAGLSGSTGRMLKPALSPVQEACGPIRSRGSTKDSDGALPVE-TKDRRESGKSSQSRSPYKHAHIPAHAK------HYQSYMQL-----------------IQQKSAVE---YAQSQMSLVSICRDPLSATDLEPKMEWKVKIRSDGTRYITKRPVRDKLLKERAIRIHEERSGLTTDDDAISELKMGRYWS 951          

HSP 2 Score: 69.707 bits (169), Expect = 1.139e-11
Identity = 50/159 (31.45%), Postives = 83/159 (52.20%), Query Frame = 2
Query: 1091 FGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSEL--PPLEEVEYASV-----------YDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSE 1522
             GLTL Y      D  E+ +YIS ++PNS+A K+  IR GD+I+QIN I++ ++   V+L   +    + LL+ RP I    +   +   ++  +L    LE+  + ++            +E  G T+     +   +KDSG+GR TDE+ + +ESSE
Sbjct:  431 LGLTLCYRT---DDEDEAGIYISEVDPNSIAAKDGRIREGDKIIQINGIEIQNREDAVALLTSESNQNISLLVARPEIQLDESWLEDDRNDFLDDLHMDMLEQQHHQAMQFTASMLQQKKLEEDGGTTDTATLLSNHHEKDSGVGR-TDESTRNDESSE 585          
BLAST of PDZ ring finger protein 4 vs. Ensembl Medaka
Match: pdzrn3b (PDZ domain containing ring finger 3 [Source:NCBI gene;Acc:101166295])

HSP 1 Score: 72.4034 bits (176), Expect = 1.721e-12
Identity = 65/235 (27.66%), Postives = 107/235 (45.53%), Query Frame = 2
Query: 1796 LPPASGSNTS-AYSTGADSTRSSPLTMELPP--TISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQL---------IKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            LP  S  ++S AY+TG +S RS+PLT+EL P  ++   +       +  +  + L    +          S    K + G+     T+ R  S       S      IP H+       +Y  Y  L                 I+Q + VE   Y  +Q+         + +  L+ KMEW VK R DGTRYIT+RP+R++++K+R  +++EER+  T ++D  ++L + R W+
Sbjct:  745 LPEKSDKDSSSAYNTG-ESCRSTPLTLELSPDNSLRRCAENQATAGLSGSTGRMLKPALSPVQEACGPIRSRGSTKDSDGALPVE-TKDRRESGKSSQSRSPYKHAHIPAHAK------HYQSYMQL-----------------IQQKSAVE---YAQSQMSLVSICRDPLSATDLEPKMEWKVKIRSDGTRYITKRPVRDKLLKERAIRIHEERSGLTTDDDAISELKMGRYWS 951          

HSP 2 Score: 69.707 bits (169), Expect = 1.139e-11
Identity = 50/159 (31.45%), Postives = 83/159 (52.20%), Query Frame = 2
Query: 1091 FGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSEL--PPLEEVEYASV-----------YDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSE 1522
             GLTL Y      D  E+ +YIS ++PNS+A K+  IR GD+I+QIN I++ ++   V+L   +    + LL+ RP I    +   +   ++  +L    LE+  + ++            +E  G T+     +   +KDSG+GR TDE+ + +ESSE
Sbjct:  431 LGLTLCYRT---DDEDEAGIYISEVDPNSIAAKDGRIREGDKIIQINGIEIQNREDAVALLTSESNQNISLLVARPEIQLDESWLEDDRNDFLDDLHMDMLEQQHHQAMQFTASMLQQKKLEEDGGTTDTATLLSNHHEKDSGVGR-TDESTRNDESSE 585          
BLAST of PDZ ring finger protein 4 vs. Ensembl Medaka
Match: pdzrn3b (PDZ domain containing ring finger 3 [Source:NCBI gene;Acc:101166295])

HSP 1 Score: 72.4034 bits (176), Expect = 1.776e-12
Identity = 65/235 (27.66%), Postives = 107/235 (45.53%), Query Frame = 2
Query: 1796 LPPASGSNTS-AYSTGADSTRSSPLTMELPP--TISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQL---------IKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            LP  S  ++S AY+TG +S RS+PLT+EL P  ++   +       +  +  + L    +          S    K + G+     T+ R  S       S      IP H+       +Y  Y  L                 I+Q + VE   Y  +Q+         + +  L+ KMEW VK R DGTRYIT+RP+R++++K+R  +++EER+  T ++D  ++L + R W+
Sbjct:  716 LPEKSDKDSSSAYNTG-ESCRSTPLTLELSPDNSLRRCAENQATAGLSGSTGRMLKPALSPVQEACGPIRSRGSTKDSDGALPVE-TKDRRESGKSSQSRSPYKHAHIPAHAK------HYQSYMQL-----------------IQQKSAVE---YAQSQMSLVSICRDPLSATDLEPKMEWKVKIRSDGTRYITKRPVRDKLLKERAIRIHEERSGLTTDDDAISELKMGRYWS 922          

