SMED30034433

Overview
NameSMED30034433
Smed IDSMED30034433
Length (bp)1136
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034433

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30034433SMESG000077381.1 Contig4871_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30034433 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000027:158314..159493 +5662
Homology
BLAST of SMED30034433 vs. UniProt/SwissProt
Match: sp|P33300|SUR1_YEAST (Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.104e-17
Identity = 50/179 (27.93%), Postives = 88/179 (49.16%), Query Frame = -3
Query:  295 IPKIIHYVYKSHMVPSQYSPLVKGCLRINKQIKFILWSDDSVYEIIKMYFPQYIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFDTRCQKPFDTVMVNDSCLLSTEVEMQSQILWRHKYLAMNSFMACVPEHRFFRFIIDKIESPDA------TSVLFQTGPMWITSLLNLYNK 813
            IPKIIH  YK+  +P  +    + CL ++   K+ILW+D+  YE IK  +P ++  +E Y+      ++ +D  RYF+L  +GG+Y+D D  C++  D ++   + L  T     S           N  M  VP H FF   +  ++  D        +++  TGP++++ +   Y +
Sbjct:   55 IPKIIHQTYKTEDIPEHWKEGRQKCLDLHPDYKYILWTDEMAYEFIKEEYPWFLDTFENYK----YPIERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFLRKTSPLGVS-----------NDVMGSVPRHPFFLKALKSLKHYDKYWFIPYMTIMGSTGPLFLSVIWKQYKR 218          
BLAST of SMED30034433 vs. UniProt/SwissProt
Match: sp|P38287|CSH1_YEAST (Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.005e-16
Identity = 55/206 (26.70%), Postives = 98/206 (47.57%), Query Frame = -3
Query:  232 IPKIIHYVYKSHMVPSQYSPLVKGCLRINKQIKFILWSDDSVYEIIKMYFPQYIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFDTRCQKPFDTVMVNDSCLLSTEVEMQSQILWRHKYLAMNSFMACVPEHRFFRFIIDKIESPDAT------SVLFQTGPMWITSLLNLYNKLINKSNNLSDKIV------LANSSLFS 813
            IPKIIH  YK++ +P Q+    + C+ ++    +ILW+D+     IK  +P ++  +  Y       ++ +D  RYF+L  +GGIY+D D  C++  D ++   + L  T     S           N  M  VP H FF  +I  ++           +++  TGP++I+ +   Y +  N + N + +I+      + N+S FS
Sbjct:   62 IPKIIHQTYKTNDIPEQWVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRSYE----YPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVPAFLRKTSPTGVS-----------NDVMGSVPRHPFFLKVIKSLKHYKKNWYIPYMTIMGSTGPLFISVVWKQYKRWSNTAENGAVRILQPADYKMHNNSFFS 252          
BLAST of SMED30034433 vs. UniProt/SwissProt
Match: sp|Q10323|IMT3_SCHPO (Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.194e-15
Identity = 47/184 (25.54%), Postives = 93/184 (50.54%), Query Frame = -3
Query:  292 ANGIPKIIHYVYKSHMVPSQYSPLVKGCLRINKQIKFILWSDDSVYEIIKMYFPQYIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFDTRCQKPFDTVMVNDSCLLSTEVEMQSQILWRHKYLAMNSFMACVPEHRFFRFIIDKIES-------PDATSVLFQTGPMWITSLLNLYNKL 822
            +  IPKIIH  +K++ +P ++    K C+ ++   +++LW+D+S+ E I   +P ++  Y+ Y       ++ +D+ RYF+L+K+GGIY+D D  C +  D ++   + +  T     S           N+ M     H F   ++  +         P  T V++ TGP++++ + + + KL
