Protein tyrosine phosphatase type IVA

Overview
NameProtein tyrosine phosphatase type IVA
Smed IDSMED30034467
Length (bp)1525
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein tyrosine phosphatase type IVA (SMED30034467) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein tyrosine phosphatase type IVA (SMED30034467) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein tyrosine phosphatase type IVA (SMED30034467) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein tyrosine phosphatase type IVA (SMED30034467) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034467

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30034467SMESG000015894.1 SMESG000000559.1 Contig1506GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30034467SMESG000015894.1 SMESG000000559.1 Contig1506GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30034467SMESG000015894.1 SMESG000000559.1 Contig1506GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30034467SMESG000078978.1 Contig1506GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30034467SMESG000078978.1 Contig1506GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30034467SMESG000078978.1 Contig1506GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30034467SMESG000078867.1 SMESG000010171.1 SmedASXL_011938SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30034467SMESG000078978.1 SMESG000078867.1 SMESG000010171.1 dd_Smed_v4_2239_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30034467SMESG000078978.1 SMESG000078867.1 SMESG000010171.1 dd_Smed_v4_2239_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30034467SMESG000078978.1 SMESG000078867.1 SMESG000010171.1 dd_Smed_v4_2239_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30034467SMESG000078978.1 SMESG000078867.1 SMESG000010171.1 dd_Smed_v4_2239_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Human
Match: PTP4A3 (protein tyrosine phosphatase 4A3 [Source:HGNC Symbol;Acc:HGNC:9636])

HSP 1 Score: 159.073 bits (401), Expect = 1.184e-45
Identity = 72/158 (45.57%), Postives = 98/158 (62.03%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
               +P    ++YKHM FLI  +P+   +  F E+ K+   T VVRVCE  Y +   +  GI +  W F DG+PPP  ++E W  L+K +F     S   +AVHC+AG GRAPVLVA+AL+E GM  EDAI+ IR KR+G+ N +Q++YL  YR K RL
Sbjct:    3 RMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGS--CVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Human
Match: PTP4A3 (protein tyrosine phosphatase 4A3 [Source:HGNC Symbol;Acc:HGNC:9636])

HSP 1 Score: 159.073 bits (401), Expect = 1.184e-45
Identity = 72/158 (45.57%), Postives = 98/158 (62.03%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
               +P    ++YKHM FLI  +P+   +  F E+ K+   T VVRVCE  Y +   +  GI +  W F DG+PPP  ++E W  L+K +F     S   +AVHC+AG GRAPVLVA+AL+E GM  EDAI+ IR KR+G+ N +Q++YL  YR K RL
Sbjct:    3 RMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGS--CVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Human
Match: PTP4A3 (protein tyrosine phosphatase 4A3 [Source:HGNC Symbol;Acc:HGNC:9636])

HSP 1 Score: 159.073 bits (401), Expect = 1.184e-45
Identity = 72/158 (45.57%), Postives = 98/158 (62.03%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
               +P    ++YKHM FLI  +P+   +  F E+ K+   T VVRVCE  Y +   +  GI +  W F DG+PPP  ++E W  L+K +F     S   +AVHC+AG GRAPVLVA+AL+E GM  EDAI+ IR KR+G+ N +Q++YL  YR K RL
Sbjct:    3 RMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGS--CVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Human
Match: PTP4A3 (protein tyrosine phosphatase 4A3 [Source:HGNC Symbol;Acc:HGNC:9636])

HSP 1 Score: 159.073 bits (401), Expect = 1.184e-45
Identity = 72/158 (45.57%), Postives = 98/158 (62.03%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
               +P    ++YKHM FLI  +P+   +  F E+ K+   T VVRVCE  Y +   +  GI +  W F DG+PPP  ++E W  L+K +F     S   +AVHC+AG GRAPVLVA+AL+E GM  EDAI+ IR KR+G+ N +Q++YL  YR K RL
Sbjct:    3 RMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGS--CVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Human
Match: PTP4A2 (protein tyrosine phosphatase 4A2 [Source:HGNC Symbol;Acc:HGNC:9635])

HSP 1 Score: 157.918 bits (398), Expect = 2.800e-45
Identity = 71/157 (45.22%), Postives = 103/157 (65.61%), Query Frame = 1
Query:  235 FQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
              +P    I+Y++M FLI  +P+   ++ F EE K+  VT +VRVC++ Y +   +  GI++  W F DG+PPP+ I++ W  LLK +F  +      +AVHC+AG GRAPVLVA+AL+E GM  EDA++ IR KR+G+FN +Q+ YL  YR K RL
Sbjct:    1 MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKF--REEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRL 155          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Celegans
Match: T19D2.2 (Putative prenylated protein tyrosine phosphatase [Source:UniProtKB/TrEMBL;Acc:G5EG43])

HSP 1 Score: 166.392 bits (420), Expect = 1.118e-48
Identity = 74/161 (45.96%), Postives = 107/161 (66.46%), Query Frame = 1
Query:  223 SARHFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
            +A  + KP  + I +  M FLI D P+  ++  + EE ++     VVRVCE  Y   A K+ GI++  W+FSDGSPPP ++++ WFQL    F  + H + SIAVHC+AG GRAPVLVA+AL+E GM  EDA+EMIR++R+G+ N++Q+ +L  Y+A   L
Sbjct:   15 AATTYFKPAPSEIAWGKMRFLITDRPNNSSIQSYIEELEKHGARAVVRVCEPTYDTLALKEAGIDVLDWQFSDGSPPPPEVIKSWFQLCMTSF--KEHPDKSIAVHCVAGLGRAPVLVAIALIEAGMKYEDAVEMIRTQRRGALNQKQLKFLETYKANGEL 173          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Celegans
Match: frg-1 (pep chromosome:WBcel235:III:12979162:12980163:1 gene:WBGene00014177.1 transcript:ZK1010.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:frg-1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.267e-19
Identity = 64/184 (34.78%), Postives = 100/184 (54.35%), Query Frame = -2
Query:  988 HKSGEPPSEDEILSCM-VLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVNKINGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQ----SFQGGXXXXXXXXXXXXXXXXKVGGLHETLLDRREKMKADRYC 1524
            H  GE P+ +EI + +    D+KISLKTG+ +YVG++ +     + A+ +A+G  EQ+  +F+EGK A    +S        N +  +   S     +E + IR +  + E P++   VE+R  A + E  YVK +Q      +   + +  +DK  +KKA+  G  HE LLDRR KMK+DRYC
Sbjct:   95 HPEGEGPNPEEIFALVKTPDDSKISLKTGFGRYVGVDSE---YQLVAMAEAIGSREQFVLVFQEGKTAFQAVSSPLFLSTVPNKEGHIYVASRTATENEMVNIRTD-AIQEGPVDWRSVEDRKNARECETAYVKMYQHSKVDLKNRHIAIDVKDKKGVKKAQADGSAHELLLDRRMKMKSDRYC 274          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Celegans
Match: cdc-14 (Tyrosine-protein phosphatase cdc-14 [Source:UniProtKB/Swiss-Prot;Acc:P81299])

HSP 1 Score: 54.299 bits (129), Expect = 1.622e-7
Identity = 34/111 (30.63%), Postives = 54/111 (48.65%), Query Frame = 1
Query:  349 VTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALM-ELGMHCEDAIEMIRSKRKGSFNERQISYL 678
            V+ +VR+   +Y    F   G +     F DGS P  +I+ K+ +++ +       + G +AVHC AG GR   L+A  +M E G+   + +  +R  R GS    Q  YL
Sbjct:  238 VSTIVRLNAKNYDASKFTKAGFDHVDLFFIDGSTPSDEIMLKFIKVVDN-------TKGGVAVHCKAGLGRTGTLIACWMMKEYGLTAGECMGWLRVCRPGSVIGPQQPYL 341          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Celegans
Match: cdc-14 (Tyrosine-protein phosphatase cdc-14 [Source:UniProtKB/Swiss-Prot;Acc:P81299])

HSP 1 Score: 54.299 bits (129), Expect = 1.637e-7
Identity = 34/111 (30.63%), Postives = 54/111 (48.65%), Query Frame = 1
Query:  349 VTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALM-ELGMHCEDAIEMIRSKRKGSFNERQISYL 678
            V+ +VR+   +Y    F   G +     F DGS P  +I+ K+ +++ +       + G +AVHC AG GR   L+A  +M E G+   + +  +R  R GS    Q  YL
Sbjct:  238 VSTIVRLNAKNYDASKFTKAGFDHVDLFFIDGSTPSDEIMLKFIKVVDN-------TKGGVAVHCKAGLGRTGTLIACWMMKEYGLTAGECMGWLRVCRPGSVIGPQQPYL 341          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Celegans
Match: cdc-14 (Tyrosine-protein phosphatase cdc-14 [Source:UniProtKB/Swiss-Prot;Acc:P81299])