HSP 2 Score: 70.0922 bits (170), Expect = 9.423e-12
Identity = 50/159 (31.45%), Postives = 83/159 (52.20%), Query Frame = 2
Query: 1091 FGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSEL--PPLEEVEYASV-----------YDEVEGNTNNENKFT-QMDKDSGIGRGTDEANKTEESSE 1522
             GLTL Y      D  E+ +YIS ++PNS+A K+  IR GD+I+QIN I++ ++   V+L   +    + LL+ RP I    +   +   ++  +L    LE+  + ++            +E  G T+     +   +KDSG+GR TDE+ + +ESSE
Sbjct:  402 LGLTLCYRT---DDEDEAGIYISEVDPNSIAAKDGRIREGDKIIQINGIEIQNREDAVALLTSESNQNISLLVARPEIQLDESWLEDDRNDFLDDLHMDMLEQQHHQAMQFTASMLQQKKLEEDGGTTDTATLLSNHHEKDSGVGR-TDESTRNDESSE 556          
BLAST of PDZ ring finger protein 4 vs. Ensembl Medaka
Match: si:ch73-162j3.4 (PDZ domain containing 4 [Source:NCBI gene;Acc:101170926])

HSP 1 Score: 65.0846 bits (157), Expect = 2.889e-10
Identity = 58/228 (25.44%), Postives = 103/228 (45.18%), Query Frame = 2
Query: 1817 NTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIE-----QNNCVEDHEYINAQLIKSDKLDS-------KMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            +TSAY+TG +S RS+PL  E  P+ S+          R+     L   ++  S R +     S   S   S + ++   R +   +    ++ G PE+    S +          P       + KP  R +S ++      ++C+        + + S  L         +MEW VK R DG+RY+ +RP+R+R++K R  K+ EER+  T ++D  +++ + R W+
Sbjct:  499 STSAYNTGGESCRSTPLVNEQHPSPSTQ---------RDGIPANLSTPYSPHSHR-RGEARTSSPGSKVRSLSRDVGSRRGSDGGVRRNPTAGGMPEMAGGRSAEN--------SPYLSRREAEAKPPQRYHSCMQLGSPSTSDCLVGLREGTCKDVASLSLPPSLLPASPRMEWKVKIRSDGSRYVAKRPVRDRLLKARAMKIREERSGMTTDDDAVSEMKMGRYWS 708          

HSP 2 Score: 63.5438 bits (153), Expect = 8.616e-10
Identity = 48/158 (30.38%), Postives = 79/158 (50.00%), Query Frame = 2
Query: 1070 KKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLF-QKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFTQM----DKDSGIGRGTDEANKTEESSECD 1528
            K + ++  GLT+ Y      D  +  +Y+  + PNS+A  +  IR GD+IL+IN +D+ ++ + V++  ++    V LLL RP I                E+  L E  +      +  NT+ +   T +    + DSG+GR TDE+ + EESSE D
Sbjct:  157 KSRQQDKLGLTVCYRT---DDEEDLGIYVGEVNPNSIAAMDGRIRKGDRILKINGVDIQNREEAVAILTREDSTNVSLLLARPEI----------------EVRKLCEA-FRECAGRLRLNTDLKRHPTVLSNSQELDSGVGR-TDESTRYEESSEHD 293          
BLAST of PDZ ring finger protein 4 vs. Ensembl Medaka
Match: PDZRN4 (PDZ domain-containing RING finger protein 4 [Source:NCBI gene;Acc:101159985])

HSP 1 Score: 64.6994 bits (156), Expect = 3.394e-10
Identity = 63/224 (28.12%), Postives = 110/224 (49.11%), Query Frame = 2
Query: 1817 NTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECH------YYDVYDPLTKSFNEKPKPMSRSNSQIEQ-NNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEER-NYTTEEEDIHADLVLNRCWT 2464
            ++SAY+T A+S+RS+PL M+  P  S    +SL    + N    L     ++++R       S    ++ S T+ + ++   S   + Q +S      P HSS   + +      +Y  Y  L +  +     +  + SQ+   + C E    IN         + KMEW VK R DGTRYIT+RP+R++++++R  K+ EER    T ++D  +++ + R W+
Sbjct:  454 SSSAYNT-AESSRSTPLAMDRSPEHSLQRMVSLT--NQRNLCSGLAGPSVITASRAPTVGKGSSPDHSNPSETDQMPQAEDESKKKVTQCTSQIPYFSPSHSSQQRQVNIPAHASHYQSYMQLIQQHS----AVEYAQSQLSLLSICKEPQRPIN---------EPKMEWKVKIRSDGTRYITKRPVRDKILRERALKIKEERSGGMTTDDDAMSEMKMGRYWS 661          