Sbjct:   54 SAAIPKIIHQTWKTNEIPEKWVGAQKSCIDLHPDYEYVLWTDESMREFIATDYPWFLTQYDSYPYN----IERADVVRYFILYKYGGIYLDLDVGCNRTLDPLLHYPAWVRRTSPSGIS-----------NNVMGFAKGHPFLLQVVRNLPRFAFNYHFPYLT-VMYSTGPLFLSIIWSAWRKL 221          
BLAST of SMED30034433 vs. UniProt/SwissProt
Match: sp|Q9UT67|IMT2_SCHPO (Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.409e-14
Identity = 48/191 (25.13%), Postives = 89/191 (46.60%), Query Frame = -3
Query:  259 IPKIIHYVYKSHMVPSQYSPLVKGCLRINKQIKFILWSDDSVYEIIKMYFPQYIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFDTRCQKPFDTVMVNDSCLLSTEVEMQSQILWRHKYLAMNSFMACVPEHRFFRFIIDKIESPDAT------SVLFQTGPMWITSLLNLYNKLINKSNNLSDKI 813
            IPKIIH  +K+  VP  +    + C+ ++   ++ILW+D+     I   +P ++  ++ Y       ++ +D+ RYF+L+ +GG Y+D D  C++  D+++     +  T+    S           N  M  VP H +F  II  +E    +      +++  TGP+ I+ L   Y + +       D I
Sbjct:   82 IPKIIHQTWKTTEVPEGWKGAQQSCIDLHPDYEYILWTDEMSRNFIADNYPWFLPYFDAYPFN----VQRADVIRYFVLYHYGGNYIDLDDGCRQRLDSLLYYPVWVRRTDPVGVS-----------NDVMGSVPHHPYFELIIQNLEKNAKSYWLPYLTIMLSTGPLSISFLWEKYKRQLPNPPAFYDHI 257          
BLAST of SMED30034433 vs. UniProt/SwissProt
Match: sp|O14084|IMT1_SCHPO (Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 3.442e-12
Identity = 48/186 (25.81%), Postives = 87/186 (46.77%), Query Frame = -3
Query:  319 ENTFANG----IPKIIHYVYKSHMVPSQYSPLVKGCLRINKQ---IKFILWSDDSVYEIIKMYFPQYIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFDTRCQKPFDTVMVNDSCLL-STEVEMQSQILWRHKYLAMNSFMACVPEHRFFRFIIDKIES------PDATSVLFQTGPMWIT 834
            ++T A G    IP++IH ++K   +P ++S  V  C R +      +FILW+D+ +   +   +  ++ ++  Y       ++  D  RYF+L+ +GG+YMD D  C+KP D ++   + +L STE    S           N + A  P+H F    I  +            +V    GP++++
Sbjct:   53 DDTSAPGEMEKIPRVIHQLWKDENIPERWSNTVNSCRRQHPDENGWQFILWTDEKIMSFMNENYSWFMPVFHSYPYN----IQKFDAARYFILYHYGGVYMDLDIGCKKPMDPLLSKATFILPSTEPIGYS-----------NDWFAATPKHPFLYQAIHNLSKFNHRYFTKYPTVFLSAGPLFLS 223          
BLAST of SMED30034433 vs. TrEMBL
Match: A0A1I8GMC1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031525g2 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 1.788e-37
Identity = 87/257 (33.85%), Postives = 133/257 (51.75%), Query Frame = -3
Query:   76 IPKIIHYVYKSHMVPSQYSPLVKGCLRINKQIKFILWSDDSVYEIIKMYFPQ-YIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFDTRCQKPFDTVMVNDSCLLSTEVEMQSQILWRHKYLAMNSFMACVPEHRFFRFIIDKI-ESPDATSVLFQTGPMWITSLLNLYNKLINKSNNLSDKIVLANSSLFSPVADPNLEI---HCSKRTVRK------WKEKACKNLANYRKIENVRIREAFCVHLFMHLGY 813
            IP+I+H V +S +V ++YS  ++ C R+N    +ILW D     +IK +FP  Y   Y  Y N+    LK SD  RY +L+ FGG+Y D D  C KPF   +  ++C L  E   QS I W  +  AMNS M C P H F   ++ ++ ESP   +V+  TGP+ +T  L+ +        + +D + L +  +FSP  D N +I    C KR  +       W ++ C++L  +  +++        VH FMHLG+
Sbjct:   38 IPRILHQVGESELVFAEYSFAIESCRRLNPNWTYILWRDKDAELLIKEFFPDFYRTQYAKYTNR----LKKSDSIRYIILYLFGGLYADLDVECMKPFSPDLDEEACFLDQENPAQSHIFWNKERSAMNSVMGCRPGHPFMLDLVSRMAESPSNQAVMLSTGPLMLTKALDEWTAQ-GSQRDWADSVRLMDPDIFSPHVD-NADILMDACRKRFGQPANDGELWVDRGCRDL-QFGGLKDNFTERTVAVHWFMHLGW 287          
