Integrase catalytic domain-containing protein

Overview
NameIntegrase catalytic domain-containing protein
Smed IDSMED30034469
Length (bp)1410
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Integrase catalytic domain-containing protein (SMED30034469) t-SNE clustered cells

Violin plots show distribution of expression levels for Integrase catalytic domain-containing protein (SMED30034469) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Integrase catalytic domain-containing protein (SMED30034469) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Integrase catalytic domain-containing protein (SMED30034469) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034469

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30034469 dd_Smed_v4_33112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034469 dd_Smed_v4_33112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034469 dd_Smed_v4_33112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01030006.1 (pep scaffold:GRCz11:KN150258.1:33006:36502:-1 gene:ENSDARG00000114113.1 transcript:ENSDART00000182402.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01030006.1)

HSP 1 Score: 55.0694 bits (131), Expect = 7.289e-8
Identity = 26/105 (24.76%), Postives = 56/105 (53.33%), Query Frame = 3
Query:  741 IDFCRPFNQTIHDKQNILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTIR 1055
            +D   P  ++    + +L  +D FS+++ L  + H   +T A +L+++ L  +     + SD+G  F S +  EL    ++  + +++YH +TN + +R  RT++
Sbjct:   43 VDIMGPMPKSGKQNEYLLVFVDYFSKWVELFPMRHATAQTIATILRQEMLTRWGVPDFILSDRGAQFVSSLFTELCGKWNITPKLTTAYHPQTN-MTERVNRTLK 146          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000023941.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV463742.1:21:4282:-1 gene:ENSXETG00000015734.1 transcript:ENSXETT00000023941.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 9.402e-8
Identity = 34/108 (31.48%), Postives = 55/108 (50.93%), Query Frame = 3
Query:  720 EVYKKIFIDFCRPFNQTIH-DKQNILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVA-AKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKR 1037
            E ++++ +D   P ++     KQ IL ++D  +RY    A+  ++  T A  L +  +   V     + SD+G  F SQ+L  L     V+  HSS YH +TNGL +R
Sbjct:  706 EPFQRVAVDLIGPLSRPSRSGKQYILTVMDYATRYPEAVALRKIDAPTVADALIQ--IFSRVGFPSEILSDQGPQFTSQLLQCLWQRCGVRAIHSSPYHPQTNGLCER 811          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000025355.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:22781891:22783779:1 gene:ENSXETG00000014447.1 transcript:ENSXETT00000025355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 3.694e-7
Identity = 28/89 (31.46%), Postives = 49/89 (55.06%), Query Frame = 3
Query:  786 NILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            N+L + D ++RY            T AKVL E+  + +   K +HSD+G+ FES+++ EL++   V K  ++ YH + +   +R  RT+
Sbjct:  207 NVLVVTDHYTRYAQAFPTKDQRAITVAKVLVERFFIHYGLPKRIHSDQGRDFESKLVHELMSMLGVLKSRTTPYHPQGDPQPERFNRTL 295          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000006041.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:37317867:37322724:1 gene:ENSXETG00000003070.1 transcript:ENSXETT00000006041.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 5.013e-7
Identity = 28/89 (31.46%), Postives = 49/89 (55.06%), Query Frame = 3
Query:  786 NILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            N+L + D ++RY            T AKVL E+  + +   K +HSD+G+ FES+++ EL++   V K  ++ YH + +   +R  RT+
Sbjct:  994 NVLVVTDHYTRYAQAFPTKDQRAITVAKVLVERFFIHYGLPKRIHSDQGRDFESKLVHELMSMLGVLKSRTTPYHPQGDPQPERFNRTL 1082          