HSP 2 Score: 55.8398 bits (133), Expect = 1.838e-7
Identity = 31/82 (37.80%), Postives = 47/82 (57.32%), Query Frame = 2
Query: 1079 SREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQ-VVSLFQKCGLEVKLLLGRPNI 1321
            S+E  GLTL Y      D +   +Y+S + PNS+A  +  IR GD+ILQIN  DV  + + + +LF      + LL+ RP++
Sbjct:  151 SQEKLGLTLCYRTDEEEDMA---IYVSEVCPNSIAANDGRIREGDRILQINGQDVKDREEAMAALFNDESRNIVLLVARPDM 229          
BLAST of PDZ ring finger protein 4 vs. Planmine SMEST
Match: SMESG000021620.1 (SMESG000021620.1)

HSP 1 Score: 1287.32 bits (3330), Expect = 0.000e+0
Identity = 704/705 (99.86%), Postives = 705/705 (100.00%), Query Frame = 2
Query:  575 MDFIILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARRYSISNTSVKPTIPFMMDLSVNIPTQSTNDYILPYPSSVFGQPLHGYINSSQKTNQINNHTDSNHSLSSYSNNCALKSFLNDAIKNRDDYSCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSECDSNQTSLKKXXXXXXXXXXXXXXXXXXIAQLMQHLAIEYQQLQKLLHGSSDSSIPRVQALPPPTLFQSTSRIVPRMGTKLDPPQTKSPIPLPPASGSNTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWTXXXXXXXXXXXXXXXXXXXMITNCQPTDLPLNGQCSLKNDVYVANNRSFHKDFQNKNLINRNCDIAAFLVGSTMF 2689
            MDFIILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARRYSISNTSVKPTIPFMMDLSVNIPTQSTNDYILPYP+SVFGQPLHGYINSSQKTNQINNHTDSNHSLSSYSNNCALKSFLNDAIKNRDDYSCGDLLKIEGILEEEEDAELDDDEEQVEIIKEEVVLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSECDSNQTSLKKSAQYQSSDSSGSRPDPQQIAQLMQHLAIEYQQLQKLLHGSSDSSIPRVQALPPPTLFQSTSRIVPRMGTKLDPPQTKSPIPLPPASGSNTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWTKSDKRKYYDKVKDKKHKRKMITNCQPTDLPLNGQCSLKNDVYVANNRSFHKDFQNKNLINRNCDIAAFLVGSTMF
Sbjct:    1 MDFIILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARRYSISNTSVKPTIPFMMDLSVNIPTQSTNDYILPYPTSVFGQPLHGYINSSQKTNQINNHTDSNHSLSSYSNNCALKSFLNDAIKNRDDYSCGDLLKIEGILEEEEDAELDDDEEQVEIIKEEVVLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSECDSNQTSLKKSAQYQSSDSSGSRPDPQQIAQLMQHLAIEYQQLQKLLHGSSDSSIPRVQALPPPTLFQSTSRIVPRMGTKLDPPQTKSPIPLPPASGSNTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWTKSDKRKYYDKVKDKKHKRKMITNCQPTDLPLNGQCSLKNDVYVANNRSFHKDFQNKNLINRNCDIAAFLVGSTMF 705          
BLAST of PDZ ring finger protein 4 vs. Planmine SMEST
Match: SMESG000021620.1 (SMESG000021620.1)