HSP 1 Score: 54.299 bits (129), Expect = 1.769e-7
Identity = 34/111 (30.63%), Postives = 54/111 (48.65%), Query Frame = 1
Query:  349 VTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALM-ELGMHCEDAIEMIRSKRKGSFNERQISYL 678
            V+ +VR+   +Y    F   G +     F DGS P  +I+ K+ +++ +       + G +AVHC AG GR   L+A  +M E G+   + +  +R  R GS    Q  YL
Sbjct:  238 VSTIVRLNAKNYDASKFTKAGFDHVDLFFIDGSTPSDEIMLKFIKVVDN-------TKGGVAVHCKAGLGRTGTLIACWMMKEYGLTAGECMGWLRVCRPGSVIGPQQPYL 341          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Fly
Match: PRL-1 (gene:FBgn0024734 transcript:FBtr0080857)

HSP 1 Score: 155.992 bits (393), Expect = 9.102e-45
Identity = 71/155 (45.81%), Postives = 103/155 (66.45%), Query Frame = 1
Query:  241 KPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
            +P    I YK M FLI D PS   ++ +  E K+ NV  VVRVCE  Y+ +  +  GI +    F DG+ PP  ++++WF++LKD++  Q +    +AVHC+AG GRAPVLVA+AL+ELG+  E A+EMIR KR+G+ N +Q+S+L  Y+ K+RL
Sbjct:   11 RPAPALIEYKGMKFLITDRPSDITINHYIMELKKNNVNTVVRVCEPSYNTDELETQGITVKDLAFEDGTFPPQQVVDEWFEVLKDKY--QQNPEACVAVHCVAGLGRAPVLVALALIELGLKYEAAVEMIRDKRRGAINAKQLSFLEKYKPKARL 163          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Fly
Match: PRL-1 (gene:FBgn0024734 transcript:FBtr0332358)

HSP 1 Score: 155.992 bits (393), Expect = 9.102e-45
Identity = 71/155 (45.81%), Postives = 103/155 (66.45%), Query Frame = 1
Query:  241 KPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
            +P    I YK M FLI D PS   ++ +  E K+ NV  VVRVCE  Y+ +  +  GI +    F DG+ PP  ++++WF++LKD++  Q +    +AVHC+AG GRAPVLVA+AL+ELG+  E A+EMIR KR+G+ N +Q+S+L  Y+ K+RL
Sbjct:   11 RPAPALIEYKGMKFLITDRPSDITINHYIMELKKNNVNTVVRVCEPSYNTDELETQGITVKDLAFEDGTFPPQQVVDEWFEVLKDKY--QQNPEACVAVHCVAGLGRAPVLVALALIELGLKYEAAVEMIRDKRRGAINAKQLSFLEKYKPKARL 163          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Fly
Match: PRL-1 (gene:FBgn0024734 transcript:FBtr0080856)

HSP 1 Score: 155.992 bits (393), Expect = 9.102e-45
Identity = 71/155 (45.81%), Postives = 103/155 (66.45%), Query Frame = 1
Query:  241 KPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
            +P    I YK M FLI D PS   ++ +  E K+ NV  VVRVCE  Y+ +  +  GI +    F DG+ PP  ++++WF++LKD++  Q +    +AVHC+AG GRAPVLVA+AL+ELG+  E A+EMIR KR+G+ N +Q+S+L  Y+ K+RL
Sbjct:   11 RPAPALIEYKGMKFLITDRPSDITINHYIMELKKNNVNTVVRVCEPSYNTDELETQGITVKDLAFEDGTFPPQQVVDEWFEVLKDKY--QQNPEACVAVHCVAGLGRAPVLVALALIELGLKYEAAVEMIRDKRRGAINAKQLSFLEKYKPKARL 163          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Fly
Match: PRL-1 (gene:FBgn0024734 transcript:FBtr0332357)

HSP 1 Score: 155.992 bits (393), Expect = 9.102e-45
Identity = 71/155 (45.81%), Postives = 103/155 (66.45%), Query Frame = 1
Query:  241 KPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
            +P    I YK M FLI D PS   ++ +  E K+ NV  VVRVCE  Y+ +  +  GI +    F DG+ PP  ++++WF++LKD++  Q +    +AVHC+AG GRAPVLVA+AL+ELG+  E A+EMIR KR+G+ N +Q+S+L  Y+ K+RL
Sbjct:   11 RPAPALIEYKGMKFLITDRPSDITINHYIMELKKNNVNTVVRVCEPSYNTDELETQGITVKDLAFEDGTFPPQQVVDEWFEVLKDKY--QQNPEACVAVHCVAGLGRAPVLVALALIELGLKYEAAVEMIRDKRRGAINAKQLSFLEKYKPKARL 163          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Fly
Match: FRG1 (gene:FBgn0036964 transcript:FBtr0074847)

HSP 1 Score: 102.064 bits (253), Expect = 4.913e-24
Identity = 75/180 (41.67%), Postives = 107/180 (59.44%), Query Frame = -2
Query:  985 HKSGEPPSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVNKINGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGXXXXXXXXXXXXXXXXKVGGLHETLLDRREKMKADRYCK 1524
            H +G+ P  +EI +   ++D K++ K+GY KY+ IE  G+   V    +A+G  EQW P+FEE ++ALL     F+S++  +          KV   E  ++R N    +  I+  P EE+    + E NYVKKFQ FQ  KM++++ D  EL++AK  G LHETLLDRR KMKADRYCK
Sbjct:   89 HNAGDGPDPEEIFTAFPINDRKVAFKSGYGKYLKIEKDGM---VTGRSEAVGGMEQWEPVFEEQRMALLSETGHFMSIDPQDDA--CVALRKKVGQHEICKVRSNASR-DVVIDTEPKEEKGDLGEVEKNYVKKFQKFQDKKMRINQNDVKELEQAKAQGSLHETLLDRRSKMKADRYCK 262          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Zebrafish
Match: ptp4a3a (protein tyrosine phosphatase 4A3a [Source:ZFIN;Acc:ZDB-GENE-040426-2220])

HSP 1 Score: 160.229 bits (404), Expect = 2.593e-46
Identity = 75/158 (47.47%), Postives = 99/158 (62.66%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
               +P    + YK+M FLI  +P+   +  F E+ K+  VT VVRVCE  Y +   +  GI +  W F DG+PPPS ++E W  LLK RF  +      +AVHC+AG GRAPVLVAVAL+E GM  EDAI+ IR KR+G+ N +Q++YL  YR K RL
Sbjct:    3 RMNRPAPVEVCYKNMRFLITHNPTNSTLSSFIEDLKKYGVTTVVRVCEITYDKTPLEKNGITVVDWPFDDGAPPPSKVVEDWLSLLKRRFIEEP--GCCVAVHCVAGLGRAPVLVAVALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Zebrafish
Match: ptp4a3a (protein tyrosine phosphatase 4A3a [Source:ZFIN;Acc:ZDB-GENE-040426-2220])

HSP 1 Score: 160.229 bits (404), Expect = 2.593e-46
Identity = 75/158 (47.47%), Postives = 99/158 (62.66%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
               +P    + YK+M FLI  +P+   +  F E+ K+  VT VVRVCE  Y +   +  GI +  W F DG+PPPS ++E W  LLK RF  +      +AVHC+AG GRAPVLVAVAL+E GM  EDAI+ IR KR+G+ N +Q++YL  YR K RL
Sbjct:    3 RMNRPAPVEVCYKNMRFLITHNPTNSTLSSFIEDLKKYGVTTVVRVCEITYDKTPLEKNGITVVDWPFDDGAPPPSKVVEDWLSLLKRRFIEEP--GCCVAVHCVAGLGRAPVLVAVALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Zebrafish
Match: ptp4a3a (protein tyrosine phosphatase 4A3a [Source:ZFIN;Acc:ZDB-GENE-040426-2220])

HSP 1 Score: 160.229 bits (404), Expect = 2.593e-46
Identity = 75/158 (47.47%), Postives = 99/158 (62.66%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
               +P    + YK+M FLI  +P+   +  F E+ K+  VT VVRVCE  Y +   +  GI +  W F DG+PPPS ++E W  LLK RF  +      +AVHC+AG GRAPVLVAVAL+E GM  EDAI+ IR KR+G+ N +Q++YL  YR K RL
Sbjct:    3 RMNRPAPVEVCYKNMRFLITHNPTNSTLSSFIEDLKKYGVTTVVRVCEITYDKTPLEKNGITVVDWPFDDGAPPPSKVVEDWLSLLKRRFIEEP--GCCVAVHCVAGLGRAPVLVAVALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Zebrafish
Match: ptp4a1 (protein tyrosine phosphatase 4A1 [Source:ZFIN;Acc:ZDB-GENE-041121-11])