BLAST of SMED30034433 vs. TrEMBL
Match: A0A1I8I557 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031525g1 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 9.098e-37
Identity = 86/257 (33.46%), Postives = 133/257 (51.75%), Query Frame = -3
Query:   76 IPKIIHYVYKSHMVPSQYSPLVKGCLRINKQIKFILWSDDSVYEIIKMYFPQ-YIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFDTRCQKPFDTVMVNDSCLLSTEVEMQSQILWRHKYLAMNSFMACVPEHRFFRFIIDKI-ESPDATSVLFQTGPMWITSLLNLYNKLINKSNNLSDKIVLANSSLFSPVADPNLEI---HCSKRTVRK------WKEKACKNLANYRKIENVRIREAFCVHLFMHLGY 813
            IP+I+H V +S +V ++YS  ++ C R+N    +ILW D     +IK +FP  Y   Y  Y N+    LK SD  RY +L+ FGG+Y D D  C KPF   +  ++C L  E   QS I W  +  AMNS M C P H F   ++ ++ +SP   +V+  TGP+ +T  L+ +        + +D + L +  +FSP  D N +I    C KR  +       W ++ C++L  +  +++        VH FMHLG+
Sbjct:   38 IPRILHQVGESELVFAEYSFAIESCRRLNPNWTYILWRDKDAELLIKEFFPDFYRTQYAKYTNR----LKKSDSIRYIILYLFGGLYADLDVECMKPFSPDLDEEACFLDQENPAQSHIFWNKERSAMNSVMGCRPGHPFMLDLVSRMAKSPSNQAVMLSTGPLMLTKALDEWTAQ-GSQRDWADSVRLMDPDIFSPHVD-NADILMDACRKRFGQPANDGELWVDRGCRDL-QFGGLKDNFTERTVAVHWFMHLGW 287          
BLAST of SMED30034433 vs. TrEMBL
Match: A0A267FUE4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019369g1 PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 2.939e-35
Identity = 88/293 (30.03%), Postives = 136/293 (46.42%), Query Frame = -3
Query:   34 SAKKYPMCTIESPESLLLYGKENTFANGIPKIIHYVYKSHMVPSQYSPLVKGCLRINKQIKFILWSDDSVYEIIKMYFPQYIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFDTRCQKPFDTVMVNDSCLLSTEVEMQSQILWRHKYLAMNSFMACVPEHRFFRFIIDKI----ESPDATSVLFQTGPMWITSLLNLYNKLINKSNNLSDKIVLANSSLFSPVADPNLEIHCSKRTVR-KWKEKACKNLANYRKIENVRIREAFCVHLFMHLGYEDRKRLIKKMENIC 897
            +   +P+  IE        G    F   IP I+H+ + S MV   Y P++  CL++N    + LW D     +I +++PQY+  Y  + +     L+ SD  RY +L +FGGIY+D D  C +PF   +   +  L  E   Q++I W  ++ AMNS M  VP H+FF+ + D++       DA S    TGP     L  ++ +  N     +  + L   S+ SP+ DPN       R  R  W  + C+ L   +   + R      VH F+HLGY    R  K + N+ 
Sbjct:   43 TGDPHPLAPIEG-------GTTAHFE--IPHILHHTFASEMVYENYRPMISSCLKLNPNWTYYLWRDSDARALIFLHYPQYMKTYMRFNDN----LQRSDAIRYIILHRFGGIYLDMDVECVRPFHPALTRQAAFLDQERVEQTRIAWGRQFSAMNSLMGSVPGHKFFQAMSDRVLLRKLPGDAYS---STGP---NVLTQVFQRFRNSPAIWNWPVHLLPPSVASPLMDPNRNWRQLCRYARYGWGSRGCRMLRAKKWRMDDRNGGTVAVHRFLHLGYGFAVRQRKSLFNLT 316          
BLAST of SMED30034433 vs. TrEMBL
Match: A0A267H5Y6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000626g1 PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 7.914e-35
Identity = 91/290 (31.38%), Postives = 137/290 (47.24%), Query Frame = -3
Query:   67 TFANGIPKIIHYVYKSHMVPSQYSPLVKGCLRINKQIKFILWSDDSVYEIIKMYFPQYIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFDTRCQKPFD---------------TVMVNDSCLLSTEVEMQSQILWRHKYLAMNSFMACVPEHRFFRFIIDKIES-PDATSVLFQTGPMWITSLLNLY--NKLINKSNNLSDKIVLANSSLFSPVADPNL---EIHCSK-----------RTVRKWKEKACKNLA----NYRKIENVRIREAFCVHLFMHLGYEDR 828