HSP 1 Score: 1283.47 bits (3320), Expect = 0.000e+0
Identity = 704/706 (99.72%), Postives = 705/706 (99.86%), Query Frame = 2
Query:  575 MDFIILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARRYSISNTSVKPTIPFMMDLSVNIPTQSTNDYILPYPSSVFGQPLHGYINSSQKTNQINNHTDSNHSLSSYSNNCALKSFLNDAIKNRDDYSCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSECDSNQTSLKKXXXXXXXXXXXXXXXXXXIAQLMQHLAIEYQQLQKLLHGSSDSSIPRVQALPPPTLFQSTSRIVPRMGTKLDPPQTKSPIPLPPA-SGSNTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWTXXXXXXXXXXXXXXXXXXXMITNCQPTDLPLNGQCSLKNDVYVANNRSFHKDFQNKNLINRNCDIAAFLVGSTMF 2689
            MDFIILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARRYSISNTSVKPTIPFMMDLSVNIPTQSTNDYILPYP+SVFGQPLHGYINSSQKTNQINNHTDSNHSLSSYSNNCALKSFLNDAIKNRDDYSCGDLLKIEGILEEEEDAELDDDEEQVEIIKEEVVLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSECDSNQTSLKKSAQYQSSDSSGSRPDPQQIAQLMQHLAIEYQQLQKLLHGSSDSSIPRVQALPPPTLFQSTSRIVPRMGTKLDPPQTKSPIPLPPA SGSNTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWTKSDKRKYYDKVKDKKHKRKMITNCQPTDLPLNGQCSLKNDVYVANNRSFHKDFQNKNLINRNCDIAAFLVGSTMF
Sbjct:    1 MDFIILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARRYSISNTSVKPTIPFMMDLSVNIPTQSTNDYILPYPTSVFGQPLHGYINSSQKTNQINNHTDSNHSLSSYSNNCALKSFLNDAIKNRDDYSCGDLLKIEGILEEEEDAELDDDEEQVEIIKEEVVLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSECDSNQTSLKKSAQYQSSDSSGSRPDPQQIAQLMQHLAIEYQQLQKLLHGSSDSSIPRVQALPPPTLFQSTSRIVPRMGTKLDPPQTKSPIPLPPAASGSNTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWTKSDKRKYYDKVKDKKHKRKMITNCQPTDLPLNGQCSLKNDVYVANNRSFHKDFQNKNLINRNCDIAAFLVGSTMF 706          
BLAST of PDZ ring finger protein 4 vs. Planmine SMEST
Match: SMESG000021620.1 (SMESG000021620.1)

HSP 1 Score: 1173.69 bits (3035), Expect = 0.000e+0
Identity = 651/653 (99.69%), Postives = 652/653 (99.85%), Query Frame = 2
Query:  734 MMDLSVNIPTQSTNDYILPYPSSVFGQPLHGYINSSQKTNQINNHTDSNHSLSSYSNNCALKSFLNDAIKNRDDYSCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSECDSNQTSLKKXXXXXXXXXXXXXXXXXXIAQLMQHLAIEYQQLQKLLHGSSDSSIPRVQALPPPTLFQSTSRIVPRMGTKLDPPQTKSPIPLPPA-SGSNTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWTXXXXXXXXXXXXXXXXXXXMITNCQPTDLPLNGQCSLKNDVYVANNRSFHKDFQNKNLINRNCDIAAFLVGSTMF 2689
            MMDLSVNIPTQSTNDYILPYP+SVFGQPLHGYINSSQKTNQINNHTDSNHSLSSYSNNCALKSFLNDAIKNRDDYSCGDLLKIEGILEEEEDAELDDDEEQVEIIKEEVVLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSECDSNQTSLKKSAQYQSSDSSGSRPDPQQIAQLMQHLAIEYQQLQKLLHGSSDSSIPRVQALPPPTLFQSTSRIVPRMGTKLDPPQTKSPIPLPPA SGSNTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWTKSDKRKYYDKVKDKKHKRKMITNCQPTDLPLNGQCSLKNDVYVANNRSFHKDFQNKNLINRNCDIAAFLVGSTMF
Sbjct:    1 MMDLSVNIPTQSTNDYILPYPTSVFGQPLHGYINSSQKTNQINNHTDSNHSLSSYSNNCALKSFLNDAIKNRDDYSCGDLLKIEGILEEEEDAELDDDEEQVEIIKEEVVLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSECDSNQTSLKKSAQYQSSDSSGSRPDPQQIAQLMQHLAIEYQQLQKLLHGSSDSSIPRVQALPPPTLFQSTSRIVPRMGTKLDPPQTKSPIPLPPAASGSNTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWTKSDKRKYYDKVKDKKHKRKMITNCQPTDLPLNGQCSLKNDVYVANNRSFHKDFQNKNLINRNCDIAAFLVGSTMF 653          
BLAST of PDZ ring finger protein 4 vs. Planmine SMEST
Match: SMESG000021620.1 (SMESG000021620.1)