BLAST of Integrase catalytic domain-containing protein vs. UniProt/SwissProt
Match: sp|P10394|POL4_DROME (Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster OX=7227 GN=POL PE=4 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.850e-7
Identity = 29/119 (24.37%), Postives = 66/119 (55.46%), Query Frame = 3
Query:  696 MIIRQSTDEVYKKIFIDFCRPFNQTIHDKQNILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            M I ++ +  + ++ +D   P  ++ +  +  + +I   ++Y+    +A+ + KT AK + E  +L++   KT  +D G  +++ I+ +L     +K   S+++HH+T G+V+R  RT+
Sbjct:  955 MTITETPEHAFDRVVVDTIGPLPKSENGNEYAVTLICDLTKYLVAIPIANKSAKTVAKAIFESFILKYGPMKTFITDMGTEYKNSIITDLCKYLKIKNITSTAHHHQTVGVVERSHRTL 1073          
BLAST of Integrase catalytic domain-containing protein vs. TrEMBL
Match: A0A5S6QWV2 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 8.456e-14
Identity = 45/139 (32.37%), Postives = 78/139 (56.12%), Query Frame = 3
Query:  636 CNRK*CRMPKTEDVDRRTN*MIIRQSTDEVYKKIFIDFCRPFNQTIHDKQNILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            C+   CR    +   RR+   +    T   ++++ IDF  P  +T   K+ +L ++D F+++    A  ++  KT AKVL +  +  F   ++VHSD+G+ FE+ +L E      +KK H++SYH ++NGLV+R  RT+
Sbjct:  754 CDACACR----KGPSRRSRQPLQSIQTGYPFQRVGIDFLGPLPKTTTGKRYVLVVVDYFTKWTEAYATENMEAKTVAKVLVDNFITRFGPPESVHSDQGRSFEATLLAETFQLLGIKKTHTTSYHPQSNGLVERFNRTL 888          
BLAST of Integrase catalytic domain-containing protein vs. TrEMBL
Match: A0A5S6PYL2 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 5.420e-12
Identity = 37/109 (33.94%), Postives = 66/109 (60.55%), Query Frame = 3
Query:  726 YKKIFIDFCRPFNQTIHDKQNILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            ++++ IDF  P   T + K+ +LA+ D F+++    A  ++   T AK+L +  +  F   ++VHSD+G+ FE+ ++ EL     VKK  ++ YH ++NGLV+R  RT+
Sbjct:  791 FQRVGIDFLGPLPTTTNGKRYVLAVCDYFTKWTEAYATENMEATTVAKLLIDNYITRFGPPESVHSDQGRNFEALLMTELFRLLDVKKTRTTPYHPQSNGLVERFNRTL 899          
BLAST of Integrase catalytic domain-containing protein vs. TrEMBL
Match: A0A0V0SWC2 (Retrovirus-related Pol polyprotein from transposon (Fragment) OS=Trichinella murrelli OX=144512 GN=POL PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 5.870e-12
Identity = 34/108 (31.48%), Postives = 61/108 (56.48%), Query Frame = 3
Query:  729 KKIFIDFCRPFNQTIHDKQNILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            +++ +D   P  +T    + +L + D F+++ +   +A++   T AKVL EK +  F A   +HSD+G+ FE+ ++ E+     +KK  SS YH + NG  +R  RT+
Sbjct:   11 QRVGMDILGPLEKTPSGNRYVLVLTDYFTKWTAAFPLANMEASTVAKVLVEKYIAYFGAPDYLHSDQGRSFEASVVLEMCRLFGIKKTRSSPYHPQGNGQAERFNRTL 118          
BLAST of Integrase catalytic domain-containing protein vs. TrEMBL
Match: A0A085N1U6 (Integrase catalytic domain-containing protein OS=Trichuris suis OX=68888 GN=M514_24368 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.214e-12
Identity = 36/109 (33.03%), Postives = 66/109 (60.55%), Query Frame = 3
Query:  726 YKKIFIDFCRPFNQTIHDKQNILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            +++I +DF  P   T   K+ +L + D F+++    A  ++   T AKVL +  +  F   ++VHSD+G+ FE++++ EL     +KK  +++YH ++NGLV+R  RT+
Sbjct:  190 FQRIGVDFLGPLPTTTTGKRYVLTVCDYFTKWAEAFATDNMEATTVAKVLTDNFVTRFGPPESVHSDQGRSFEARLMTELFQLLGIKKTRTTAYHPQSNGLVERFNRTL 298          
BLAST of Integrase catalytic domain-containing protein vs. TrEMBL
Match: A0A085LTK0 (Uncharacterized protein OS=Trichuris suis OX=68888 GN=M513_10788 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 8.327e-12