            T  +GIPKI+HYV+KS  V   Y P +K CL  N   + + WSD    ++I  ++ ++I+ Y  YR++    L+ SD  RY +L KFGG+Y+D D  C+KPF                +  V  S  L  E   Q++IL+ + Y AMNS M   P H FF+  ID++   P        TGP ++T L  ++        S    + ++L  + L SP+ D +L   E  C                RKW+   C  L     NY + ++  +     VH F+HLGY ++
Sbjct:   73 TGISGIPKILHYVFKSEQVFDSYKPFIKSCLDQNPDWQVLFWSDSHSEKLIADHYARFIHKYRSYRDR----LEKSDSVRYMILHKFGGVYLDMDVECRKPFSRLFTQPPVQESLAVASATVAPSAFLGEERREQTRILYGYSYCAMNSVMGSRPGHPFFQLAIDRMLGMPMLAHARLTTGPDFLTGLYRMWLNCSAGPASCQAKEPVLLYPARLVSPLMDTSLVNWESKCRPFLSKGKPDAKLEGRRKWEAMGCSQLVANGWNYDQTDDTTV----AVHRFLHLGYGNQ 354          
BLAST of SMED30034433 vs. TrEMBL
Match: A0A267G0Y6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012114g1 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 2.045e-34
Identity = 90/290 (31.03%), Postives = 136/290 (46.90%), Query Frame = -3
Query:   67 TFANGIPKIIHYVYKSHMVPSQYSPLVKGCLRINKQIKFILWSDDSVYEIIKMYFPQYIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFDTRCQKPFD---------------TVMVNDSCLLSTEVEMQSQILWRHKYLAMNSFMACVPEHRFFRFIIDKIES-PDATSVLFQTGPMWITSLLNLY--NKLINKSNNLSDKIVLANSSLFSPVADPNL---EIHCSK-----------RTVRKWKEKACKNLA----NYRKIENVRIREAFCVHLFMHLGYEDR 828
            T  +GIPKI+HYV+KS  V   Y P +K CL  N   + + WSD    ++I  ++ ++I+ Y  YR++    L+ SD  RY +L KFGG+Y+D D  C+KPF                +     S  L  E   Q++IL+ + Y AMNS M   P H FF+  ID++   P        TGP ++T L  ++        S    + ++L  + L SP+ D +L   E  C                RKW+   C  L     NY + ++  +     VH F+HLGY ++
Sbjct:   73 TGISGIPKILHYVFKSEQVFDSYKPFIKSCLDQNPDWQVLFWSDSHSEKLIADHYARFIHKYRSYRDR----LEKSDSVRYMILHKFGGVYLDMDVECRKPFSRLFTQPPVQERFAVASATAAPSAFLGEERREQTRILYGYSYCAMNSMMGSRPGHPFFQLAIDRMLGMPMLAHARLTTGPDFLTGLYRMWLNCSAGPASCQAKEPVLLYPARLVSPLMDTSLVNWESKCRPFLSKGKPDAKLEGRRKWEAMGCSQLVANGWNYDQTDDTTV----AVHRFLHLGYGNQ 354          
BLAST of SMED30034433 vs. Ensembl Yeast
Match: SUR1 (Mannosylinositol phosphorylceramide (MIPC) synthase catalytic subunit; forms a complex with regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Csh1p; SUR1 has a paralog, CSH1, that arose from the whole genome duplication [Source:SGD;Acc:S000005978])

HSP 1 Score: 87.0409 bits (214), Expect = 1.590e-19
Identity = 50/179 (27.93%), Postives = 88/179 (49.16%), Query Frame = -3
Query:  295 IPKIIHYVYKSHMVPSQYSPLVKGCLRINKQIKFILWSDDSVYEIIKMYFPQYIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFDTRCQKPFDTVMVNDSCLLSTEVEMQSQILWRHKYLAMNSFMACVPEHRFFRFIIDKIESPDA------TSVLFQTGPMWITSLLNLYNK 813
            IPKIIH  YK+  +P  +    + CL ++   K+ILW+D+  YE IK  +P ++  +E Y+      ++ +D  RYF+L  +GG+Y+D D  C++  D ++   + L  T     S           N  M  VP H FF   +  ++  D        +++  TGP++++ +   Y +
Sbjct:   55 IPKIIHQTYKTEDIPEHWKEGRQKCLDLHPDYKYILWTDEMAYEFIKEEYPWFLDTFENYK----YPIERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFLRKTSPLGVS-----------NDVMGSVPRHPFFLKALKSLKHYDKYWFIPYMTIMGSTGPLFLSVIWKQYKR 218          