HSP 1 Score: 1171.38 bits (3029), Expect = 0.000e+0
Identity = 650/652 (99.69%), Postives = 651/652 (99.85%), Query Frame = 2
Query:  737 MDLSVNIPTQSTNDYILPYPSSVFGQPLHGYINSSQKTNQINNHTDSNHSLSSYSNNCALKSFLNDAIKNRDDYSCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSECDSNQTSLKKXXXXXXXXXXXXXXXXXXIAQLMQHLAIEYQQLQKLLHGSSDSSIPRVQALPPPTLFQSTSRIVPRMGTKLDPPQTKSPIPLPPA-SGSNTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWTXXXXXXXXXXXXXXXXXXXMITNCQPTDLPLNGQCSLKNDVYVANNRSFHKDFQNKNLINRNCDIAAFLVGSTMF 2689
            MDLSVNIPTQSTNDYILPYP+SVFGQPLHGYINSSQKTNQINNHTDSNHSLSSYSNNCALKSFLNDAIKNRDDYSCGDLLKIEGILEEEEDAELDDDEEQVEIIKEEVVLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSECDSNQTSLKKSAQYQSSDSSGSRPDPQQIAQLMQHLAIEYQQLQKLLHGSSDSSIPRVQALPPPTLFQSTSRIVPRMGTKLDPPQTKSPIPLPPA SGSNTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWTKSDKRKYYDKVKDKKHKRKMITNCQPTDLPLNGQCSLKNDVYVANNRSFHKDFQNKNLINRNCDIAAFLVGSTMF
Sbjct:    1 MDLSVNIPTQSTNDYILPYPTSVFGQPLHGYINSSQKTNQINNHTDSNHSLSSYSNNCALKSFLNDAIKNRDDYSCGDLLKIEGILEEEEDAELDDDEEQVEIIKEEVVLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLEVKLLLGRPNIISKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFTQMDKDSGIGRGTDEANKTEESSECDSNQTSLKKSAQYQSSDSSGSRPDPQQIAQLMQHLAIEYQQLQKLLHGSSDSSIPRVQALPPPTLFQSTSRIVPRMGTKLDPPQTKSPIPLPPAASGSNTSAYSTGADSTRSSPLTMELPPTISSASFLSLKIDVRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTILHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIEQNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWTKSDKRKYYDKVKDKKHKRKMITNCQPTDLPLNGQCSLKNDVYVANNRSFHKDFQNKNLINRNCDIAAFLVGSTMF 652          
BLAST of PDZ ring finger protein 4 vs. Planmine SMEST
Match: SMESG000070317.1 (SMESG000070317.1)

HSP 1 Score: 72.7886 bits (177), Expect = 4.427e-13
Identity = 28/56 (50.00%), Postives = 43/56 (76.79%), Query Frame = 2
Query: 2297 MEWVVKKRPDGTRYITRRPIRNRMMKDREKKLNEERNYTTEEEDIHADLVLNRCWT 2464
            MEWV+KKRPDG++Y+TRRP RN+ +K+R K++  ER   T ++D H+++ L R W+
Sbjct:  340 MEWVLKKRPDGSKYVTRRPKRNKFLKERAKQVVAERTGGTTDDDAHSEIKLGRYWS 395          

HSP 2 Score: 65.855 bits (159), Expect = 8.342e-11
Identity = 33/70 (47.14%), Postives = 47/70 (67.14%), Query Frame = 2
Query: 1091 FGLTLSYSALSASDNSESEVYISAIEPNSVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLEVKL 1300
            +GLTLSY  L      E+ V+IS IE NS+A    N+R+G++IL IN+  V S++QV+ LF++  LEV L
Sbjct:  108 YGLTLSYELLQLEKEVETSVFISEIEKNSLASFNSNLRVGNEILAINDEPVKSRSQVIDLFRQSDLEVVL 177          