Identity = 36/109 (33.03%), Postives = 66/109 (60.55%), Query Frame = 3
Query:  726 YKKIFIDFCRPFNQTIHDKQNILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            +++I +DF  P   T   K+ +L + D F+++    A  ++   T AKVL +  +  F   ++VHSD+G+ FE++++ EL     +KK  +++YH ++NGLV+R  RT+
Sbjct:  773 FQRIGVDFLGPLPTTTTGKRYVLTVCDYFTKWAEAFATDNMEATTVAKVLTDNFVTRFGPPESVHSDQGRSFEARLMTELFQLLGIKKTRTTAYHPQSNGLVERFNRTL 881          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000031920.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:11094903:11101818:1 gene:ENSAMXG00000039354.1 transcript:ENSAMXT00000031920.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 9.289e-14
Identity = 35/118 (29.66%), Postives = 67/118 (56.78%), Query Frame = 3
Query:  699 IIRQSTDEVYKKIFIDFCRPFNQTIHDKQNILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            ++   T   Y++I +D   P  +T    + IL + D FS++    ++ +   KT AKVL E+ +  + A +++H+D+G+ FES +  EL    ++ K  +S Y  +++GL++R  RT+
Sbjct:   28 LLPSVTSRPYERIALDILGPLPETPQKNRYILVVGDYFSKWTEAFSLPNQEAKTVAKVLTEEWICRYGAPRSIHTDQGRNFESHLFSELCRLLNMHKSRTSPYRPQSDGLIERFNRTL 145          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000058127.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:35454045:35455481:1 gene:ENSAMXG00000038477.1 transcript:ENSAMXT00000058127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 1.181e-13
Identity = 35/113 (30.97%), Postives = 65/113 (57.52%), Query Frame = 3
Query:  714 TDEVYKKIFIDFCRPFNQTIHDKQNILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            T   Y++I +D   P  +T    + IL + D FS++    ++ +   KT AKVL E+ +  + A +++H+D+G+ FES +  EL    ++ K  +S Y  +++GL++R  RT+
Sbjct:   69 TSRPYERIALDILGPLPETPQKNRYILVVGDYFSKWTEAFSLPNQEAKTVAKVLTEEWICRYGAPRSIHTDQGRNFESHLFSELCRLLNMHKSRTSPYRPQSDGLIERFNRTL 181          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000053716.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001785.1:10187:12838:-1 gene:ENSAMXG00000030794.1 transcript:ENSAMXT00000053716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 1.683e-10
Identity = 29/91 (31.87%), Postives = 51/91 (56.04%), Query Frame = 3
Query:  780 KQNILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            ++N+L I D FS++     V+     T A+VL EK    +   + +HSD+G+ FE ++L  L   + ++K  ++ YH + NG  +R  RT+
Sbjct:    2 EENVLVITDVFSKFTQAYPVSDQKASTVARVLTEKWFYVYGVPQRIHSDQGRNFEGELLRRLCELYGIEKSRTTPYHPEGNGQCERFNRTL 92          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000036301.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:28817284:28820114:1 gene:ENSAMXG00000037673.1 transcript:ENSAMXT00000036301.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 1.960e-10
Identity = 33/108 (30.56%), Postives = 59/108 (54.63%), Query Frame = 3
Query:  729 KKIFIDFCRPFNQTIHDKQNILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            +++ +D   PF  T    + +L  +D F+++    AV   +  TTA  L E     F   + +HSD+G+ FESQ++ E+     V+K  ++  H +++GLV+R  RT+
Sbjct:  469 ERVAVDVLGPFPVTEDGNRYVLVAMDFFTKWPEAYAVPDQSAATTATRLVEDFFCRFGIPEELHSDQGRNFESQVMAEVCKRLGVRKTRTTPLHPQSDGLVERFNRTL 576          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000054209.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001944.1:84644:88116:-1 gene:ENSAMXG00000038678.1 transcript:ENSAMXT00000054209.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 3.285e-10
Identity = 33/109 (30.28%), Postives = 58/109 (53.21%), Query Frame = 3
Query:  726 YKKIFIDFCRPFNQTIHDKQNILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            +++I +D   P   T    + IL I D FS++    A+ +    T A+ + +  LL +   + +H+D+G+ FES +  EL     + K  +S Y  +++GLV+R  RTI