BLAST of SMED30034433 vs. Ensembl Yeast
Match: CSH1 (Mannosylinositol phosphorylceramide (MIPC) synthase catalytic subunit; forms a complex with regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Sur1p; CSH1 has a paralog, SUR1, that arose from the whole genome duplication [Source:SGD;Acc:S000000365])

HSP 1 Score: 84.3445 bits (207), Expect = 1.447e-18
Identity = 55/206 (26.70%), Postives = 98/206 (47.57%), Query Frame = -3
Query:  232 IPKIIHYVYKSHMVPSQYSPLVKGCLRINKQIKFILWSDDSVYEIIKMYFPQYIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFDTRCQKPFDTVMVNDSCLLSTEVEMQSQILWRHKYLAMNSFMACVPEHRFFRFIIDKIESPDAT------SVLFQTGPMWITSLLNLYNKLINKSNNLSDKIV------LANSSLFS 813
            IPKIIH  YK++ +P Q+    + C+ ++    +ILW+D+     IK  +P ++  +  Y       ++ +D  RYF+L  +GGIY+D D  C++  D ++   + L  T     S           N  M  VP H FF  +I  ++           +++  TGP++I+ +   Y +  N + N + +I+      + N+S FS
Sbjct:   62 IPKIIHQTYKTNDIPEQWVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRSYE----YPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVPAFLRKTSPTGVS-----------NDVMGSVPRHPFFLKVIKSLKHYKKNWYIPYMTIMGSTGPLFISVVWKQYKRWSNTAENGAVRILQPADYKMHNNSFFS 252          
BLAST of SMED30034433 vs. Planmine SMEST
Match: SMESG000077381.1 (SMESG000077381.1)

HSP 1 Score: 682.945 bits (1761), Expect = 0.000e+0
Identity = 330/330 (100.00%), Postives = 330/330 (100.00%), Query Frame = -3
Query:    4 MISYRALFTFCFYFGMFIVMYLFYNFSLDNDWSAKKYPMCTIESPESLLLYGKENTFANGIPKIIHYVYKSHMVPSQYSPLVKGCLRINKQIKFILWSDDSVYEIIKMYFPQYIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFDTRCQKPFDTVMVNDSCLLSTEVEMQSQILWRHKYLAMNSFMACVPEHRFFRFIIDKIESPDATSVLFQTGPMWITSLLNLYNKLINKSNNLSDKIVLANSSLFSPVADPNLEIHCSKRTVRKWKEKACKNLANYRKIENVRIREAFCVHLFMHLGYEDRKRLIKKMENICILYDNINLIE 993
            MISYRALFTFCFYFGMFIVMYLFYNFSLDNDWSAKKYPMCTIESPESLLLYGKENTFANGIPKIIHYVYKSHMVPSQYSPLVKGCLRINKQIKFILWSDDSVYEIIKMYFPQYIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFDTRCQKPFDTVMVNDSCLLSTEVEMQSQILWRHKYLAMNSFMACVPEHRFFRFIIDKIESPDATSVLFQTGPMWITSLLNLYNKLINKSNNLSDKIVLANSSLFSPVADPNLEIHCSKRTVRKWKEKACKNLANYRKIENVRIREAFCVHLFMHLGYEDRKRLIKKMENICILYDNINLIE
Sbjct:    1 MISYRALFTFCFYFGMFIVMYLFYNFSLDNDWSAKKYPMCTIESPESLLLYGKENTFANGIPKIIHYVYKSHMVPSQYSPLVKGCLRINKQIKFILWSDDSVYEIIKMYFPQYIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFDTRCQKPFDTVMVNDSCLLSTEVEMQSQILWRHKYLAMNSFMACVPEHRFFRFIIDKIESPDATSVLFQTGPMWITSLLNLYNKLINKSNNLSDKIVLANSSLFSPVADPNLEIHCSKRTVRKWKEKACKNLANYRKIENVRIREAFCVHLFMHLGYEDRKRLIKKMENICILYDNINLIE 330          
BLAST of SMED30034433 vs. Planmine SMEST
Match: SMESG000077351.1 (SMESG000077351.1)

HSP 1 Score: 311.997 bits (798), Expect = 8.297e-105
Identity = 150/301 (49.83%), Postives = 206/301 (68.44%), Query Frame = -3