HSP 3 Score: 53.5286 bits (127), Expect = 6.249e-7
Identity = 21/39 (53.85%), Postives = 30/39 (76.92%), Query Frame = 2
Query:  575 MDFIILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARR 691
            MDFIILK+NGKD++T SH + ++ FN A +   VE+AR+
Sbjct:    1 MDFIILKINGKDVTTCSHDEAVKYFNEAPDRFLVEIARK 39          
The following BLAST results are available for this feature:
BLAST of PDZ ring finger protein 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDZRN43.074e-1830.41PDZ domain containing ring finger 4 [Source:HGNC S... [more]
PDZRN41.109e-1729.73PDZ domain containing ring finger 4 [Source:HGNC S... [more]
PDZRN42.019e-1730.39PDZ domain containing ring finger 4 [Source:HGNC S... [more]
PDZRN31.527e-1233.14PDZ domain containing ring finger 3 [Source:HGNC S... [more]
PDZRN31.796e-1233.14PDZ domain containing ring finger 3 [Source:HGNC S... [more]
back to top
BLAST of PDZ ring finger protein 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C50F7.61.054e-641.82pep chromosome:WBcel235:IV:7720566:7723199:-1 gene... [more]
C50F7.61.144e-641.82pep chromosome:WBcel235:IV:7720568:7722408:-1 gene... [more]
back to top
BLAST of PDZ ring finger protein 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Slip14.070e-740.28gene:FBgn0024728 transcript:FBtr0310536[more]
Slip14.338e-744.83gene:FBgn0024728 transcript:FBtr0089090[more]
back to top
BLAST of PDZ ring finger protein 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX640588.18.609e-1229.18pep chromosome:GRCz11:CHR_ALT_CTG6_1_42:44244096:4... [more]
pdzrn3b8.666e-1229.18PDZ domain containing RING finger 3b [Source:NCBI ... [more]
pdzrn3b8.944e-1229.18PDZ domain containing RING finger 3b [Source:NCBI ... [more]
pdzrn3b9.156e-1229.18PDZ domain containing RING finger 3b [Source:NCBI ... [more]
PDZD41.850e-1131.68si:ch73-162j3.4 [Source:ZFIN;Acc:ZDB-GENE-090313-1... [more]
back to top
BLAST of PDZ ring finger protein 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frem22.998e-1427.92FRAS1 related extracellular matrix protein 2 [Sour... [more]
pip5k1c6.652e-1428.94phosphatidylinositol-4-phosphate 5-kinase, type I,... [more]
frem23.009e-1226.48FRAS1 related extracellular matrix protein 2 [Sour... [more]
frem23.283e-1226.48FRAS1 related extracellular matrix protein 2 [Sour... [more]
frem23.439e-1226.48FRAS1 related extracellular matrix protein 2 [Sour... [more]
back to top
BLAST of PDZ ring finger protein 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pdzrn47.778e-1329.41PDZ domain containing RING finger 4 [Source:MGI Sy... [more]
Pdzrn41.218e-1229.41PDZ domain containing RING finger 4 [Source:MGI Sy... [more]
Pdzrn34.921e-1232.56PDZ domain containing RING finger 3 [Source:MGI Sy... [more]
Pdzrn31.642e-1132.56PDZ domain containing RING finger 3 [Source:MGI Sy... [more]
Pdzd45.494e-1043.86PDZ domain containing 4 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of PDZ ring finger protein 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6ZMN7|PZRN4_HUMAN1.476e-1730.41PDZ domain-containing RING finger protein 4 OS=Hom... [more]
sp|Q9UPQ7|PZRN3_HUMAN3.707e-1133.14E3 ubiquitin-protein ligase PDZRN3 OS=Homo sapiens... [more]
sp|E7FDW2|PZR3B_DANRE6.752e-1129.18E3 ubiquitin-protein ligase PDZRN3-B OS=Danio reri... [more]
sp|Q69ZS0|PZRN3_MOUSE1.148e-1032.56E3 ubiquitin-protein ligase PDZRN3 OS=Mus musculus... [more]
sp|P68907|PZRN3_RAT1.188e-1032.56E3 ubiquitin-protein ligase PDZRN3 OS=Rattus norve... [more]
back to top
BLAST of PDZ ring finger protein 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A023ZS190.000e+099.80PDZ ring finger protein 4 (Fragment) OS=Schmidtea ... [more]
A0A1I7RIJ29.595e-2025.79PDZ domain-containing protein OS=Bursaphelenchus x... [more]
H0X8S84.333e-1729.03PDZ domain containing ring finger 4 OS=Otolemur ga... [more]
G5BGJ92.323e-1630.56PDZ domain-containing RING finger protein 4 OS=Het... [more]
A0A402FLH32.775e-1627.33PDZ domain-containing protein OS=Paroedura picta O... [more]
back to top
BLAST of PDZ ring finger protein 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdzrn3a2.278e-1432.34E3 ubiquitin-protein ligase PDZRN3 [Source:NCBI ge... [more]
pdzrn3b7.836e-1333.53PDZ domain containing ring finger 3 [Source:NCBI g... [more]
PDZD43.890e-1131.58PDZ domain containing 4 [Source:HGNC Symbol;Acc:HG... [more]
PDZRN49.741e-1129.36PDZ domain containing ring finger 4 [Source:NCBI g... [more]
pdzrn41.537e-1030.77PDZ domain-containing RING finger protein 4 [Sourc... [more]
back to top
BLAST of PDZ ring finger protein 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000743.15.871e-1143.86pep scaffold:Pmarinus_7.0:GL478474:22919:40568:-1 ... [more]
back to top
BLAST of PDZ ring finger protein 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PDZ ring finger protein 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PDZ ring finger protein 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdzrn3b1.721e-1227.66PDZ domain containing ring finger 3 [Source:NCBI g... [more]
pdzrn3b1.721e-1227.66PDZ domain containing ring finger 3 [Source:NCBI g... [more]
pdzrn3b1.776e-1227.66PDZ domain containing ring finger 3 [Source:NCBI g... [more]
si:ch73-162j3.42.889e-1025.44PDZ domain containing 4 [Source:NCBI gene;Acc:1011... [more]
PDZRN43.394e-1028.13PDZ domain-containing RING finger protein 4 [Sourc... [more]
back to top
BLAST of PDZ ring finger protein 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021620.10.000e+099.86SMESG000021620.1[more]
SMESG000021620.10.000e+099.72SMESG000021620.1[more]
SMESG000021620.10.000e+099.69SMESG000021620.1[more]
SMESG000021620.10.000e+099.69SMESG000021620.1[more]
SMESG000070317.14.427e-1350.00SMESG000070317.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30034470
GenBankAHY82407.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034470 ID=SMED30034470|Name=PDZ ring finger protein 4|organism=Schmidtea mediterranea sexual|type=transcript|length=2802bp
TAACAATCAGATTTCATCCAGCCATAGAAATGTTCTCACTCATCCGTATC
TTTGCAATAATATCCACATTGGCTGCACACAGTCGCGTGGACCCTTGCAC
GCATGCTTACACTCACACGCACACGCACACGATGATCACACGTCAAATGG
ATTTATAATCAATCGCATATAAGCAAACATTAATCGATCGATCTAATATT
AAAAAATTACGACGCATCATATTACAACCAATCGTGATGTAATCGACCTC
AAAATCAACCAATCAGATTTGCCATAGAAATAAGCAAGTGCATTAGAAAC
AAATATTATTCCATAACCGAAAAGTCACCAAAGACCAGCACGAAATAATC
AAAACACATGCCGGTTTATTGATAAATAGTGACAGATTTTTCACTCGGGA
TTTTTTTTCTATTTTTGCTTCGGGTTTTTTTATTGAGTCGCCGTTCAGTT
GACGCGATCGGGAAAACGATAAAACGCAATTTGACCAGATTCAACAGAAT
GCTGTGATTGATTGTGCTATGTGCCGTTGATTAAATTTGTTCACACTCGA
CTGAATTATTATTATTGAAATCGAATGGATTTTATTATCTTGAAGGTAAA
CGGAAAAGATCTTTCTACTGCGTCTCACCAGCAAGTTTTGGAAGCATTTA
ATTCGGCATCAGAGCCTATTTTTGTCGAAGTAGCCAGACGTTATTCCATA
TCAAACACTTCGGTGAAACCGACTATTCCATTCATGATGGACTTATCAGT
TAATATCCCCACACAATCGACAAATGATTACATTCTTCCATATCCCTCTT
CAGTTTTCGGGCAACCTTTGCATGGATATATTAATTCCTCCCAGAAAACA
AATCAGATCAATAATCACACCGACAGCAACCATAGTCTTTCTTCATATTC
GAATAATTGCGCGCTGAAATCATTTCTTAATGACGCCATAAAAAACCGAG
ATGATTATAGCTGTGGAGATCTGTTAAAAATCGAAGGAATTCTCGAAGAG
GAAGAAGATGCTGAACTCGACGATGATGAAGAACAAGTTGAAATAATAAA
AGAGGAAGTGGTCTTGAGAAAGAAACAATCTCGTGAAATATTCGGCCTGA
CACTTTCCTACAGCGCGTTGTCAGCAAGCGATAACTCAGAATCCGAAGTT
TATATCAGCGCAATCGAGCCAAATAGTGTGGCCAAAAAGGAGCCCAATAT
TCGATTGGGGGATCAGATTCTACAGATAAATAATATTGACGTCCATTCAA
AGGCTCAAGTTGTATCTTTATTTCAGAAATGTGGATTGGAAGTGAAATTG
TTGCTTGGTCGACCTAATATCATTTCAAAATTCAACGGAAATACCAATAG
AAATGGGAATTACAGCTCTGAACTTCCTCCTCTTGAAGAAGTCGAATATG
CCTCGGTCTATGATGAGGTTGAGGGAAACACCAACAACGAGAACAAATTC
ACTCAGATGGATAAAGATTCTGGAATTGGTCGAGGCACAGACGAAGCAAA
CAAAACTGAAGAAAGCAGTGAATGTGATTCAAATCAGACTTCATTAAAGA
AATCAGCTCAATATCAGTCTTCAGATAGTTCGGGTTCCAGGCCAGATCCA
CAACAAATTGCTCAACTAATGCAACATCTCGCTATTGAATATCAACAACT
ACAGAAATTGTTGCATGGTTCTTCAGATTCATCTATTCCAAGAGTTCAAG
CTCTTCCACCACCAACACTCTTTCAGTCGACTTCTAGAATTGTGCCTCGA
ATGGGCACAAAACTTGATCCTCCTCAAACTAAGTCACCAATTCCTTTACC
ACCAGCAAGCGGCAGTAACACAAGTGCCTACAGTACTGGAGCGGACAGCA
CTCGCAGTTCTCCACTTACAATGGAATTGCCTCCAACCATCAGTTCTGCA
TCCTTCCTTTCTCTCAAAATCGACGTCCGCAACAATAACTACAAATTCTT
AGATGACAATTTCAACATGTCATCTACTCGGACAAAATATAACTTGTCGA
ATTCAGATCAAAAAAGCACCAGCGGCTCTTCCACAAACAACTTGACTGAA
TCTCGCATGGCATCGAGTACAATATTGCATCAGTTTTCTAGCACTGGATT
TCCAGAAATACCACAGCATTCGTCAGATGACACCGAATGTCATTATTACG
ATGTCTATGATCCCCTTACTAAGTCTTTTAACGAGAAACCAAAACCAATG
TCTAGAAGTAATTCCCAAATCGAACAAAACAATTGTGTAGAGGATCACGA
ATATATCAATGCTCAACTTATCAAATCCGACAAACTGGACAGCAAAATGG
AGTGGGTCGTCAAAAAGCGGCCAGATGGGACAAGATACATCACCAGACGA
CCTATAAGGAATAGAATGATGAAGGATAGAGAAAAAAAACTAAATGAGGA
AAGGAATTACACGACCGAGGAGGAAGACATTCATGCGGATCTTGTTTTGA
ACAGATGCTGGACGAAATCAGACAAGCGAAAATACTATGACAAGGTGAAA
GATAAAAAACATAAGCGAAAAATGATTACCAATTGTCAGCCAACAGACCT
ACCCTTAAATGGTCAATGTTCATTGAAAAATGACGTCTATGTTGCCAATA
ATCGCTCATTTCACAAAGATTTTCAAAACAAAAACCTTATAAATCGGAAT
TGTGACATTGCTGCGTTTCTTGTCGGCTCAACCATGTTTTGATTGATGGG
AATCCTGTGTAAAAATTATTTAACTGGCTTATTTGGTCTATTGCATGTAT
TTGATCATGCGCGTTATCACAAATTTATAACTGTTCATATAAGAGATCGG
AA
back to top

protein sequence of SMED30034470-orf-1

>SMED30034470-orf-1 ID=SMED30034470-orf-1|Name=SMED30034470-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=706bp
MDFIILKVNGKDLSTASHQQVLEAFNSASEPIFVEVARRYSISNTSVKPT
IPFMMDLSVNIPTQSTNDYILPYPSSVFGQPLHGYINSSQKTNQINNHTD
SNHSLSSYSNNCALKSFLNDAIKNRDDYSCGDLLKIEGILEEEEDAELDD
DEEQVEIIKEEVVLRKKQSREIFGLTLSYSALSASDNSESEVYISAIEPN
SVAKKEPNIRLGDQILQINNIDVHSKAQVVSLFQKCGLEVKLLLGRPNII
SKFNGNTNRNGNYSSELPPLEEVEYASVYDEVEGNTNNENKFTQMDKDSG
IGRGTDEANKTEESSECDSNQTSLKKSAQYQSSDSSGSRPDPQQIAQLMQ
HLAIEYQQLQKLLHGSSDSSIPRVQALPPPTLFQSTSRIVPRMGTKLDPP
QTKSPIPLPPASGSNTSAYSTGADSTRSSPLTMELPPTISSASFLSLKID
VRNNNYKFLDDNFNMSSTRTKYNLSNSDQKSTSGSSTNNLTESRMASSTI
LHQFSSTGFPEIPQHSSDDTECHYYDVYDPLTKSFNEKPKPMSRSNSQIE
QNNCVEDHEYINAQLIKSDKLDSKMEWVVKKRPDGTRYITRRPIRNRMMK
DREKKLNEERNYTTEEEDIHADLVLNRCWTKSDKRKYYDKVKDKKHKRKM
ITNCQPTDLPLNGQCSLKNDVYVANNRSFHKDFQNKNLINRNCDIAAFLV
GSTMF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR001478PDZ
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 141..161
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 471..490
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 300..314
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 394..433
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 408..433
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 284..342
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 315..342
NoneNo IPR availablePANTHERPTHR15545PDZ DOMAIN CONTAINING RING FINGER PROTEIN 3, 4coord: 412..652
coord: 5..331
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 161..244
e-value: 2.46603E-14
score: 66.4362
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 171..248
e-value: 6.6E-11
score: 52.2
IPR001478PDZ domainPFAMPF00595PDZcoord: 166..243
e-value: 4.6E-8
score: 33.3
IPR001478PDZ domainPROSITEPS50106PDZcoord: 161..248
score: 15.521
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 137..252
e-value: 6.6E-16
score: 60.2
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 4..60
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 160..247