Sbjct:   19 FQRIALDIVGPLPVTATGNKYILVIADYFSKWAESYAIPNQEATTVARAVVD-FLLRWGMPQVIHTDQGRTFESSLFKELCRLLEIDKTRTSPYSPQSDGLVERLNRTI 126          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045127.1 (pep primary_assembly:ASM223467v1:10:587855:593081:1 gene:ENSORLG00000029202.1 transcript:ENSORLT00000045127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.8626 bits (172), Expect = 4.328e-13
Identity = 34/109 (31.19%), Postives = 65/109 (59.63%), Query Frame = 3
Query:  726 YKKIFIDFCRPFNQTIHDKQNILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            ++++ ++   P  +T +  + IL I D FS++     + +   ++ AKVL E+ +  F A +++HSD+G+ FES +  EL +   + K  +S YH +++GLV+R  RT+
Sbjct:   38 FERVALEILGPLPETPNKNKYILVISDYFSKWTEAFPLPNQEAQSIAKVLTEEWVCRFGAPRSIHSDQGRNFESTLFKELCSLLSIHKSRTSPYHPQSDGLVERFNRTL 146          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000036827.1 (pep primary_assembly:ASM223467v1:16:28613823:28617539:1 gene:ENSORLG00000023550.1 transcript:ENSORLT00000036827.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 7.693e-10
Identity = 30/108 (27.78%), Postives = 57/108 (52.78%), Query Frame = 3
Query:  729 KKIFIDFCRPFNQTIHDKQNILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            +++ +D   PF +T    + +L  +D F+++    A+      T A  L E     F AA+ +HSD+G+ FES +   +     ++K  ++  H +++GLV+R  RT+
Sbjct:  882 ERVAVDIMGPFPRTNRGNRFVLVAMDYFTKWPEAYAIPDQEAVTVADALVEGMFSRFGAAEVIHSDQGRNFESAVFSAMCERLGMRKTRTTPLHPQSDGLVERFNRTL 989          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000037924.1 (pep primary_assembly:ASM223467v1:1:16750442:16752019:-1 gene:ENSORLG00000026907.1 transcript:ENSORLT00000037924.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 3.775e-9
Identity = 27/88 (30.68%), Postives = 55/88 (62.50%), Query Frame = 3
Query:  789 ILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            +L + D F+++++L A+ +   +T A+ L E  +L     + +HSD+G+ FE++++  L      KK  +++YH K++G+V+R  RT+
Sbjct:  191 VLVVEDYFTKFVNLYALPNQTAQTVARCLFEDYVLVHGIPEVLHSDQGRQFEAEVIKFLCQWMGTKKTRTTAYHPKSDGMVERHKRTV 278          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000032171.1 (pep primary_assembly:ASM223467v1:18:2114932:2117958:1 gene:ENSORLG00000025397.1 transcript:ENSORLT00000032171.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 1.275e-8
Identity = 29/90 (32.22%), Postives = 48/90 (53.33%), Query Frame = 3
Query:  783 QNILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            +N+L + D FS+Y            T AKVL  +   +F     +HSD+G+ FESQ++ +L   + ++K  ++ YH   NG  +R  RT+
Sbjct:  863 ENVLVLTDVFSKYTVAIPTRDQRAATVAKVLVAEWFSKFGVPARLHSDQGRSFESQLIQQLCGLYGIEKSRTTPYHPAGNGQCERFNRTL 952          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000029819.1 (pep primary_assembly:ASM223467v1:24:6358775:6362914:-1 gene:ENSORLG00000022361.1 transcript:ENSORLT00000029819.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 1.531e-8
Identity = 30/90 (33.33%), Postives = 50/90 (55.56%), Query Frame = 3
Query:  783 QNILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            +N+L I D FS+Y    A       T A+VL  +   +F     +HSD+G+ FES ++ +L + + V+K  ++ YH + NG  +R  RT+
Sbjct:  987 ENVLVITDIFSKYTMAVATRDQRAATVAQVLVTEWFSKFGVPARIHSDQGRSFESALIQQLCDLYAVEKSRTTPYHPEGNGQCERFNRTL 1076          
BLAST of Integrase catalytic domain-containing protein vs. Planmine SMEST
Match: SMESG000029259.1 (SMESG000029259.1)

HSP 1 Score: 103.219 bits (256), Expect = 6.561e-23