HSP 1 Score: 158.303 bits (399), Expect = 2.190e-45
Identity = 77/162 (47.53%), Postives = 101/162 (62.35%), Query Frame = 1
Query:  220 KSARHFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
            K AR   +P    I YK+M FLI  +P+   +H F EE K+  VT VVRVCE+ Y        GI +  W F DG+PP + I++ W  LL+ +F  +      IAVHC+AG GRAPVLVA+AL+E GM  EDA++ IR KR+G+FN +Q+ YL  YR K RL
Sbjct:   11 KMAR-MNRPAPVEITYKNMRFLITHNPTNATLHKFIEELKKYGVTTVVRVCEATYDANLVVKEGIQVLDWPFDDGAPPSNQIVDDWLNLLRVKF--REEPGCCIAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLFYLEKYRPKMRL 169          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Zebrafish
Match: ptp4a1 (protein tyrosine phosphatase 4A1 [Source:ZFIN;Acc:ZDB-GENE-041121-11])

HSP 1 Score: 157.147 bits (396), Expect = 3.687e-45
Identity = 74/158 (46.84%), Postives = 98/158 (62.03%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
               +P    I YK+M FLI  +P+   +H F EE K+  VT VVRVCE+ Y        GI +  W F DG+PP + I++ W  LL+ +F  +      IAVHC+AG GRAPVLVA+AL+E GM  EDA++ IR KR+G+FN +Q+ YL  YR K RL
Sbjct:    3 RMNRPAPVEITYKNMRFLITHNPTNATLHKFIEELKKYGVTTVVRVCEATYDANLVVKEGIQVLDWPFDDGAPPSNQIVDDWLNLLRVKF--REEPGCCIAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLFYLEKYRPKMRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Xenopus
Match: ptp4a2 (protein tyrosine phosphatase type IVA, member 2 [Source:NCBI gene;Acc:549961])

HSP 1 Score: 156.377 bits (394), Expect = 8.509e-45
Identity = 71/157 (45.22%), Postives = 102/157 (64.97%), Query Frame = 1
Query:  235 FQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
              +P    I+++ M FLI  +P+   ++ F EE K+  VT +VRVC++ Y +   +  GI +  W F DG+PPP+ I++ W  LLK +F  +  +   IAVHC+AG GRAPVLVA+AL+E GM  EDA++ IR KR+G+FN +Q+ YL  YR K RL
Sbjct:    4 MNRPAPVEISHECMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIQVLDWPFDDGAPPPTQIVDDWLNLLKTKF--REEAGCCIAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Xenopus
Match: tcta (T cell leukemia translocation altered [Source:Xenbase;Acc:XB-GENE-954032])

HSP 1 Score: 155.606 bits (392), Expect = 2.288e-44
Identity = 73/158 (46.20%), Postives = 99/158 (62.66%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
               +P    I YK+M FLI  +P+   ++ F EE K+  VT +VRVCE+ Y     +  GI +  W F DG+PP + I++ W  LLK +F  +      IAVHC+AG GRAPVLVA+AL+E GM  EDA++ IR KR+G+FN +Q+ YL  YR K RL
Sbjct:    3 RMNRPAPVEITYKNMRFLITHNPTNATLNKFIEELKKYGVTTLVRVCEATYDTALVEKEGIQVLDWPFDDGAPPSNQIVDDWLNLLKMKF--REEPGCCIAVHCVAGLGRAPVLVALALIESGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Xenopus
Match: pfdn4 (prefoldin subunit 4 [Source:Xenbase;Acc:XB-GENE-856231])

HSP 1 Score: 155.221 bits (391), Expect = 3.330e-44
Identity = 71/158 (44.94%), Postives = 98/158 (62.03%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
               +P    + YK+M FLI  +P+   ++ F E+ K+   T VVRVCE  Y +   +  GI +  W F DG+PPP+ I++ W  LLK +F         +AVHC+AG GRAPVLVA+AL+E GM  EDAI+ IR KR+G+ N +Q++YL  YR K RL
Sbjct:    3 RINRPAPVEVCYKNMRFLITHNPTNATMNTFIEDLKKYGATTVVRVCEITYDKTPLEKDGITVMDWPFDDGAPPPNKIVDDWLNLLKTKFC--EDPGCCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Xenopus
Match: cdh20 (cadherin 20 [Source:Xenbase;Acc:XB-GENE-1011620])

HSP 1 Score: 130.954 bits (328), Expect = 3.634e-34
Identity = 83/180 (46.11%), Postives = 112/180 (62.22%), Query Frame = -2
Query:  985 HKSGEPPSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVNKINGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGXXXXXXXXXXXXXXXXKVGGLHETLLDRREKMKADRYCK 1524
            HK  + PS  E  + + LSD++I+LK+GY KY+GI   GL   V    DA+G  EQW P+FE GK+ALL  NSCF+  N+   + ++   S      E ++IR          + +P E++    + E+NYVKKFQSFQ  K+K+S ED  +LKKA+K G  HETLLDRR K+KADRYCK
Sbjct:   83 HKDDDGPSPPEQFTAIKLSDSRIALKSGYGKYLGINSDGL---VIGRSDAIGAREQWEPVFENGKMALLASNSCFVGCNE---EGDLIAQSKTAGEGEMIKIRSCVERDGKSEDEIPKEDKGNVKQCEINYVKKFQSFQDNKLKVSLEDNKDLKKARKEGNFHETLLDRRSKLKADRYCK 256          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Xenopus
Match: cdh20 (cadherin 20 [Source:Xenbase;Acc:XB-GENE-1011620])

HSP 1 Score: 130.183 bits (326), Expect = 4.259e-34
Identity = 83/180 (46.11%), Postives = 112/180 (62.22%), Query Frame = -2
Query:  985 HKSGEPPSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVNKINGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGXXXXXXXXXXXXXXXXKVGGLHETLLDRREKMKADRYCK 1524
            HK  + PS  E  + + LSD++I+LK+GY KY+GI   GL   V    DA+G  EQW P+FE GK+ALL  NSCF+  N+   + ++   S      E ++IR          + +P E++    + E+NYVKKFQSFQ  K+K+S ED  +LKKA+K G  HETLLDRR K+KADRYCK
Sbjct:   74 HKDDDGPSPPEQFTAIKLSDSRIALKSGYGKYLGINSDGL---VIGRSDAIGAREQWEPVFENGKMALLASNSCFVGCNE---EGDLIAQSKTAGEGEMIKIRSCVERDGKSEDEIPKEDKGNVKQCEINYVKKFQSFQDNKLKVSLEDNKDLKKARKEGNFHETLLDRRSKLKADRYCK 247          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Mouse
Match: Ptp4a3 (protein tyrosine phosphatase 4a3 [Source:MGI Symbol;Acc:MGI:1277098])

HSP 1 Score: 160.229 bits (404), Expect = 2.684e-46
Identity = 73/158 (46.20%), Postives = 98/158 (62.03%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
               +P    ++Y+HM FLI  +PS   +  F E+ K+   T VVRVCE  Y +   +  GI +  W F DG+PPP  ++E W  LLK +F     S   +AVHC+AG GRAPVLVA+AL+E GM  EDAI+ IR KR+G+ N +Q++YL  YR K RL
Sbjct:    3 RMNRPAPVEVSYRHMRFLITHNPSNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLLKAKFYNDPGS--CVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Mouse
Match: Ptp4a3 (protein tyrosine phosphatase 4a3 [Source:MGI Symbol;Acc:MGI:1277098])

HSP 1 Score: 160.229 bits (404), Expect = 2.684e-46
Identity = 73/158 (46.20%), Postives = 98/158 (62.03%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
               +P    ++Y+HM FLI  +PS   +  F E+ K+   T VVRVCE  Y +   +  GI +  W F DG+PPP  ++E W  LLK +F     S   +AVHC+AG GRAPVLVA+AL+E GM  EDAI+ IR KR+G+ N +Q++YL  YR K RL
Sbjct:    3 RMNRPAPVEVSYRHMRFLITHNPSNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLLKAKFYNDPGS--CVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Mouse
Match: Ptp4a3 (protein tyrosine phosphatase 4a3 [Source:MGI Symbol;Acc:MGI:1277098])

HSP 1 Score: 160.229 bits (404), Expect = 2.684e-46
Identity = 73/158 (46.20%), Postives = 98/158 (62.03%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
               +P    ++Y+HM FLI  +PS   +  F E+ K+   T VVRVCE  Y +   +  GI +  W F DG+PPP  ++E W  LLK +F     S   +AVHC+AG GRAPVLVA+AL+E GM  EDAI+ IR KR+G+ N +Q++YL  YR K RL
Sbjct:    3 RMNRPAPVEVSYRHMRFLITHNPSNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLLKAKFYNDPGS--CVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Mouse
Match: Ptp4a3 (protein tyrosine phosphatase 4a3 [Source:MGI Symbol;Acc:MGI:1277098])

HSP 1 Score: 160.229 bits (404), Expect = 2.684e-46
Identity = 73/158 (46.20%), Postives = 98/158 (62.03%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
               +P    ++Y+HM FLI  +PS   +  F E+ K+   T VVRVCE  Y +   +  GI +  W F DG+PPP  ++E W  LLK +F     S   +AVHC+AG GRAPVLVA+AL+E GM  EDAI+ IR KR+G+ N +Q++YL  YR K RL
Sbjct:    3 RMNRPAPVEVSYRHMRFLITHNPSNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLLKAKFYNDPGS--CVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Mouse
Match: Ptp4a2 (protein tyrosine phosphatase 4a2 [Source:MGI Symbol;Acc:MGI:1277117])

HSP 1 Score: 157.918 bits (398), Expect = 1.922e-45
Identity = 71/157 (45.22%), Postives = 103/157 (65.61%), Query Frame = 1
Query:  235 FQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
              +P    I+Y++M FLI  +P+   ++ F EE K+  VT +VRVC++ Y +   +  GI++  W F DG+PPP+ I++ W  LLK +F  +      +AVHC+AG GRAPVLVA+AL+E GM  EDA++ IR KR+G+FN +Q+ YL  YR K RL
Sbjct:    1 MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKF--REEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRL 155          
BLAST of Protein tyrosine phosphatase type IVA vs. UniProt/SwissProt
Match: sp|Q9D658|TP4A3_MOUSE (Protein tyrosine phosphatase type IVA 3 OS=Mus musculus OX=10090 GN=Ptp4a3 PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.877e-45
Identity = 73/158 (46.20%), Postives = 98/158 (62.03%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
               +P    ++Y+HM FLI  +PS   +  F E+ K+   T VVRVCE  Y +   +  GI +  W F DG+PPP  ++E W  LLK +F     S   +AVHC+AG GRAPVLVA+AL+E GM  EDAI+ IR KR+G+ N +Q++YL  YR K RL
Sbjct:    3 RMNRPAPVEVSYRHMRFLITHNPSNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLLKAKFYNDPGS--CVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. UniProt/SwissProt
Match: sp|O75365|TP4A3_HUMAN (Protein tyrosine phosphatase type IVA 3 OS=Homo sapiens OX=9606 GN=PTP4A3 PE=1 SV=2)

HSP 1 Score: 159.073 bits (401), Expect = 5.687e-45
Identity = 72/158 (45.57%), Postives = 98/158 (62.03%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
               +P    ++YKHM FLI  +P+   +  F E+ K+   T VVRVCE  Y +   +  GI +  W F DG+PPP  ++E W  L+K +F     S   +AVHC+AG GRAPVLVA+AL+E GM  EDAI+ IR KR+G+ N +Q++YL  YR K RL
Sbjct:    3 RMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGS--CVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. UniProt/SwissProt
Match: sp|Q6P9X4|TP4A2_RAT (Protein tyrosine phosphatase type IVA 2 OS=Rattus norvegicus OX=10116 GN=Ptp4a2 PE=2 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 1.345e-44
Identity = 71/157 (45.22%), Postives = 103/157 (65.61%), Query Frame = 1
Query:  235 FQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
              +P    I+Y++M FLI  +P+   ++ F EE K+  VT +VRVC++ Y +   +  GI++  W F DG+PPP+ I++ W  LLK +F  +      +AVHC+AG GRAPVLVA+AL+E GM  EDA++ IR KR+G+FN +Q+ YL  YR K RL
Sbjct:    1 MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKF--REEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRL 155          
BLAST of Protein tyrosine phosphatase type IVA vs. UniProt/SwissProt
Match: sp|O70274|TP4A2_MOUSE (Protein tyrosine phosphatase type IVA 2 OS=Mus musculus OX=10090 GN=Ptp4a2 PE=1 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 1.345e-44
Identity = 71/157 (45.22%), Postives = 103/157 (65.61%), Query Frame = 1
Query:  235 FQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
              +P    I+Y++M FLI  +P+   ++ F EE K+  VT +VRVC++ Y +   +  GI++  W F DG+PPP+ I++ W  LLK +F  +      +AVHC+AG GRAPVLVA+AL+E GM  EDA++ IR KR+G+FN +Q+ YL  YR K RL
Sbjct:    1 MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKF--REEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRL 155          
BLAST of Protein tyrosine phosphatase type IVA vs. UniProt/SwissProt
Match: sp|Q12974|TP4A2_HUMAN (Protein tyrosine phosphatase type IVA 2 OS=Homo sapiens OX=9606 GN=PTP4A2 PE=1 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 1.345e-44
Identity = 71/157 (45.22%), Postives = 103/157 (65.61%), Query Frame = 1
Query:  235 FQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
              +P    I+Y++M FLI  +P+   ++ F EE K+  VT +VRVC++ Y +   +  GI++  W F DG+PPP+ I++ W  LLK +F  +      +AVHC+AG GRAPVLVA+AL+E GM  EDA++ IR KR+G+FN +Q+ YL  YR K RL
Sbjct:    1 MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKF--REEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRL 155          
BLAST of Protein tyrosine phosphatase type IVA vs. TrEMBL
Match: A0A430QDS4 (Protein tyrosine phosphatase type IVA OS=Schistosoma bovis OX=6184 GN=DC041_0008269 PE=4 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 1.120e-64
Identity = 109/180 (60.56%), Postives = 133/180 (73.89%), Query Frame = 1
Query:  223 SARHFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRF---NTQSHSN------GSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRLYL-SQKCFIL 732
             AR  + P  T I +K M+F+IMDSPS+ NV  F EEC +LNV+DVVRVCE  Y  E F++ GI + HWEFSDGSPPP +IL +WF LL++RF   N  +H +      G IAVHCIAG+GRAPVLVAVALMELGM  EDAIE+IRSKRKG+FN+RQI YLT+Y A SRL   + +CFI+
Sbjct:    2 GARTLRLPIITDIKHKGMHFIIMDSPSKTNVPYFVEECSKLNVSDVVRVCEDRYPVEPFENAGICVHHWEFSDGSPPPENILTEWFTLLRNRFYGENNSTHDDQNHLVPGPIAVHCIAGYGRAPVLVAVALMELGMSSEDAIELIRSKRKGAFNDRQIHYLTNYHAHSRLRRHNHRCFIV 181          
BLAST of Protein tyrosine phosphatase type IVA vs. TrEMBL
Match: G4VB66 (TYR_PHOSPHATASE_2 domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_040550 PE=4 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 1.611e-64
Identity = 109/180 (60.56%), Postives = 133/180 (73.89%), Query Frame = 1
Query:  223 SARHFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRF---NTQSHSN------GSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRLYL-SQKCFIL 732
             AR  + P  T I +K M+F+IMDSPS+ NV  F EEC +LNV+DVVRVCE  Y  E F++ GI + HWEFSDGSPPP +IL +WF LL++RF   N  +H +      G IAVHCIAG+GRAPVLVAVALMELGM  EDAIE+IRSKRKG+FN+RQI YLT+Y A SRL   + +CFI+
Sbjct:    2 GARTLRLPIITDIKHKGMHFIIMDSPSKTNVPYFVEECSKLNVSDVVRVCEDRYPVEPFENAGICVHHWEFSDGSPPPENILTEWFTLLRNRFYGENNTAHVDQNHLVPGPIAVHCIAGYGRAPVLVAVALMELGMSSEDAIELIRSKRKGAFNDRQIHYLTNYHAHSRLRRHNHRCFIV 181          
BLAST of Protein tyrosine phosphatase type IVA vs. TrEMBL
Match: Q5DB62 (Protein tyrosine phosphatase type IVA 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_006406 PE=2 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 1.127e-63
Identity = 106/179 (59.22%), Postives = 133/179 (74.30%), Query Frame = 1
Query:  223 SARHFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSN--------GSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRLYL-SQKCFIL 732
             AR  + P  T INYK M+F+IMDSPS+ NV  F EEC +L+V+DVVRVCE  Y  E F+  GI + HWEFSDGSPPP +IL +WF LL++RF  ++++         G +AVHCIAG+GRAPVLVAVALMELGM  EDAIE+IRSKRKG+FN+RQI YLT+Y + SRL   + +CFI+
Sbjct:    2 GARTLRLPIITDINYKGMHFIIMDSPSKTNVPYFVEECCKLHVSDVVRVCEDRYPVEPFEKAGICVHHWEFSDGSPPPENILTEWFTLLRNRFYGENNNQDDQSTLIPGPVAVHCIAGYGRAPVLVAVALMELGMSSEDAIELIRSKRKGAFNDRQIHYLTNYHSHSRLRRHNHRCFIV 180          
BLAST of Protein tyrosine phosphatase type IVA vs. TrEMBL
Match: A0A4V3SHA0 (TYR_PHOSPHATASE_2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000379 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 7.082e-63
Identity = 99/179 (55.31%), Postives = 129/179 (72.07%), Query Frame = 1
Query:  223 SARHFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQ--------SHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRLYL-SQKCFIL 732
            ++R  + P  T I YK +N +IMDSP++ +V  F EEC RL+V+D+VRVCE  Y  + F+  GI + HWEFSDGSPPP ++L  WF LL+ RF T+        + + G +AVHCIAG+GRAPVLVAVALMELGM C DAIE+IRSKRKG+FN+RQ++YLT Y  KSRL     +CF++
Sbjct:    2 NSRTLRLPVITTIEYKGINLIIMDSPTKSSVPYFVEECSRLHVSDIVRVCEDRYPTDEFEKSGIRVHHWEFSDGSPPPDNVLSDWFNLLRARFYTEPKTASSNATGAAGPVAVHCIAGYGRAPVLVAVALMELGMPCADAIELIRSKRKGAFNDRQLAYLTAYHPKSRLRRHGNRCFLM 180          
BLAST of Protein tyrosine phosphatase type IVA vs. TrEMBL
Match: A0A564XZ16 (TYR_PHOSPHATASE_2 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS1470 PE=4 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.058e-61
Identity = 100/172 (58.14%), Postives = 126/172 (73.26%), Query Frame = 1
Query:  226 ARHFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRF-----------NTQSHSN-GSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
            +R   KP  T + YK MNF+IMDSP+ D V  FA+EC RL+V+DV+RVCE  Y  E F++VGI + HWEF DGS PP DIL+KWF+LL+ RF           N+  H+  G +AVHC+AG+GRAPVLVAVALMELGM  +DAIE+IRSKRKG+FN+RQ+  L +YR+K RL
Sbjct:    3 SRQLLKPVITDVVYKGMNFIIMDSPAADTVQTFAKECSRLHVSDVIRVCEDKYPVEPFENVGIRVHHWEFEDGSFPPDDILDKWFELLRLRFYGSKKTTSGDGNSSDHATPGPVAVHCLAGYGRAPVLVAVALMELGMPNQDAIELIRSKRKGAFNDRQVESLRNYRSKGRL 174          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Cavefish
Match: ptp4a2b (protein tyrosine phosphatase type IVA 2 [Source:NCBI gene;Acc:103042327])

HSP 1 Score: 159.844 bits (403), Expect = 3.134e-46
Identity = 74/163 (45.40%), Postives = 102/163 (62.58%), Query Frame = 1
Query:  217 MKSARHFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
            M    +  +P A  I Y+ M FLI  +P+   ++ F EE K+  V  +VRVCE+ Y +   +  GI +  W F DG+PPP+ I++ W  LLK +F  +      IAVHC+AG GRAPVLVA+AL+E GM  EDA++ IR KR+G+FN +Q+ YL  YR K RL
Sbjct:    1 MGRLANMNRPAAVEITYECMRFLITHNPTNSTLNKFTEELKKFEVNTLVRVCEATYDKAPVEREGIQVLDWPFDDGAPPPTQIVDDWLNLLKTKF--RDEPGCCIAVHCVAGLGRAPVLVALALIESGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRL 161          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Cavefish
Match: ptp4a2b (protein tyrosine phosphatase type IVA 2 [Source:NCBI gene;Acc:103042327])

HSP 1 Score: 159.844 bits (403), Expect = 3.548e-46
Identity = 73/158 (46.20%), Postives = 101/158 (63.92%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
            +  +P A  I Y+ M FLI  +P+   ++ F EE K+  V  +VRVCE+ Y +   +  GI +  W F DG+PPP+ I++ W  LLK +F  +      IAVHC+AG GRAPVLVA+AL+E GM  EDA++ IR KR+G+FN +Q+ YL  YR K RL
Sbjct:    8 NMNRPAAVEITYECMRFLITHNPTNSTLNKFTEELKKFEVNTLVRVCEATYDKAPVEREGIQVLDWPFDDGAPPPTQIVDDWLNLLKTKF--RDEPGCCIAVHCVAGLGRAPVLVALALIESGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRL 163          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Cavefish
Match: ptp4a3a (protein tyrosine phosphatase type IVA 3-like [Source:NCBI gene;Acc:103031245])

HSP 1 Score: 158.303 bits (399), Expect = 1.341e-45
Identity = 71/158 (44.94%), Postives = 97/158 (61.39%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
               +P    + YK+M FLI  +P+   +  F E+ K+   T VVRVCE  Y +   +  GI +  W F DG+PPP+ ++E W  LL+ RF         +AVHC+AG GRAPVLVA+AL+E GM  EDAI+ IR KR+G+ N +Q++YL  YR K RL
Sbjct:    3 RMNRPAPVEVRYKNMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPTKVVEDWLSLLRRRF--MEEPGCCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Cavefish
Match: ptp4a3b (protein tyrosine phosphatase type IVA 3 [Source:NCBI gene;Acc:103029087])

HSP 1 Score: 155.606 bits (392), Expect = 1.105e-44
Identity = 71/157 (45.22%), Postives = 98/157 (62.42%), Query Frame = 1
Query:  235 FQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
              +P    + YK+M FLI  +P+   +  F E+ K+   T VVRVCE  Y +   +  GI +  W F DG+PPP+ I++ W  LLK++F         +AVHC+AG GRAPVLVA+AL+E GM  EDAI+ IR KR+G+ N +Q++YL  YR K RL
Sbjct:    4 MNRPAPVEVCYKNMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEITYDKTPLEKDGITVMDWPFDDGAPPPTKIVDDWLSLLKNKFC--EDPGCCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Cavefish
Match: ptp4a1 (protein tyrosine phosphatase type IVA 1 [Source:NCBI gene;Acc:103037233])

HSP 1 Score: 154.836 bits (390), Expect = 2.153e-44
Identity = 72/158 (45.57%), Postives = 98/158 (62.03%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
               +P    I YK+M FLI  +P+   ++ F EE K+  VT VVRVCE+ Y        GI +  W F DG+PP + I++ W  LL+ +F  +      +AVHC+AG GRAPVLVA+AL+E GM  EDA++ IR KR+G+FN +Q+ YL  YR K RL
Sbjct:    3 RMNRPAPVEITYKNMRFLITHNPTNATLNKFIEELKKYGVTTVVRVCEATYDANLVAKEGIQVLDWPFDDGAPPSNQIVDDWLNLLRIKF--REEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLFYLEKYRPKMRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Sea Lamprey
Match: ptp4a1 (protein tyrosine phosphatase 4A1 [Source:ZFIN;Acc:ZDB-GENE-041121-11])

HSP 1 Score: 157.918 bits (398), Expect = 3.598e-46
Identity = 72/162 (44.44%), Postives = 102/162 (62.96%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRLYLSQ 717
               +P A  + YKHM FLI  +P+   ++ F EE K+ NVT VVRVCE  Y +   +  GI+++ W F DG+PP + I++ W  L K +F  +   +  I VHC+AG GRAPVLVA+AL+E GM  EDA++ IR KR+G+ N +Q+ YL  YR K +L   +
Sbjct:    6 RMNRPAAVEVTYKHMRFLITHNPTNVTLNKFIEELKKYNVTTVVRVCEVTYDKSPVEQQGISVFDWSFDDGAPPSNKIVDDWLNLCKTKF--RDEPDCCIGVHCVAGLGRAPVLVALALIESGMKYEDAVQFIRQKRRGAINSKQLLYLEKYRPKMKLRFKE 165          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Sea Lamprey
Match: cdc14ab (cell division cycle 14Ab [Source:NCBI gene;Acc:565969])

HSP 1 Score: 59.6918 bits (143), Expect = 2.821e-10
Identity = 41/131 (31.30%), Postives = 65/131 (49.62%), Query Frame = 1
Query:  337 KRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALME-LGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRLYLSQKCF 726
            ++  VT V+R+ +  Y    F D G+      F DGS P  DI+ K+ ++ +        + G++AVHC AG GR   L+A  LM+   +   +A+  IR  R GS    Q  +L  +R +S L+   + F
Sbjct:   45 RKNGVTTVIRLNKKIYDARRFTDAGLAHHDLFFPDGSSPSPDIVRKFCEICEG-------TRGAVAVHCKAGLGRTGTLIACYLMKHHRLTAAEAVAWIRICRPGSIIGPQQHFLLEWR-QSGLWAQGEAF 167          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Sea Lamprey
Match: ptp4a3a (protein tyrosine phosphatase 4A3a [Source:ZFIN;Acc:ZDB-GENE-040426-2220])

HSP 1 Score: 49.2914 bits (116), Expect = 2.616e-8
Identity = 22/60 (36.67%), Postives = 35/60 (58.33%), Query Frame = 1
Query:  241 KPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINL 420
            +P    + Y+ M FLI  +P+   ++ F EE K+ +VT VVRVCE  Y +   +  GI++
Sbjct:    6 RPAPVEVTYREMRFLITHNPNNTTLNKFIEELKQYSVTTVVRVCEVTYDKSPLEREGISV 65          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Yeast
Match: CDC14 (Protein phosphatase required for mitotic exit; required for rDNA segregation, cytokinesis, meiosis I spindle disassembly, environmental stress response; held in nucleolus by Cdc55p in early meiosis, liberated by FEAR and Mitotic Exit Network in anaphase, enabling it to effect a decrease in CDK/B-cyclin activity and mitotic exit; sequestered in metaphase II, released upon entry into anaphase II; human homolog CDC14A can complement thermosensitivity of yeast cdc14-1 mutant [Source:SGD;Acc:S000001924])

HSP 1 Score: 49.6766 bits (117), Expect = 8.130e-7
Identity = 36/121 (29.75%), Postives = 56/121 (46.28%), Query Frame = 1
Query:  289 MDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALM-ELGMHCEDAIEMIRSKRKG 648
            ++ P +  ++ FA      NV  VVR+    Y+++ F+D+GI      F DG+ P   I++ +    +    T     G IAVHC AG GR   L+   L+   G    + I  +R  R G
Sbjct:  207 LNQPFKSVLNFFANN----NVQLVVRLNSHLYNKKHFEDIGIQHLDLIFEDGTCPDLSIVKNFVGAAE----TIIKRGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPG 319          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Nematostella
Match: EDO37167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGK4])

HSP 1 Score: 141.739 bits (356), Expect = 3.907e-40
Identity = 65/144 (45.14%), Postives = 90/144 (62.50%), Query Frame = 1
Query:  274 MNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
            M FLI D P+   +  + ++ K+ +   VVRVCE  Y+ E     GI +  W F DG+ PP  ++E W +LLK +F  +  S   +AVHC+AG GRAPVLVA+AL+E GM  EDA+E IR KR+G+ N +Q+SYL  Y+    L
Sbjct:    1 MKFLITDRPTNSTLPQYIQDLKKYDAHTVVRVCEPTYNTETLSKEGIIVLDWPFDDGAAPPKQLVEDWLKLLKGKFKERPGS--CVAVHCVAGLGRAPVLVALALIESGMKYEDAVEFIRRKRRGAINAKQLSYLERYKPTKLL 142          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Nematostella
Match: EDO44060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWZ5])

HSP 1 Score: 100.908 bits (250), Expect = 4.875e-24
Identity = 74/185 (40.00%), Postives = 108/185 (58.38%), Query Frame = -2
Query:  985 SGEP-------PSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVNKINGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGXXXXXXXXXXXXXXXXKVGGLHETLLDRREKMKADRYCK 1518
            +GEP       P+  E+ + + +S+ K+++K+GY KY+ +   G    +    +A+G  EQ   +F+  KVAL   N CFLSV+       ++ +  K    E   IR +KP  + P     VE+       EL+YVKKFQSFQ  K+KLSKE++S LKKA+  G LHE +LDRREKMK+D++CK
Sbjct:   82 AGEPREDGVNSPAPVEVFTAVPVSEVKLAIKSGYGKYMSVNTMG---DITGRAEAIGPQEQLELLFDGDKVALQAYNGCFLSVSDSGS---LSASKKKAGEKEIFSIRADKPKSK-PKTDSQVEDEEDVTNLELSYVKKFQSFQDRKIKLSKEEQSNLKKARLDGRLHEEMLDRREKMKSDKFCK 259          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Nematostella
Match: EDO38271 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDJ9])

HSP 1 Score: 56.225 bits (134), Expect = 1.074e-8
Identity = 34/106 (32.08%), Postives = 54/106 (50.94%), Query Frame = 1
Query:  337 KRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALME-LGMHCEDAIEMIRSKRKGS 651
            K+ N++ VVR+ +  Y  + F D GI  +   F DGS P   I+ ++  + ++       + G IA+HC AG GR   L+A  LM+       ++I  +R  R GS
Sbjct:  201 KKHNISTVVRLNKKLYDAQRFTDHGIEHYDLFFIDGSVPSDMIVRRFLTIAEN-------AKGGIAIHCKAGLGRTGTLIACYLMKHYRFTAAESIGWLRVCRPGS 299          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Nematostella
Match: EDO38043 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE41])

HSP 1 Score: 47.7506 bits (112), Expect = 7.127e-6
Identity = 33/116 (28.45%), Postives = 51/116 (43.97%), Query Frame = 1
Query:  340 RLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALM-ELGMHCEDAIEMIRSKRKGSFNERQISYLTH 684
            RLN  D +      Y    F   G       F DG  P   I++++ ++L        H  G++A+HC AG GR   L+A  L+ +      +A+  +R  R GS +  Q  +L H
Sbjct:  226 RLNRDDNMIKYGLVYDARCFTANGFAHSDQYFEDGGIPTKAIVKRFTRIL-------DHCEGAVAIHCRAGLGRTGTLIACYLIKQYKFSAAEAVGWLRICRPGSVSSLQHCFLEH 334          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Medaka
Match: ptp4a2b (protein tyrosine phosphatase type IVA 2 [Source:NCBI gene;Acc:101164411])

HSP 1 Score: 156.377 bits (394), Expect = 6.244e-45
Identity = 72/163 (44.17%), Postives = 103/163 (63.19%), Query Frame = 1
Query:  217 MKSARHFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
            M    +  +P A  I+Y  M FLI  +P+   ++ F E+ K+  V  +VRVCE+ Y +   +  GI++  W F DG+PPP+ I++ W +LL  +F  +      IAVHC+AG GRAPVLVA+AL+E GM  EDA++ IR KR+G+FN +Q+ YL  YR K RL
Sbjct:    1 MGRLANMNRPAAVEISYDCMTFLITHNPTNATLNKFTEDLKKFKVNTLVRVCEATYDKTPVEKEGIHVLDWPFDDGAPPPTQIVDDWLKLLNTKF--REEPGCCIAVHCVAGLGRAPVLVALALIESGMKYEDAVQYIRQKRRGAFNSKQLLYLEKYRPKMRL 161          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Medaka
Match: ptp4a2b (protein tyrosine phosphatase type IVA 2 [Source:NCBI gene;Acc:101164411])

HSP 1 Score: 156.377 bits (394), Expect = 6.244e-45
Identity = 72/163 (44.17%), Postives = 103/163 (63.19%), Query Frame = 1
Query:  217 MKSARHFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
            M    +  +P A  I+Y  M FLI  +P+   ++ F E+ K+  V  +VRVCE+ Y +   +  GI++  W F DG+PPP+ I++ W +LL  +F  +      IAVHC+AG GRAPVLVA+AL+E GM  EDA++ IR KR+G+FN +Q+ YL  YR K RL
Sbjct:    1 MGRLANMNRPAAVEISYDCMTFLITHNPTNATLNKFTEDLKKFKVNTLVRVCEATYDKTPVEKEGIHVLDWPFDDGAPPPTQIVDDWLKLLNTKF--REEPGCCIAVHCVAGLGRAPVLVALALIESGMKYEDAVQYIRQKRRGAFNSKQLLYLEKYRPKMRL 161          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Medaka
Match: ptp4a1 (protein tyrosine phosphatase 4A1 [Source:NCBI gene;Acc:101157510])

HSP 1 Score: 155.992 bits (393), Expect = 1.042e-44
Identity = 74/158 (46.84%), Postives = 98/158 (62.03%), Query Frame = 1
Query:  232 HFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
               +P    I YK+M FLI  +P+   ++ F EE K+  VT VVRVCE+ Y        GI +  W F DG+PP + I++ W  LLK +F  +      IAVHC+AG GRAPVLVA+AL+E GM  EDA++ IR KR+G+FN +Q+ YL  YR K RL
Sbjct:    3 RMNRPAPVEITYKNMRFLITHNPTNATLNKFIEELKKYGVTTVVRVCEATYDAALVVKEGIQVLDWPFDDGAPPSNQIVDDWLNLLKLKF--REEPGCCIAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLFYLEKYRPKMRL 158          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Medaka
Match: ptp4a3b (protein tyrosine phosphatase type IVA 3 [Source:NCBI gene;Acc:101157004])

HSP 1 Score: 153.295 bits (386), Expect = 1.075e-43
Identity = 69/157 (43.95%), Postives = 101/157 (64.33%), Query Frame = 1
Query:  235 FQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRL 705
              +P    + +K+M FLI  +P+   +  F E+ KR  VT +VRVC+  Y +   +  GI ++ W F DG+ PP+ +++ W  LLK +F  Q      +AVHC+AG GRAPVLVA+AL+E GM  EDAI++IR KR+G+ N +Q++YL  YR+K RL
Sbjct:    5 MNRPAPVELCHKNMRFLITHNPTDSTLSSFVEDLKRYGVTLLVRVCDITYDKTTLEKDGITVFDWPFDDGAAPPNKLVDDWLSLLKKKF--QEDPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQLIRQKRRGAINSKQLTYLEKYRSKHRL 159          
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Medaka
Match: ptp4a2a (protein tyrosine phosphatase type IVA 2-like [Source:NCBI gene;Acc:101163535])

HSP 1 Score: 139.428 bits (350), Expect = 2.304e-38
Identity = 65/159 (40.88%), Postives = 93/159 (58.49%), Query Frame = 1
Query:  235 FQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVRVCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSHSNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQISYLTHYRAKSRLYL 711
              +P    I+Y  + FLI  +P+   +  F E+ K   V  +VRVC + Y +   +  GI +  W F DGS PP  ++  W  LL+ +F  Q      +AVHC+AG GRAPVLVA+AL+E GM  EDA+ +IR KR+G+ N +Q+ YL  Y++K  L L
Sbjct:    1 MNRPAPVEISYDCLRFLITHNPTDAQMGKFIEDLKAFGVNTLVRVCAATYDKTPVEQEGIQVLDWPFDDGSAPPDQVVGDWLNLLQAKFKEQPGC--CVAVHCVAGLGRAPVLVALALIECGMEYEDAVHLIRQKRRGALNAKQLHYLEEYKSKLCLRL 157          
BLAST of Protein tyrosine phosphatase type IVA vs. Planmine SMEST
Match: SMESG000078867.1 (SMESG000078867.1)

HSP 1 Score: 331.257 bits (848), Expect = 1.795e-111
Identity = 180/180 (100.00%), Postives = 180/180 (100.00%), Query Frame = -2
Query:  985 HKSGEPPSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVNKINGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGXXXXXXXXXXXXXXXXKVGGLHETLLDRREKMKADRYCK 1524
            HKSGEPPSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVNKINGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGKMKLSKEDKSELKKAKKVGGLHETLLDRREKMKADRYCK
Sbjct:   78 HKSGEPPSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVNKINGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGKMKLSKEDKSELKKAKKVGGLHETLLDRREKMKADRYCK 257          
BLAST of Protein tyrosine phosphatase type IVA vs. Planmine SMEST
Match: SMESG000078867.1 (SMESG000078867.1)

HSP 1 Score: 331.257 bits (848), Expect = 3.968e-111
Identity = 180/180 (100.00%), Postives = 180/180 (100.00%), Query Frame = -2
Query:  985 HKSGEPPSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVNKINGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGXXXXXXXXXXXXXXXXKVGGLHETLLDRREKMKADRYCK 1524
            HKSGEPPSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVNKINGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGKMKLSKEDKSELKKAKKVGGLHETLLDRREKMKADRYCK
Sbjct:   96 HKSGEPPSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVNKINGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGKMKLSKEDKSELKKAKKVGGLHETLLDRREKMKADRYCK 275          
BLAST of Protein tyrosine phosphatase type IVA vs. Planmine SMEST
Match: SMESG000010171.1 (SMESG000010171.1)

HSP 1 Score: 330.487 bits (846), Expect = 6.976e-110
Identity = 179/180 (99.44%), Postives = 179/180 (99.44%), Query Frame = -2
Query:  985 HKSGEPPSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVNKINGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGXXXXXXXXXXXXXXXXKVGGLHETLLDRREKMKADRYCK 1524
            HKSGEPPSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVN INGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGKMKLSKEDKSELKKAKKVGGLHETLLDRREKMKADRYCK
Sbjct:  163 HKSGEPPSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVNNINGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGKMKLSKEDKSELKKAKKVGGLHETLLDRREKMKADRYCK 342          
BLAST of Protein tyrosine phosphatase type IVA vs. Planmine SMEST
Match: SMESG000010171.1 (SMESG000010171.1)

HSP 1 Score: 330.487 bits (846), Expect = 9.489e-110
Identity = 179/180 (99.44%), Postives = 179/180 (99.44%), Query Frame = -2
Query:  985 HKSGEPPSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVNKINGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGXXXXXXXXXXXXXXXXKVGGLHETLLDRREKMKADRYCK 1524
            HKSGEPPSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVN INGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGKMKLSKEDKSELKKAKKVGGLHETLLDRREKMKADRYCK
Sbjct:  171 HKSGEPPSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVNNINGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGKMKLSKEDKSELKKAKKVGGLHETLLDRREKMKADRYCK 350          
BLAST of Protein tyrosine phosphatase type IVA vs. Planmine SMEST
Match: SMESG000010171.1 (SMESG000010171.1)

HSP 1 Score: 330.487 bits (846), Expect = 1.320e-109
Identity = 179/180 (99.44%), Postives = 179/180 (99.44%), Query Frame = -2
Query:  985 HKSGEPPSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVNKINGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGXXXXXXXXXXXXXXXXKVGGLHETLLDRREKMKADRYCK 1524
            HKSGEPPSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVN INGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGKMKLSKEDKSELKKAKKVGGLHETLLDRREKMKADRYCK
Sbjct:  188 HKSGEPPSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDAMGENEQWTPIFEEGKVALLGRNSCFLSVNNINGKIEVTCNSPKVESSEFLQIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGKMKLSKEDKSELKKAKKVGGLHETLLDRREKMKADRYCK 367          
The following BLAST results are available for this feature:
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTP4A31.184e-4545.57protein tyrosine phosphatase 4A3 [Source:HGNC Symb... [more]
PTP4A31.184e-4545.57protein tyrosine phosphatase 4A3 [Source:HGNC Symb... [more]
PTP4A31.184e-4545.57protein tyrosine phosphatase 4A3 [Source:HGNC Symb... [more]
PTP4A31.184e-4545.57protein tyrosine phosphatase 4A3 [Source:HGNC Symb... [more]
PTP4A22.800e-4545.22protein tyrosine phosphatase 4A2 [Source:HGNC Symb... [more]
back to top
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T19D2.21.118e-4845.96Putative prenylated protein tyrosine phosphatase ... [more]
frg-11.267e-1934.78pep chromosome:WBcel235:III:12979162:12980163:1 ge... [more]
cdc-141.622e-730.63Tyrosine-protein phosphatase cdc-14 [Source:UniPr... [more]
cdc-141.637e-730.63Tyrosine-protein phosphatase cdc-14 [Source:UniPr... [more]
cdc-141.769e-730.63Tyrosine-protein phosphatase cdc-14 [Source:UniPr... [more]
back to top
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRL-19.102e-4545.81gene:FBgn0024734 transcript:FBtr0080857[more]
PRL-19.102e-4545.81gene:FBgn0024734 transcript:FBtr0332358[more]
PRL-19.102e-4545.81gene:FBgn0024734 transcript:FBtr0080856[more]
PRL-19.102e-4545.81gene:FBgn0024734 transcript:FBtr0332357[more]
FRG14.913e-2441.67gene:FBgn0036964 transcript:FBtr0074847[more]
back to top
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptp4a3a2.593e-4647.47protein tyrosine phosphatase 4A3a [Source:ZFIN;Acc... [more]
ptp4a3a2.593e-4647.47protein tyrosine phosphatase 4A3a [Source:ZFIN;Acc... [more]
ptp4a3a2.593e-4647.47protein tyrosine phosphatase 4A3a [Source:ZFIN;Acc... [more]
ptp4a12.190e-4547.53protein tyrosine phosphatase 4A1 [Source:ZFIN;Acc:... [more]
ptp4a13.687e-4546.84protein tyrosine phosphatase 4A1 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptp4a28.509e-4545.22protein tyrosine phosphatase type IVA, member 2 [S... [more]
tcta2.288e-4446.20T cell leukemia translocation altered [Source:Xenb... [more]
pfdn43.330e-4444.94prefoldin subunit 4 [Source:Xenbase;Acc:XB-GENE-85... [more]
cdh203.634e-3446.11cadherin 20 [Source:Xenbase;Acc:XB-GENE-1011620][more]
cdh204.259e-3446.11cadherin 20 [Source:Xenbase;Acc:XB-GENE-1011620][more]
back to top
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptp4a32.684e-4646.20protein tyrosine phosphatase 4a3 [Source:MGI Symbo... [more]
Ptp4a32.684e-4646.20protein tyrosine phosphatase 4a3 [Source:MGI Symbo... [more]
Ptp4a32.684e-4646.20protein tyrosine phosphatase 4a3 [Source:MGI Symbo... [more]
Ptp4a32.684e-4646.20protein tyrosine phosphatase 4a3 [Source:MGI Symbo... [more]
Ptp4a21.922e-4545.22protein tyrosine phosphatase 4a2 [Source:MGI Symbo... [more]
back to top
BLAST of Protein tyrosine phosphatase type IVA vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D658|TP4A3_MOUSE1.877e-4546.20Protein tyrosine phosphatase type IVA 3 OS=Mus mus... [more]
sp|O75365|TP4A3_HUMAN5.687e-4545.57Protein tyrosine phosphatase type IVA 3 OS=Homo sa... [more]
sp|Q6P9X4|TP4A2_RAT1.345e-4445.22Protein tyrosine phosphatase type IVA 2 OS=Rattus ... [more]
sp|O70274|TP4A2_MOUSE1.345e-4445.22Protein tyrosine phosphatase type IVA 2 OS=Mus mus... [more]
sp|Q12974|TP4A2_HUMAN1.345e-4445.22Protein tyrosine phosphatase type IVA 2 OS=Homo sa... [more]
back to top
BLAST of Protein tyrosine phosphatase type IVA vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430QDS41.120e-6460.56Protein tyrosine phosphatase type IVA OS=Schistoso... [more]
G4VB661.611e-6460.56TYR_PHOSPHATASE_2 domain-containing protein OS=Sch... [more]
Q5DB621.127e-6359.22Protein tyrosine phosphatase type IVA 3 OS=Schisto... [more]
A0A4V3SHA07.082e-6355.31TYR_PHOSPHATASE_2 domain-containing protein OS=Opi... [more]
A0A564XZ161.058e-6158.14TYR_PHOSPHATASE_2 domain-containing protein OS=Hym... [more]
back to top
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptp4a2b3.134e-4645.40protein tyrosine phosphatase type IVA 2 [Source:NC... [more]
ptp4a2b3.548e-4646.20protein tyrosine phosphatase type IVA 2 [Source:NC... [more]
ptp4a3a1.341e-4544.94protein tyrosine phosphatase type IVA 3-like [Sour... [more]
ptp4a3b1.105e-4445.22protein tyrosine phosphatase type IVA 3 [Source:NC... [more]
ptp4a12.153e-4445.57protein tyrosine phosphatase type IVA 1 [Source:NC... [more]
back to top
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ptp4a13.598e-4644.44protein tyrosine phosphatase 4A1 [Source:ZFIN;Acc:... [more]
cdc14ab2.821e-1031.30cell division cycle 14Ab [Source:NCBI gene;Acc:565... [more]
ptp4a3a2.616e-836.67protein tyrosine phosphatase 4A3a [Source:ZFIN;Acc... [more]
back to top
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CDC148.130e-729.75Protein phosphatase required for mitotic exit; req... [more]
back to top
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO371673.907e-4045.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO440604.875e-2440.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382711.074e-832.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380437.127e-628.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein tyrosine phosphatase type IVA vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptp4a2b6.244e-4544.17protein tyrosine phosphatase type IVA 2 [Source:NC... [more]
ptp4a2b6.244e-4544.17protein tyrosine phosphatase type IVA 2 [Source:NC... [more]
ptp4a11.042e-4446.84protein tyrosine phosphatase 4A1 [Source:NCBI gene... [more]
ptp4a3b1.075e-4343.95protein tyrosine phosphatase type IVA 3 [Source:NC... [more]
ptp4a2a2.304e-3840.88protein tyrosine phosphatase type IVA 2-like [Sour... [more]
back to top
BLAST of Protein tyrosine phosphatase type IVA vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078867.11.795e-111100.00SMESG000078867.1[more]
SMESG000078867.13.968e-111100.00SMESG000078867.1[more]
SMESG000010171.16.976e-11099.44SMESG000010171.1[more]
SMESG000010171.19.489e-11099.44SMESG000010171.1[more]
SMESG000010171.11.320e-10999.44SMESG000010171.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034467 ID=SMED30034467|Name=Protein tyrosine phosphatase type IVA|organism=Schmidtea mediterranea sexual|type=transcript|length=1525bp
TAAAATTGACGCACTCAGTTTATTTTTTCACTTTTCCTTAATTTTTATAA
ATTATATTTTATTCAATATAGGTAAAAACAATTTTTAATTTTATAAAAAG
ATTTAATTTGTTAGTGATTTTAAGAAGTTATAAGTTTGTGTCAAAATTTT
AACTTTTAGTGCCTTTTGAAATTTATCAAGAATTAGAAGTCATAATTTTT
TTGTAAAGTATGACCCATGAAGTCTGCAAGACACTTTCAGAAACCATTTG
CTACACATATTAATTATAAACACATGAATTTTCTAATAATGGATTCTCCT
TCTCAAGATAACGTTCACATATTTGCAGAAGAATGTAAAAGATTAAACGT
TACTGATGTAGTTCGTGTTTGTGAATCACATTATAGTGAAGAAGCTTTCA
AAGATGTCGGTATTAATTTATGGCACTGGGAATTCAGTGATGGCTCACCT
CCACCAAGTGATATTTTAGAAAAATGGTTTCAGTTACTCAAAGATCGATT
TAACACCCAATCTCATTCCAATGGATCGATAGCGGTTCATTGTATTGCTG
GATTTGGTAGAGCTCCTGTGTTGGTGGCTGTTGCTTTAATGGAACTTGGA
ATGCATTGTGAAGACGCAATCGAAATGATACGAAGTAAACGCAAAGGTTC
CTTCAATGAACGTCAGATATCTTATTTAACTCATTATCGGGCCAAATCGA
GACTTTACCTATCCCAGAAGTGTTTTATATTATAATTGAAAATAATCAAC
GCAGTGAATCAAATTGACGCATATTCGTATCATCCTCAATTGGCCATTCT
TGTCAACCTGAGCCCTAATTATATATTTACAGTGATCGACCATTACTGAA
ACGATGATCTATCAATAAATTAAGATTGTATTAGTGTTGTAATGGCCTGT
TATATAATTGCGAATGAAAAAGATATTGTAAAATATTTTCCAGGCAATGA
TTTTTGAATTAAAAAATTGGAAAACAGATTTTTATTTACAATAACGATCA
GCTTTCATTTTTTCTCGTCTATCAAGTAATGTTTCATGTAAACCTCCAAC
TTTCTTTGCCTTCTTTAGTTCGCTTTTATCTTCTTTACTCAGTTTCATTT
TGCCTCCTTGAAAACTTTGGAATTTTTTAACGTAATTTAATTCTGATTTC
ATTGCCCCACTCCTTTCTTCGACTGGCAACAAATTTATTGGATCTTCGAA
TAATGGTTTGTTACATCTTATTTGAAGAAATTCAGATGATTCAACTTTTG
GTGAGTTGCATGTGACTTCTATTTTACCATTTATCTTATTTACGCTTAAA
AAACACGAATTTCTTCCTAGTAGAGCAACTTTACCTTCTTCAAAAATCGG
TGTCCATTGTTCATTCTCACCCATGGCATCTCTCACGGCATTAACTGTAT
TATTTAGGCCTTTCATTTCAATACCAACATACTTGTTGTATCCAGTTTTC
AAAGAAATCTTTGTATCTGAAAGGACCATACATGATAGGATTTCATCTTC
TGATGGTGGCTCACCACTTTTATGC
back to top

protein sequence of SMED30034467-orf-1

>SMED30034467-orf-1 ID=SMED30034467-orf-1|Name=SMED30034467-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=173bp
MKSARHFQKPFATHINYKHMNFLIMDSPSQDNVHIFAEECKRLNVTDVVR
VCESHYSEEAFKDVGINLWHWEFSDGSPPPSDILEKWFQLLKDRFNTQSH
SNGSIAVHCIAGFGRAPVLVAVALMELGMHCEDAIEMIRSKRKGSFNERQ
ISYLTHYRAKSRLYLSQKCFIL*
back to top

protein sequence of SMED30034467-orf-2

>SMED30034467-orf-2 ID=SMED30034467-orf-2|Name=SMED30034467-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=181bp
HKSGEPPSEDEILSCMVLSDTKISLKTGYNKYVGIEMKGLNNTVNAVRDA
MGENEQWTPIFEEGKVALLGRNSCFLSVNKINGKIEVTCNSPKVESSEFL
QIRCNKPLFEDPINLLPVEERSGAMKSELNYVKKFQSFQGGKMKLSKEDK
SELKKAKKVGGLHETLLDRREKMKADRYCK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0035335peptidyl-tyrosine dephosphorylation
Vocabulary: molecular function
TermDefinition
GO:0016791phosphatase activity
GO:0008138protein tyrosine/serine/threonine phosphatase activity
GO:0004725protein tyrosine phosphatase activity
GO:0016787hydrolase activity
Vocabulary: INTERPRO
TermDefinition
IPR003595Tyr_Pase_cat
IPR029021Prot-tyrosine_phosphatase-like
IPR000340Dual-sp_phosphatase_cat-dom
IPR000387TYR_PHOSPHATASE_dom
IPR010414FRG1
IPR008999Actin-crosslinking
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 64..160
e-value: 2.1E-4
score: 29.0
IPR000340Dual specificity phosphatase, catalytic domainPFAMPF00782DSPccoord: 43..157
e-value: 5.6E-10
score: 39.2
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 3..168
e-value: 5.6E-47
score: 161.5
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 11..158
NoneNo IPR availablePANTHERPTHR23339TYROSINE SPECIFIC PROTEIN PHOSPHATASE AND DUAL SPECIFICITY PROTEIN PHOSPHATASEcoord: 5..166
NoneNo IPR availablePANTHERPTHR23339:SF65PROTEIN TYROSINE PHOSPHATASE TYPE IVA 2coord: 5..166
NoneNo IPR availableCDDcd14500PTP-IVacoord: 10..163
e-value: 7.50949E-90
score: 257.149
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 85..153
score: 15.213