Query:    7 DWSAKKY--PMCTIESPESLLLYGKENTFANGIPKIIHYVYKSHMVPSQYSPLVKGCLRINKQIKFILWSDDSVYEIIKMYFPQYIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFDTRCQKPFDTVMVNDSCLLSTEVEMQSQILWRHKYLAMNSFMACVPEHRFFRFIIDKIESPDATSVLFQTGPMWITSLLNLYNKLINKSNNLSDKIVLANSSLFSPVADPNLEIHCSKRTVRKWKEKACKNLANYRKIENVRIREAFCVHLFMHLGYEDRKRLIKKMENICILYDNINLI 903
            D+  ++Y    C + + +SL  +G +N +AN IPKIIHYVY++  +P QY   +K C+ INK  KF+ WSD S ++ I  +F     +Y+ Y NK++ +LKLSDINRYF++ KFGGIY+D DT+CQ+ FD  M NDSC+LS EVE QS+ILW  +YL MNS MACVP H FF+F+++K++  D +SVL QTGP  +T L   YNK+   S N+  K+V AN   FSP+AD  LE+ C+K  + KW+ + CK L N+RKI++V+ +EA  VHLFMHLGY  +K LI K ENIC   +N  L+
Sbjct:   24 DFGDERYRNGKCKLNTMKSLFRFGNKNQYANKIPKIIHYVYRTGYIPVQYLSHIKHCMEINKDAKFVFWSDFSTFQFILNHFQSDRDVYQSYFNKAIYSLKLSDINRYFIILKFGGIYIDMDTKCQQSFDVAMKNDSCILSKEVEEQSKILWNFEYLVMNSLMACVPGHEFFKFVVNKLKVADGSSVLEQTGPFMLTKLFTEYNKVYVNSLNIFQKVVGANPYTFSPLADQFLEMRCNKFEIGKWRIEGCKTLPNHRKIQDVKEKEAIVVHLFMHLGYAHKKHLIVKNENICFSLNNFTLV 324          
BLAST of SMED30034433 vs. Planmine SMEST
Match: SMESG000065880.1 (SMESG000065880.1)

HSP 1 Score: 310.071 bits (793), Expect = 3.836e-104
Identity = 141/290 (48.62%), Postives = 196/290 (67.59%), Query Frame = -3
Query:    7 CTIESPESLLLYGKENTFANGIPKIIHYVYKSHMVPSQYSPLVKGCLRINKQIKFILWSDDSVYEIIKMYFPQYIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFDTRCQKPFDTVMVNDSCLLSTEVEMQSQILWRHKYLAMNSFMACVPEHRFFRFIIDKIESPDATSVLFQTGPMWITSLLNLYNKLINKSNNLSDKIVLANSSLFSPVADPNLEIHCSKRTVRKWKEKACKNLANYRKIENVRIREAFCVHLFMHLGYEDRKRLIKKMENICILYDNINLI 876
            C   S   +L YGK   +ANG+PKIIHYVYK+  +PSQYSP VK CL INK +KFI WSD + Y  +  +F Q   ++  Y +KS+E+LK+SD+ RYF+LFKFGGIYMD DT+CQKP +  M N SC+LS E+  Q++ILW   YLAMNSFMA +P+H FF+++I K+   D+  +L+QTGP ++T+ L  YNKL+    + S  ++LA+S L+SP  +  LE HC    V  WK K CK LA +RK + +R ++AF +HLFMHLGY   K  +  ++ +C  + NI ++
Sbjct:   29 CQTMSTSDILSYGKVQQYANGVPKIIHYVYKTAYIPSQYSPHVKNCLEINKGVKFIFWSDFTTYGFVLKHFQQNAKLFSSYFSKSVESLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLTVADSAHILYQTGPFFMTNALESYNKLVRNVTDQSKLVILADSYLYSPFTERYLEGHCGGNPVGVWKVKGCKTLAEHRKQQKIRTKDAFVIHLFMHLGYNFAKHAVINLDYVCKTFKNITIV 318          
BLAST of SMED30034433 vs. Planmine SMEST
Match: SMESG000077190.1 (SMESG000077190.1)

HSP 1 Score: 308.916 bits (790), Expect = 1.546e-103
Identity = 145/296 (48.99%), Postives = 203/296 (68.58%), Query Frame = -3
Query:    4 KKYPMCTIESPESLLLYGKENTFANGIPKIIHYVYKSHMVPSQYSPLVKGCLRINKQIKFILWSDDSVYEIIKMYFPQYIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFDTRCQKPFDTVMVNDSCLLSTEVEMQSQILWRHKYLAMNSFMACVPEHRFFRFIIDKIESPDATSVLFQTGPMWITSLLNLYNKLINKSNNLSDKIVLANSSLFSPVADPNLEIHCSKRTVRKWKEKACKNLANYRKIENVRIREAFCVHLFMHLGYEDRKRLIKKMENICILYDNINLIE 891
            K++ +C +ES E+L+ YG+ N + NGIPK+IH VY++H +P QY  LV+ C++IN  +KF+ W+D+S   +++ YFP    +Y+ Y N  +E LK SD+NRYF+L KFGGIYMD DTRCQKPF+ VMVN++C+LSTE + QS ILW    +AMNS MAC  +H+FFRFI+  +   +  S+L  TGP+W+T + +LY K++  S+N  D +VLA+S +FSP  DP L + C  R  + WK   C+ L  +RK    +IR+A  VHLFMHLGY +RK LIKK   IC+   N  LI+
Sbjct:   33 KQFNICQVESVETLIEYGQNNQYPNGIPKLIHNVYENHRIPFQYKDLVENCMKINPDVKFVFWTDESAVNLVRQYFPAQFSVYQTYLNSKVEPLKRSDLNRYFILMKFGGIYMDLDTRCQKPFNLVMVNETCILSTENQAQSLILWNQDCIAMNSLMACTSQHKFFRFILKNVRKFENISILELTGPIWLTKMFHLY-KIMKDSHNDKDAVVLADSYMFSPQVDPYLILKCI-RIRKNWKTVGCQKLRLHRKTARKKIRKAIVVHLFMHLGYANRKYLIKKRVKICLKLLNFTLIQ 326          
BLAST of SMED30034433 vs. Planmine SMEST
Match: SMESG000065849.1 (SMESG000065849.1)

HSP 1 Score: 298.901 bits (764), Expect = 9.846e-100
Identity = 138/290 (47.59%), Postives = 192/290 (66.21%), Query Frame = -3
Query:    7 CTIESPESLLLYGKENTFANGIPKIIHYVYKSHMVPSQYSPLVKGCLRINKQIKFILWSDDSVYEIIKMYFPQYIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFDTRCQKPFDTVMVNDSCLLSTEVEMQSQILWRHKYLAMNSFMACVPEHRFFRFIIDKIESPDATSVLFQTGPMWITSLLNLYNKLINKSNNLSDKIVLANSSLFSPVADPNLEIHCSKRTVRKWKEKACKNLANYRKIENVRIREAFCVHLFMHLGYEDRKRLIKKMENICILYDNINLI 876
            C   S   +L YGK   +ANG+PKIIHYVYK+  +PSQYSP VK CL INK  KFILWSD + Y  +  +F Q   ++  Y +KS+E+LK+SD+ RYF+LFKFGGIYMD DT+CQKP +  M   SC+LS E+  Q++ILW   Y AMNSFMA +P+H FF+++I K+   ++  +++QTGP ++T+ L  YNKL+    + S  ++LA+S L+SP  +  LE HC    V  WK K CK LA +RK + +R ++AF +HLFMHLGY   K  +  ++  C    NI ++
Sbjct:   29 CQTMSTSDILSYGKVQQYANGVPKIIHYVYKTAYIPSQYSPHVKNCLEINKGAKFILWSDFTAYGFVLKHFQQNAKLFSSYFSKSVESLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKKGSCILSQEINEQTRILWNAPYAAMNSFMATIPDHEFFKYLIGKLTVANSFEIVYQTGPFFMTNALESYNKLVRNVTDQSKLVILADSYLYSPFTEHYLEGHCYGNPVGDWKVKGCKTLAEHRKQQKIRTKDAFVIHLFMHLGYNFAKHAVINLDYACKTLKNITIV 318          
The following BLAST results are available for this feature:
BLAST of SMED30034433 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034433 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034433 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034433 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034433 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034433 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034433 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P33300|SUR1_YEAST1.104e-1727.93Mannosyl phosphorylinositol ceramide synthase SUR1... [more]
sp|P38287|CSH1_YEAST1.005e-1626.70Mannosyl phosphorylinositol ceramide synthase CSH1... [more]
sp|Q10323|IMT3_SCHPO1.194e-1525.54Inositol phosphoceramide mannosyltransferase 3 OS=... [more]
sp|Q9UT67|IMT2_SCHPO2.409e-1425.13Inositol phosphoceramide mannosyltransferase 2 OS=... [more]
sp|O14084|IMT1_SCHPO3.442e-1225.81Inositol phosphoceramide mannosyltransferase 1 OS=... [more]
back to top
BLAST of SMED30034433 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GMC11.788e-3733.85Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I5579.098e-3733.46Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FUE42.939e-3530.03Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H5Y67.914e-3531.38Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G0Y62.045e-3431.03Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SMED30034433 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034433 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034433 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SUR11.590e-1927.93Mannosylinositol phosphorylceramide (MIPC) synthas... [more]
CSH11.447e-1826.70Mannosylinositol phosphorylceramide (MIPC) synthas... [more]
back to top
BLAST of SMED30034433 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034433 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034433 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077381.10.000e+0100.00SMESG000077381.1[more]
SMESG000077351.18.297e-10549.83SMESG000077351.1[more]
SMESG000065880.13.836e-10448.62SMESG000065880.1[more]
SMESG000077190.11.546e-10348.99SMESG000077190.1[more]
SMESG000065849.19.846e-10047.59SMESG000065849.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034433 ID=SMED30034433|Name=SMED30034433|organism=Schmidtea mediterranea sexual|type=transcript|length=1136bp
TTATTCAATCAAATTAATATTATCATAAAGTATACATATATTTTCCATTT
TTTTGATCAATCTTTTCCTATCCTCATAGCCTAAATGCATAAACAGATGG
ACACAAAAAGCCTCTCGAATCCGGACATTTTCAATTTTTCTATAATTAGC
GAGATTTTTACAAGCTTTTTCTTTCCATTTCCTCACCGTACGTTTTGAAC
AGTGAATTTCAAGATTTGGATCCGCAACCGGTGAAAACAGACTCGAATTC
GCCAAAACTATTTTATCGCTGAGGTTGTTCGACTTATTTATCAACTTATT
GTATAAGTTCAGTAAACTAGTAATCCACATCGGTCCGGTTTGGAAGAGTA
CGGACGTAGCGTCTGGAGATTCAATTTTATCTATGATAAATCGGAAAAAT
CTATGCTCAGGAACGCAGGCCATGAAACTGTTCATTGCTAGATACTTATG
CCGCCATAAAATTTGACTTTGCATTTCAACTTCAGTACTTAAAAGACAAG
AATCATTCACCATGACTGTGTCAAACGGTTTTTGGCACCGAGTATCGAAA
TCCATATAAATCCCTCCGAATTTAAACAATAAAAAATATCTGTTGATATC
GGATAATTTTAGGGCCTCAAGCGATTTATTGCGATAAAATTCATAGATGT
AAATGTATTGGGGGAAATACATTTTGATAATTTCATAGACCGAATCGTCT
GACCACAGAATGAATTTTATTTGTTTGTTAATTCTCAAACAGCCTTTGAC
AAGAGGGGAGTATTGTGATGGCACCATGTGGGATTTGTACACGTAATGGA
TGATTTTTGGTATTCCGTTTGCAAATGTATTTTCTTTACCATATAAAAGG
AGACTTTCTGGCGATTCAATGGTACACATGGGGTATTTCTTCGCACTCCA
ATCATTGTCCAGTGAAAAATTGTAAAATAAATACATGACAATAAACATTC
CAAAATAAAAGCAAAAAGTAAATAAAGCTCTATAAGATATCATTGCCTTA
ATTAGTTTTGCTCATATTATCCGGTGTATATTTCTAAACATATTTCTCCG
TCATTGTATGCGTTAAAATTACTGTAATTAATACGTAAATATTTTGAATG
TTTCTAATCTTTGTCGTAATTAAATGTCAATTATTA
back to top

protein sequence of SMED30034433-orf-1

>SMED30034433-orf-1 ID=SMED30034433-orf-1|Name=SMED30034433-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=331bp
MISYRALFTFCFYFGMFIVMYLFYNFSLDNDWSAKKYPMCTIESPESLLL
YGKENTFANGIPKIIHYVYKSHMVPSQYSPLVKGCLRINKQIKFILWSDD
SVYEIIKMYFPQYIYIYEFYRNKSLEALKLSDINRYFLLFKFGGIYMDFD
TRCQKPFDTVMVNDSCLLSTEVEMQSQILWRHKYLAMNSFMACVPEHRFF
RFIIDKIESPDATSVLFQTGPMWITSLLNLYNKLINKSNNLSDKIVLANS
SLFSPVADPNLEIHCSKRTVRKWKEKACKNLANYRKIENVRIREAFCVHL
FMHLGYEDRKRLIKKMENICILYDNINLIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR007577GlycoTrfase_DXD_sugar-bd_CS
IPR029044Nucleotide-diphossugar_trans