Identity = 49/112 (43.75%), Postives = 75/112 (66.96%), Query Frame = 3
Query:  720 EVYKKIFIDFCRPFNQTIHDKQNILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTIR 1055
            E ++KI++D C P  +T + K+ I  IID +S+YISL A+   +E+T ++ L  K +L+F A K +H D GK FE++ + EL  +  ++   SS YHH TNG+++RQFRTIR
Sbjct: 3291 EPFEKIYMDICGPLKETFNKKKYICGIIDHYSKYISLTAINKQDERTISETLLNKWILKFGAPKELHVDCGKNFEARSIKELAKTAGIELIFSSPYHHNTNGIIERQFRTIR 3402          
BLAST of Integrase catalytic domain-containing protein vs. Planmine SMEST
Match: SMESG000060899.1 (SMESG000060899.1)

HSP 1 Score: 89.7373 bits (221), Expect = 6.501e-19
Identity = 44/66 (66.67%), Postives = 52/66 (78.79%), Query Frame = 3
Query:  855 KTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            KTT  VL+EK L +F   KTVHS+ GK FESQ+L ELLNSHH+K  +SS YHH TNGLV+RQ+RTI
Sbjct:    2 KTTVNVLREKWLSKFGIIKTVHSENGKTFESQLLLELLNSHHIKVINSSPYHHNTNGLVERQYRTI 67          
BLAST of Integrase catalytic domain-containing protein vs. Planmine SMEST
Match: SMESG000060899.1 (SMESG000060899.1)

HSP 1 Score: 90.1225 bits (222), Expect = 7.222e-19
Identity = 44/66 (66.67%), Postives = 52/66 (78.79%), Query Frame = 3
Query:  855 KTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            KTT  VL+EK L +F   KTVHS+ GK FESQ+L ELLNSHH+K  +SS YHH TNGLV+RQ+RTI
Sbjct:    2 KTTVNVLREKWLSKFGIIKTVHSENGKTFESQLLLELLNSHHIKVINSSPYHHNTNGLVERQYRTI 67          
BLAST of Integrase catalytic domain-containing protein vs. Planmine SMEST
Match: SMESG000060882.1 (SMESG000060882.1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.500e-18
Identity = 42/66 (63.64%), Postives = 52/66 (78.79%), Query Frame = 3
Query:  855 KTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTI 1052
            KTT  VL+EK L +F   KTVHS+ GK FESQ+L +LLNSHH+K  +SS YHH TNGL++RQ+RTI
Sbjct:    2 KTTVNVLREKWLSKFGVIKTVHSENGKTFESQLLLKLLNSHHIKLINSSPYHHNTNGLIERQYRTI 67          
BLAST of Integrase catalytic domain-containing protein vs. Planmine SMEST
Match: SMESG000074789.1 (SMESG000074789.1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.278e-17
Identity = 43/112 (38.39%), Postives = 67/112 (59.82%), Query Frame = 3
Query:  720 EVYKKIFIDFCRPFNQTIHDKQNILAIIDQFSRYISLAAVAHLNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRHSSSYHHKTNGLVKRQFRTIR 1055
            E+++ IF+D C    +T   K+ IL +IDQ+S+Y  L  +   +E+T  + + EK +L F   K +  D GK +ES ++ E      +K   SS YHH+TNG ++R+FRTIR
Sbjct:  676 EMFEIIFVDDCGLPQETKRRKKYILGMIDQYSKYQILTTIIRQDEETIKRTIYEKSILRFGCPKEIKVDCGKAYESTMMREFTEKLDIKLYFSSPYHHQTNGQIERKFRTIR 787          
The following BLAST results are available for this feature:
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CABZ01030006.17.289e-824.76pep scaffold:GRCz11:KN150258.1:33006:36502:-1 gene... [more]
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSXETT00000023941.19.402e-831.48pep primary_assembly:Xenopus_tropicalis_v9.1:KV463... [more]
ENSXETT00000025355.13.694e-731.46pep primary_assembly:Xenopus_tropicalis_v9.1:1:227... [more]
ENSXETT00000006041.15.013e-731.46pep primary_assembly:Xenopus_tropicalis_v9.1:6:373... [more]
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|P10394|POL4_DROME1.850e-724.37Retrovirus-related Pol polyprotein from transposon... [more]
back to top
BLAST of Integrase catalytic domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5S6QWV28.456e-1432.37Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A5S6PYL25.420e-1233.94Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A0V0SWC25.870e-1231.48Retrovirus-related Pol polyprotein from transposon... [more]
A0A085N1U66.214e-1233.03Integrase catalytic domain-containing protein OS=T... [more]
A0A085LTK08.327e-1233.03Uncharacterized protein OS=Trichuris suis OX=68888... [more]
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000031920.19.289e-1429.66pep primary_assembly:Astyanax_mexicanus-2.0:12:110... [more]
ENSAMXT00000058127.11.181e-1330.97pep primary_assembly:Astyanax_mexicanus-2.0:16:354... [more]
ENSAMXT00000053716.11.683e-1031.87pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000036301.11.960e-1030.56pep primary_assembly:Astyanax_mexicanus-2.0:15:288... [more]
ENSAMXT00000054209.13.285e-1030.28pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000045127.14.328e-1331.19pep primary_assembly:ASM223467v1:10:587855:593081:... [more]
ENSORLT00000036827.17.693e-1027.78pep primary_assembly:ASM223467v1:16:28613823:28617... [more]
ENSORLT00000037924.13.775e-930.68pep primary_assembly:ASM223467v1:1:16750442:167520... [more]
ENSORLT00000032171.11.275e-832.22pep primary_assembly:ASM223467v1:18:2114932:211795... [more]
ENSORLT00000029819.11.531e-833.33pep primary_assembly:ASM223467v1:24:6358775:636291... [more]
back to top
BLAST of Integrase catalytic domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029259.16.561e-2343.75SMESG000029259.1[more]
SMESG000060899.16.501e-1966.67SMESG000060899.1[more]
SMESG000060899.17.222e-1966.67SMESG000060899.1[more]
SMESG000060882.13.500e-1863.64SMESG000060882.1[more]
SMESG000074789.14.278e-1738.39SMESG000074789.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034469 ID=SMED30034469|Name=Integrase catalytic domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1410bp
TGTTCGAAACCCCATTACAAGTATAAAAACAATAAATATTTTTGTTTTTA
TTTACTTATCCAATGAACTCAAGTGAAGCATTACGGACAATTCTTATGGA
GTTCAAAAGGATAAAGTTGATATACTGGTTGATGACAATAGTTCAGAATT
CAGTTTCGGTATACAATGACTCTGATAACGATATTGACTCCAAATATCCC
CTGACTCTCCGATCATGAACAAACATGATATTGGATATTGAATTACCAGA
AAAGAATTGCTGGCAATTTATCACTTGACTCAAATTTACCATAAAGCTAT
AACATTAATTCCCAACTCCAGACATGGATAAATTCTTTGATTGGATACAA
AGCTGGAATACTGAAAAGGAGTTACATGCAAATGTGGATGCTTTATCGAG
AAATATTTGTACCACATGTAATCAGTGTCAGCCGATTCACAAACACCCAA
AATAAAAAAGAATAAAACGAAGATGTTAGCAATCAAAGAGTCTAAGGAAT
ATGAAGGAAAATACTAAGTAAAAGTAAAGAAGTGTTAATCAATGATGTGC
ATCGAGATTTGTGTCACGCAGGTATCAGAAAAACACATGCAAAACAAAAT
TTAAAATTAAATATTAATGAAAACGAGGTCAATAATGTAATAGAAAATAG
TGTAGGATGCCAAAAACGGAAGACGTGGACAGGAGAACCAATTAAATGAT
TATAAGGCAAAGCACCGATGAAGTTTATAAAAAAATATTCATTGATTTTT
GTAGGCCATTTAATCAAACAATACACGACAAACAAAATATTTTGGCAATC
ATTGATCAATTTAGCAGATATATTTCACTGGCAGCAGTGGCACATCTAAA
TGAAAAGACTACTGCTAAAGTTTTAAAAGAAAAACGGTTATTGGAATTTG
TAGCTGCTAAAACAGTTCACTCAGATAAAGGTAAACTATTTGAATCTCAG
ATACTGTTTGAATTATTGAACTCACATCATGTTAAAAAAAGGCACTCAAG
CTCTTATCATCATAAAACAAATGGGCTAGTAAAGAGACAATTTAGAACCA
TAAGAGTCAGAAATATTATATTATGAACATGTAAAAAAACGAGCAAGTCT
TGAATTCTGTAAATTACTAACTGTTGATCTTTTGTCACCCAAAACATCCT
AAGTTGTTCAAAATATAAAAAGTTTTAAAAGAAAACACTCGAGAATCGTG
ACAAATTTTCTACCGATCTGAACGTTACAAAATCTTGTCAAAGTTCTAAA
ACCTTCGGAAGATGGCATGTAGCGACTATAAACTTGTGAAATTGTTTTAT
TATTTAGATCAGGGGTGGGCAAACTGTAAATCGCGGGCATTTTAAATAAT
TTACTAGGTTAAATTAAAACTTTAAAATGTGTACTTAAAATTTAGCAGAC
GATGAAACAT
back to top

protein sequence of SMED30034469-orf-1

>SMED30034469-orf-1 ID=SMED30034469-orf-1|Name=SMED30034469-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=127bp
MIIRQSTDEVYKKIFIDFCRPFNQTIHDKQNILAIIDQFSRYISLAAVAH
LNEKTTAKVLKEKRLLEFVAAKTVHSDKGKLFESQILFELLNSHHVKKRH
SSSYHHKTNGLVKRQFRTIRVRNIIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_sf
IPR001584Integrase_cat-core
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration