Arp2/3 complex 34 kDa subunit

Overview
NameArp2/3 complex 34 kDa subunit
Smed IDSMED30034430
Length (bp)1414
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Arp2/3 complex 34 kDa subunit (SMED30034430) t-SNE clustered cells

Violin plots show distribution of expression levels for Arp2/3 complex 34 kDa subunit (SMED30034430) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Arp2/3 complex 34 kDa subunit (SMED30034430) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Arp2/3 complex 34 kDa subunit (SMED30034430) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034430

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30034430SMESG000060573.1 Contig5379GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30034430SMESG000060573.1 Contig5379GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30034430SMESG000073809.1 Contig5379GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30034430SMESG000073809.1 Contig5379GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30034430SMESG000073809.1 dd_Smed_v4_693_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30034430SMESG000073809.1 dd_Smed_v4_693_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034430SMESG000073809.1 dd_Smed_v4_693_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034430SMESG000073809.1 dd_Smed_v4_693_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034430SMESG000073809.1 dd_Smed_v4_693_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Human
Match: ARPC2 (actin related protein 2/3 complex subunit 2 [Source:HGNC Symbol;Acc:HGNC:705])

HSP 1 Score: 333.569 bits (854), Expect = 8.763e-112
Identity = 167/284 (58.80%), Postives = 209/284 (73.59%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINNEI-DRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTTSK-QAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKP 918
            MILLE  NR ++E L  KF  A +G K E  +    DFDG +Y I+N   D+  + VSI+L F+K+LQ +GAD++LKR YG  L + PE G NVS+ YDL NLP   + +   A +LKRNCFASVFE +F +QE G   + +AVI+YRDDETMY+++ +DRVTVVFST+FKD DDV+IGKVF+QE  E RR    APQVL+S REPP+ELK T AAVGDNI YITFVLF RH    +AR N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P
Sbjct:    1 MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVN-PESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH-TNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARP 282          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Human
Match: ARPC2 (actin related protein 2/3 complex subunit 2 [Source:HGNC Symbol;Acc:HGNC:705])

HSP 1 Score: 333.569 bits (854), Expect = 8.763e-112
Identity = 167/284 (58.80%), Postives = 209/284 (73.59%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINNEI-DRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTTSK-QAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKP 918
            MILLE  NR ++E L  KF  A +G K E  +    DFDG +Y I+N   D+  + VSI+L F+K+LQ +GAD++LKR YG  L + PE G NVS+ YDL NLP   + +   A +LKRNCFASVFE +F +QE G   + +AVI+YRDDETMY+++ +DRVTVVFST+FKD DDV+IGKVF+QE  E RR    APQVL+S REPP+ELK T AAVGDNI YITFVLF RH    +AR N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P
Sbjct:    1 MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVN-PESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH-TNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARP 282          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Human
Match: ARPC2 (actin related protein 2/3 complex subunit 2 [Source:HGNC Symbol;Acc:HGNC:705])

HSP 1 Score: 140.969 bits (354), Expect = 3.449e-39
Identity = 66/97 (68.04%), Postives = 77/97 (79.38%), Query Frame = 1
Query:  628 EARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKP 918
            E RR    APQVL+S REPP+ELK T AAVGDNI YITFVLF RH    +AR N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P
Sbjct:    2 EGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH-TNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARP 97          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Human
Match: ARPC2 (actin related protein 2/3 complex subunit 2 [Source:HGNC Symbol;Acc:HGNC:705])

HSP 1 Score: 74.7146 bits (182), Expect = 5.568e-16
Identity = 42/90 (46.67%), Postives = 57/90 (63.33%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINN-EIDRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQ 339
            MILLE  NR ++E L  KF  A +G K E  +    DFDG +Y I+N   D+  + VSI+L F+K+LQ +GAD++LKR YG  L + PE 
Sbjct:    1 MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVN-PES 89          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Human
Match: ARPC2 (actin related protein 2/3 complex subunit 2 [Source:HGNC Symbol;Acc:HGNC:705])

HSP 1 Score: 74.3294 bits (181), Expect = 6.356e-16
Identity = 42/90 (46.67%), Postives = 57/90 (63.33%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINN-EIDRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQ 339
            MILLE  NR ++E L  KF  A +G K E  +    DFDG +Y I+N   D+  + VSI+L F+K+LQ +GAD++LKR YG  L + PE 
Sbjct:    1 MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVN-PES 89          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Celegans
Match: arx-4 (Probable actin-related protein 2/3 complex subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:Q8WTM6])

HSP 1 Score: 332.028 bits (850), Expect = 1.206e-111
Identity = 166/300 (55.33%), Postives = 215/300 (71.67%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINN-EIDRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTTS-KQAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKG-TKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKPKITASGVGFETVDFK 963
            MI+LE  NR + E+L QKF  AK G K E       DFDG +YK++N + DR  I +SI+L F+ +LQ++GAD +L+R YG  + S PEQG NV+++Y+L +LP D  +L Q A+ LKRNCFASVFE +F++QE+G    K+AVINYRDDETMYI+A  DRVTV+FST+FKDADDVIIGKVF+QE  E R+    AP VLYS  EPP+ELK   +A VGDN+ YITFVLF RH      + N+IDLIH+FR+YLHYHIKCSK Y+H RMR K+ +FL +L +A+P++      F    F+
Sbjct:    1 MIILEQNNRIIVELLEQKFANAKEGGKPESVNVTFADFDGVLYKLSNPDGDRTKIILSISLKFYTELQQHGADDLLRRVYGGHMRSTPEQGFNVTLEYNLADLPADTTDLVQAASALKRNCFASVFEKYFEFQEAGQEGHKRAVINYRDDETMYIEAKADRVTVIFSTVFKDADDVIIGKVFLQEFREGRKASQTAPAVLYSLGEPPLELKDLPEARVGDNVGYITFVLFPRH-TNKKTKDNTIDLIHSFRDYLHYHIKCSKVYLHTRMRAKTTDFLKVLNRARPEVKGEKKTFHGRTFQ 299          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Fly
Match: Arpc2 (gene:FBgn0032859 transcript:FBtr0346418)

HSP 1 Score: 334.339 bits (856), Expect = 1.923e-112
Identity = 175/324 (54.01%), Postives = 222/324 (68.52%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINN-EIDRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTT-SKQAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKPKITASGVGFETVDFKGVTDLGIEGLGAGDNNQKKTITGRT 1038
            MILLE  NR ++E LL K+  A++G K E     + DFDG +Y I+N   D+  + +SI+L F+KQLQE+GAD++LKREYG  L +  E+G NVS+  +L  +P+D E++A+   LLKRNCFASVFE +FDYQE G    K+AVINYR+DET+Y++A  DRVTVVFST+F+D DDVIIGKVF+QEL E RR    APQVL+S REPP+EL  T A VGDNI Y+TFVLF RH      R N+I+LIH FR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P+                            N +KKTITGRT
Sbjct:    1 MILLEINNRIIEETLLVKYRNAQAGLKPESIDIRIADFDGVLYHISNVNGDKTKVRISISLKFYKQLQEHGADELLKREYGS-LLTDTEEGYNVSVLINLEEIPEDCEQIAKRIGLLKRNCFASVFEKYFDYQEQGEEGQKRAVINYRNDETLYVEAKPDRVTVVFSTIFRDEDDVIIGKVFMQELREGRRASHTAPQVLFSHREPPLELANTDARVGDNIGYVTFVLFPRH-TNKETRDNTINLIHMFRDYLHYHIKCSKAYIHSRMRAKTSDFLKVLNRARPE--------------------------PKNTEKKTITGRT 296          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Fly
Match: Arpc2 (gene:FBgn0032859 transcript:FBtr0081358)

HSP 1 Score: 334.339 bits (856), Expect = 1.923e-112
Identity = 175/324 (54.01%), Postives = 222/324 (68.52%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINN-EIDRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTT-SKQAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKPKITASGVGFETVDFKGVTDLGIEGLGAGDNNQKKTITGRT 1038
            MILLE  NR ++E LL K+  A++G K E     + DFDG +Y I+N   D+  + +SI+L F+KQLQE+GAD++LKREYG  L +  E+G NVS+  +L  +P+D E++A+   LLKRNCFASVFE +FDYQE G    K+AVINYR+DET+Y++A  DRVTVVFST+F+D DDVIIGKVF+QEL E RR    APQVL+S REPP+EL  T A VGDNI Y+TFVLF RH      R N+I+LIH FR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P+                            N +KKTITGRT
Sbjct:    1 MILLEINNRIIEETLLVKYRNAQAGLKPESIDIRIADFDGVLYHISNVNGDKTKVRISISLKFYKQLQEHGADELLKREYGS-LLTDTEEGYNVSVLINLEEIPEDCEQIAKRIGLLKRNCFASVFEKYFDYQEQGEEGQKRAVINYRNDETLYVEAKPDRVTVVFSTIFRDEDDVIIGKVFMQELREGRRASHTAPQVLFSHREPPLELANTDARVGDNIGYVTFVLFPRH-TNKETRDNTINLIHMFRDYLHYHIKCSKAYIHSRMRAKTSDFLKVLNRARPE--------------------------PKNTEKKTITGRT 296          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Zebrafish
Match: arpc2 (actin related protein 2/3 complex, subunit 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5276])

HSP 1 Score: 334.724 bits (857), Expect = 1.579e-112
Identity = 169/284 (59.51%), Postives = 211/284 (74.30%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINNEI-DRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTT-SKQAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKP 918
            MILLE  NR ++E L  KF +A +G K E  +    DFDG +Y I+N   D+  + VSI+L FFK+LQE+GAD++LKR YG+ L + PE G N+S+ +DL  LP + EE+   A +LKRNCFASVFE +F +QE G    K+AV++YRDDE+MYI+A +DRVTVVFST+FKD DDVIIGKVF+QE  E RR    APQVL+S REPP+ELK T AAVGDNI YITFVLF RH      R N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P
Sbjct:    1 MILLEINNRIIEETLSLKFDSASNGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFFKELQEHGADELLKRVYGNFLVA-PEDGYNISLLFDLDALPPNKEEMIHQAGILKRNCFASVFEKYFKFQEEGRDGEKRAVVHYRDDESMYIEAKKDRVTVVFSTVFKDDDDVIIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH-TNANTRDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARP 282          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Xenopus
Match: arpc2 (actin related protein 2/3 complex subunit 2 [Source:NCBI gene;Acc:448094])

HSP 1 Score: 330.102 bits (845), Expect = 1.641e-110
Identity = 165/284 (58.10%), Postives = 208/284 (73.24%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINNEI-DRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTTS-KQAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKP 918
            MILLE  NR ++E L  KF  A +G K E  +    DFDG +Y + N   D+  + VSI+L F+K+LQE+GAD++LK+ YG+ L + PE G NVS+ YDL  LP + + +   A +LKRNCFASVFE +F +QE G    ++AVI+YRDDETMY++A +DRVTVVFST+FKD DDV+IGKVF+QE  E RR    APQVL+S REPP+ELK T AAVGDNI YITFVLF RH      R N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P
Sbjct:    1 MILLEVNNRIIEETLNLKFENAAAGNKPEAVEMTFADFDGVLYHVGNPNGDKGKVMVSISLKFYKELQEHGADEILKKVYGNYLVA-PEPGYNVSLLYDLEVLPSNKDSVVHQAGMLKRNCFASVFEKYFKFQEEGKDGERRAVIHYRDDETMYVEAKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH-TNANTRDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARP 282          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Xenopus
Match: arpc2 (actin related protein 2/3 complex subunit 2 [Source:NCBI gene;Acc:448094])

HSP 1 Score: 329.717 bits (844), Expect = 1.795e-110
Identity = 165/284 (58.10%), Postives = 208/284 (73.24%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINNEI-DRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTTS-KQAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKP 918
            MILLE  NR ++E L  KF  A +G K E  +    DFDG +Y + N   D+  + VSI+L F+K+LQE+GAD++LK+ YG+ L + PE G NVS+ YDL  LP + + +   A +LKRNCFASVFE +F +QE G    ++AVI+YRDDETMY++A +DRVTVVFST+FKD DDV+IGKVF+QE  E RR    APQVL+S REPP+ELK T AAVGDNI YITFVLF RH      R N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P
Sbjct:    1 MILLEVNNRIIEETLNLKFENAAAGNKPEAVEMTFADFDGVLYHVGNPNGDKGKVMVSISLKFYKELQEHGADEILKKVYGNYLVA-PEPGYNVSLLYDLEVLPSNKDSVVHQAGMLKRNCFASVFEKYFKFQEEGKDGERRAVIHYRDDETMYVEAKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH-TNANTRDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARP 282          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Xenopus
Match: arpc2 (actin related protein 2/3 complex subunit 2 [Source:NCBI gene;Acc:448094])

HSP 1 Score: 317.005 bits (811), Expect = 1.491e-105
Identity = 162/284 (57.04%), Postives = 201/284 (70.77%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINNEI-DRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTT-SKQAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKP 918
            MILLE  NR ++E L  KF  A +G K E  +    DFDG +Y + N   D+  + VSI+L F+K+LQE+GAD+V K        S P  G NVS+ YDL  LP + + +   A +LKRNCFASVFE +F +QE G    ++AVI+YRDDETMY++A +DRVTVVFST+FKD DDV+IGKVF+QE  E RR    APQVL+S REPP+ELK T AAVGDNI YITFVLF RH      R N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P
Sbjct:    1 MILLEVNNRIIEETLNLKFENAAAGNKPEAVEMTFADFDGVLYHVGNPNGDKGKVMVSISLKFYKELQEHGADEVSK----SIRMSVPSAGYNVSLLYDLEVLPSNKDSVVHQAGMLKRNCFASVFEKYFKFQEEGKDGERRAVIHYRDDETMYVEAKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH-TNANTRDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARP 279          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Mouse
Match: Arpc2 (actin related protein 2/3 complex, subunit 2 [Source:MGI Symbol;Acc:MGI:1923959])

HSP 1 Score: 332.413 bits (851), Expect = 1.782e-111
Identity = 167/284 (58.80%), Postives = 208/284 (73.24%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINNEI-DRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTTSK-QAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKP 918
            MILLE  NR ++E L  KF  A +G K E  +    DFDG +Y I+N   D+  + VSI+L F+K+LQ +GAD++LKR YG  L + PE G NVS+ YDL NLP   + +   A +LKRNCFASVFE +F +QE G   + +AVI+YRDDETMY+++ +DRVTVVFST+FKD DDV+IGKVF+QE  E RR    APQVL+S REPP+ELK T AAVGDNI YITFVLF RH     AR N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P
Sbjct:    1 MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVN-PEPGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH-TNATARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARP 282          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Mouse
Match: Arpc2 (actin related protein 2/3 complex, subunit 2 [Source:MGI Symbol;Acc:MGI:1923959])

HSP 1 Score: 332.413 bits (851), Expect = 1.782e-111
Identity = 167/284 (58.80%), Postives = 208/284 (73.24%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINNEI-DRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTTSK-QAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKP 918
            MILLE  NR ++E L  KF  A +G K E  +    DFDG +Y I+N   D+  + VSI+L F+K+LQ +GAD++LKR YG  L + PE G NVS+ YDL NLP   + +   A +LKRNCFASVFE +F +QE G   + +AVI+YRDDETMY+++ +DRVTVVFST+FKD DDV+IGKVF+QE  E RR    APQVL+S REPP+ELK T AAVGDNI YITFVLF RH     AR N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P
Sbjct:    1 MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVN-PEPGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH-TNATARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARP 282          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Mouse
Match: Arpc2 (actin related protein 2/3 complex, subunit 2 [Source:MGI Symbol;Acc:MGI:1923959])

HSP 1 Score: 311.612 bits (797), Expect = 1.228e-103
Identity = 154/258 (59.69%), Postives = 192/258 (74.42%), Query Frame = 1
Query:  151 KIEKSKQCLVDFDGAVYKINNEI-DRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTTSK-QAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKP 918
            K E  +    DFDG +Y I+N   D+  + VSI+L F+K+LQ +GAD++LKR YG  L + PE G NVS+ YDL NLP   + +   A +LKRNCFASVFE +F +QE G   + +AVI+YRDDETMY+++ +DRVTVVFST+FKD DDV+IGKVF+QE  E RR    APQVL+S REPP+ELK T AAVGDNI YITFVLF RH     AR N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P
Sbjct:   11 KPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVN-PEPGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH-TNATARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARP 266          
BLAST of Arp2/3 complex 34 kDa subunit vs. UniProt/SwissProt
Match: sp|Q0IH88|ARC2A_XENLA (Actin-related protein 2/3 complex subunit 2-A OS=Xenopus laevis OX=8355 GN=arpc2-a PE=2 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 1.690e-111
Identity = 167/284 (58.80%), Postives = 211/284 (74.30%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINNEI-DRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTT-SKQAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKP 918
            MILLE  NR ++EIL  KF  A +G K E  +    DFDG +Y ++N   D+  + +SI+L F+K+LQE+G D+VLK+ YG+ L + PE G NVS+ YDL +LP + + +   A +LKRNCFASVFE +F +QE G    K+AVI+YRDDETMY++A +DRVTVVFST+FKD DDV+IGKVF+QE  E RR    APQVL+S REPP+ELK T AAVGDNI YITFVLF RH     AR N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P
Sbjct:    1 MILLEVNNRIIEEILTLKFENAAAGNKPEAVEVTFADFDGVLYHVSNPNGDKAKVLISISLKFYKELQEHGTDEVLKKVYGNFLVA-PESGYNVSLLYDLESLPSNKDSVIHQAGMLKRNCFASVFEKYFKFQEEGKDGEKRAVIHYRDDETMYVEAKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH-TNANARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARP 282          
BLAST of Arp2/3 complex 34 kDa subunit vs. UniProt/SwissProt
Match: sp|Q9VIM5|ARPC2_DROME (Actin-related protein 2/3 complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=Arpc2 PE=2 SV=2)

HSP 1 Score: 334.339 bits (856), Expect = 1.928e-111
Identity = 175/324 (54.01%), Postives = 222/324 (68.52%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINN-EIDRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTT-SKQAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKPKITASGVGFETVDFKGVTDLGIEGLGAGDNNQKKTITGRT 1038
            MILLE  NR ++E LL K+  A++G K E     + DFDG +Y I+N   D+  + +SI+L F+KQLQE+GAD++LKREYG  L +  E+G NVS+  +L  +P+D E++A+   LLKRNCFASVFE +FDYQE G    K+AVINYR+DET+Y++A  DRVTVVFST+F+D DDVIIGKVF+QEL E RR    APQVL+S REPP+EL  T A VGDNI Y+TFVLF RH      R N+I+LIH FR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P+                            N +KKTITGRT
Sbjct:    1 MILLEINNRIIEETLLVKYRNAQAGLKPESIDIRIADFDGVLYHISNVNGDKTKVRISISLKFYKQLQEHGADELLKREYGS-LLTDTEEGYNVSVLINLEEIPEDCEQIAKRIGLLKRNCFASVFEKYFDYQEQGEEGQKRAVINYRNDETLYVEAKPDRVTVVFSTIFRDEDDVIIGKVFMQELREGRRASHTAPQVLFSHREPPLELANTDARVGDNIGYVTFVLFPRH-TNKETRDNTINLIHMFRDYLHYHIKCSKAYIHSRMRAKTSDFLKVLNRARPE--------------------------PKNTEKKTITGRT 296          
BLAST of Arp2/3 complex 34 kDa subunit vs. UniProt/SwissProt
Match: sp|Q3MHR7|ARPC2_BOVIN (Actin-related protein 2/3 complex subunit 2 OS=Bos taurus OX=9913 GN=ARPC2 PE=1 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 2.638e-111
Identity = 167/284 (58.80%), Postives = 209/284 (73.59%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINNEI-DRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTTSK-QAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKP 918
            MILLE  NR ++E L  KF  A +G K E  +    DFDG +Y I+N   D+  + VSI+L F+K+LQ +GAD++LKR YG  L + PE G NVS+ YDL NLP   + +   A +LKRNCFASVFE +F +QE G   + +AVI+YRDDETMY+++ +DRVTVVFST+FKD DDV+IGKVF+QE  E RR    APQVL+S REPP+ELK T AAVGDNI YITFVLF RH    +AR N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P
Sbjct:    1 MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSYLVN-PESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH-TNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARP 282          
BLAST of Arp2/3 complex 34 kDa subunit vs. UniProt/SwissProt
Match: sp|Q5R5Z5|ARPC2_PONAB (Actin-related protein 2/3 complex subunit 2 OS=Pongo abelii OX=9601 GN=ARPC2 PE=2 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 4.208e-111
Identity = 167/284 (58.80%), Postives = 209/284 (73.59%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINNEI-DRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTTSK-QAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKP 918
            MILLE  NR ++E L  KF  A +G K E  +    DFDG +Y I+N   D+  + VSI+L F+K+LQ +GAD++LKR YG  L + PE G NVS+ YDL NLP   + +   A +LKRNCFASVFE +F +QE G   + +AVI+YRDDETMY+++ +DRVTVVFST+FKD DDV+IGKVF+QE  E RR    APQVL+S REPP+ELK T AAVGDNI YITFVLF RH    +AR N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P
Sbjct:    1 MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVN-PESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH-TNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARP 282          
BLAST of Arp2/3 complex 34 kDa subunit vs. UniProt/SwissProt
Match: sp|O15144|ARPC2_HUMAN (Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens OX=9606 GN=ARPC2 PE=1 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 4.208e-111
Identity = 167/284 (58.80%), Postives = 209/284 (73.59%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINNEI-DRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTTSK-QAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKP 918
            MILLE  NR ++E L  KF  A +G K E  +    DFDG +Y I+N   D+  + VSI+L F+K+LQ +GAD++LKR YG  L + PE G NVS+ YDL NLP   + +   A +LKRNCFASVFE +F +QE G   + +AVI+YRDDETMY+++ +DRVTVVFST+FKD DDV+IGKVF+QE  E RR    APQVL+S REPP+ELK T AAVGDNI YITFVLF RH    +AR N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P
Sbjct:    1 MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVN-PESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH-TNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARP 282          
BLAST of Arp2/3 complex 34 kDa subunit vs. TrEMBL
Match: A0A4E0R694 (Arp2/3 complex 34 kDa subunit OS=Fasciola hepatica OX=6192 GN=D915_006618 PE=3 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 4.283e-121
Identity = 175/293 (59.73%), Postives = 223/293 (76.11%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINN-EIDRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESG---TTSKQAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKPKITASGV 939
            MI LE  NRGV+E+LL KF +AK G K EK    L DFDG +Y+++    D++ I +SI+LNF+++LQEYGAD++L+REYG+ LC +PE G +VS+ YDL  +P D   LA+  ALLKRNCFA+VFE FF++  SG     SK+AVI+YR DET+Y++A+ DRVTV+FST+FKD DDV+IGKVF+QELTE RRR+DRAPQVLYS   PP EL+GT AAVGDN+AY+TFVLF RH    AA + +I+LIH  RNYLHYHIKCSK YIH RMR K+  F+ +L +A P+ T S V
Sbjct:    1 MIFLEIHNRGVEELLLLKFESAKQGLKYEKFDYVLADFDGVLYRLHTVHNDKSKILISISLNFYRELQEYGADELLRREYGEHLCEKPENGASVSLIYDLEAIPTDYGALARQIALLKRNCFAAVFERFFEFHVSGEEAAGSKRAVIHYRADETLYVQALADRVTVIFSTVFKDPDDVVIGKVFLQELTEVRRRIDRAPQVLYSQGTPPTELQGTDAAVGDNVAYVTFVLFPRHLTESAAPR-TINLIHMLRNYLHYHIKCSKGYIHRRMRAKTTEFIKILNRAHPQYTVSPV 292          
BLAST of Arp2/3 complex 34 kDa subunit vs. TrEMBL
Match: A0A504YMX2 (Arp2/3 complex 34 kDa subunit OS=Fasciola gigantica OX=46835 GN=FGIG_06270 PE=3 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 8.588e-121
Identity = 174/293 (59.39%), Postives = 222/293 (75.77%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINN-EIDRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQ---ESGTTSKQAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKPKITASGV 939
            MI LE  NRGV+E+LL KF +AK G K EK    L DFDG +Y+++    D++ I +SI+LNF+++LQEYGAD++L+REYG+ LC +PE G +VS+ YDL  +P D   LA+  ALLKRNCFA+VFE FF++    E    SK+AVI+YR DET+Y++A+ DRVTV+FST+FKD DDV+IGKVF+QELTE RRR+DRAPQVLYS   PP EL+GT AAVGDN+AY+TFVLF RH    AA + +I+LIH  RNYLHYHIKCSK YIH RMR K+  F+ +L +A P+ T S V
Sbjct:    1 MIFLEIHNRGVEELLLLKFESAKQGLKYEKFDYVLADFDGVLYRLHTVHNDKSKILISISLNFYRELQEYGADELLRREYGEHLCEKPENGASVSLIYDLEAIPTDYGALARQIALLKRNCFAAVFERFFEFHVLGEEAVGSKRAVIHYRTDETLYVQALADRVTVIFSTVFKDPDDVVIGKVFLQELTEVRRRIDRAPQVLYSQGTPPTELQGTDAAVGDNVAYVTFVLFPRHLTESAAPR-TINLIHMLRNYLHYHIKCSKGYIHRRMRAKTTEFIKILNRAHPQYTVSPV 292          
BLAST of Arp2/3 complex 34 kDa subunit vs. TrEMBL
Match: A0A5J4NM50 (Arp2/3 complex 34 kDa subunit OS=Paragonimus westermani OX=34504 GN=DEA37_0010776 PE=3 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 1.272e-119
Identity = 178/294 (60.54%), Postives = 224/294 (76.19%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINN-EIDRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQE--SGTTS--KQAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKPKITASGV 939
            MI LE  NR V+E+L+ KF  AK G K EK    L DFDG VY++++   D++ I VSI+LNFF +LQE+GAD++L+REYG  LCSQPEQGC+VS+ YDL +LP D E+LA+ A+LLKRNCFA+VFE FF++     GT    K+AVI+ R DET+YI+A  DRVTV+FST+FKD DDVIIGKVF+QEL E RRR+DRAPQVLYS   PP EL GT+AA+GDN+AYITFVLF RH  TPAA   +I+LI++ RNYLHYHIKC K YIH RMR K+  F+ +L +A+P+ +   V
Sbjct:    1 MIFLELHNRAVEELLIVKFEHAKHGLKHEKLDHILADFDGVVYRVHSLPSDKSKIVVSISLNFFPELQEHGADELLQREYGVHLCSQPEQGCSVSLVYDLDHLPVDHEQLARQASLLKRNCFAAVFERFFEFHALCEGTAEGLKRAVIHNRTDETLYIQAQADRVTVIFSTIFKDPDDVIIGKVFLQELNEVRRRIDRAPQVLYSQGSPPAELMGTEAAIGDNVAYITFVLFPRHL-TPAAVPRTINLIYSLRNYLHYHIKCCKGYIHRRMRAKTVEFIKILNRAQPQYSTMPV 293          
BLAST of Arp2/3 complex 34 kDa subunit vs. TrEMBL
Match: A0A3Q0KL93 (Putative arp2/3 OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 357.836 bits (917), Expect = 1.908e-116
Identity = 174/288 (60.42%), Postives = 218/288 (75.69%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINN-EIDRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQ----ESGTTSKQAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKPK 921
            MI LE FNR V+E LL +F  AK+G K EK  Q L DFDGA+Y + +   DR+ I VSITLNFF++LQE+GA++VL+REYG  L ++PE GC+VS+ YDL +LP++   +AQ AALLKRNCFA+VFE FF++     E     K+AVI+YR DET+YI A+ DRVTV+FST+FK++DD+II KVF+QELTE RRR DRAPQVLYS   PP EL GT AAVG+N+AYITFVLF RH  TP A   +I+LIH  RNYLHYHIKCSK YIH RM  K+  F+ +L +A+P+
Sbjct:    1 MIFLEIFNRAVEETLLYRFENAKNGLKFEKFNQTLADFDGAIYHLRSVPNDRSKILVSITLNFFQELQEHGANEVLRREYGQYLLNKPEDGCSVSLLYDLEHLPENYALIAQKAALLKRNCFAAVFEKFFEFHASMGEEAVGCKKAVIHYRPDETLYISALADRVTVIFSTVFKESDDLIIAKVFLQELTEVRRRFDRAPQVLYSQSVPPSELIGTDAAVGENVAYITFVLFPRHL-TPQASPRTINLIHILRNYLHYHIKCSKGYIHRRMHAKTFEFIKILNRARPQ 287          
BLAST of Arp2/3 complex 34 kDa subunit vs. TrEMBL
Match: V4BB72 (Arp2/3 complex 34 kDa subunit OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_220774 PE=3 SV=1)

HSP 1 Score: 349.747 bits (896), Expect = 4.612e-115
Identity = 179/324 (55.25%), Postives = 228/324 (70.37%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINN-EIDRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTTSKQ-AVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKPKITASGVGFETVDFKGVTDLGIEGLGAGDNNQKKTITGRT 1038
            MILLE+ NR V+E L+ KF  A+ G+K +       DFDG +Y I+N + D+N + VSI+L F+  LQ +GAD ++KREY D L S PE G NVS+ Y+L ++P D EE+A+ AALLKRNCFASVFE +FDYQ+ GT  ++ AVI+YRDDETMY++A +DRVTV+FST+FKD DDV+IGKVF+QE  E RR+  +APQVL+S REPP EL+ T A  GDNI YITFVLF RH  +PAAR N+I+LIHT R+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P+                              +KKTITGRT
Sbjct:    1 MILLEFHNRIVQETLISKFKNAQEGSKPDTVDVTCADFDGVLYHISNPDGDKNKLLVSISLKFYTDLQAHGADTLIKREYCDYLTS-PEAGYNVSLLYNLESVPQDYEEVAKKAALLKRNCFASVFEKYFDYQQKGTEGRERAVIHYRDDETMYVEAKKDRVTVIFSTIFKDNDDVVIGKVFMQEFKEGRRKYQQAPQVLFSHREPPQELQDTDARTGDNICYITFVLFPRH-TSPAARDNTINLIHTLRDYLHYHIKCSKAYIHQRMRAKTSDFLKVLNRARPE--------------------------NKEKEKKTITGRT 296          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Cavefish
Match: ARPC2 (actin related protein 2/3 complex subunit 2 [Source:NCBI gene;Acc:103022959])

HSP 1 Score: 337.421 bits (864), Expect = 1.413e-113
Identity = 170/284 (59.86%), Postives = 212/284 (74.65%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINN-EIDRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTTSKQ-AVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKP 918
            MILLE  NR ++E L  KF +A +G K E  +    DFDG +Y I+N + D+  I VSI+L F+K+LQE+GAD++LKR YG+ L + PE G NVS+ +DL  LP + EEL   A +LKRNCFASVFE +F +QE G   +Q AV++YRDDE+MY++A +DRVTVVFST+FKD DDVIIGKVF+QE  E RR    APQVL+S REPP+ELK T AAVGDNI YITFVLF RH      R N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P
Sbjct:    1 MILLEINNRIIEETLSLKFESASNGNKPEAVEVTFADFDGVLYHISNPDGDKTKIMVSISLKFYKELQEHGADELLKRVYGNFLVA-PEAGYNVSLLFDLDTLPANKEELVHQAGMLKRNCFASVFEKYFKFQEEGKEGEQRAVVHYRDDESMYLEAKKDRVTVVFSTVFKDDDDVIIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH-TNANTRDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARP 282          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Cavefish
Match: arpc2 (actin-related protein 2/3 complex subunit 2-like [Source:NCBI gene;Acc:103022001])

HSP 1 Score: 330.102 bits (845), Expect = 8.204e-111
Identity = 167/284 (58.80%), Postives = 208/284 (73.24%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINNEI-DRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTTSKQ-AVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKP 918
            MILLE  NR V+E L  K  +A  G K E  +    DFDG +Y I+N   D+  + +SI+L F+K+LQE+GAD++LKR YG+ L    E G NVS+ +DL NLP + EE    A +LKRNCFASVFE +F +QE G   +Q AV++YRDDE+MY++A +DRVTVVFST+FKD DDV+IGKVF+QE  E RR    APQVL+S REPP+ELK T AAVGDNI YITFVLF RH     AR N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P
Sbjct:    1 MILLEINNRIVEETLSLKLESAAGGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMISISLKFYKELQEHGADELLKRVYGNLLVPA-EDGYNVSLLFDLDNLPANKEEAVHQAGMLKRNCFASVFEKYFKFQEEGREGEQRAVVHYRDDESMYLEAKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH-TNANARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARP 282          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Cavefish
Match: arpc2 (actin-related protein 2/3 complex subunit 2-like [Source:NCBI gene;Acc:103022001])

HSP 1 Score: 327.791 bits (839), Expect = 5.823e-110
Identity = 167/284 (58.80%), Postives = 209/284 (73.59%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINNEI-DRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTTSKQ-AVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKP 918
            MILLE  NR V+E L  K  +A  G  +     C+VDFDG +Y I+N   D+  + +SI+L F+K+LQE+GAD++LKR YG+ L    E G NVS+ +DL NLP + EE    A +LKRNCFASVFE +F +QE G   +Q AV++YRDDE+MY++A +DRVTVVFST+FKD DDV+IGKVF+QE  E RR    APQVL+S REPP+ELK T AAVGDNI YITFVLF RH     AR N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P
Sbjct:    1 MILLEINNRIVEETLSLKLESAAGGCFV----YCVVDFDGVLYHISNPNGDKTKVMISISLKFYKELQEHGADELLKRVYGNLLVP-AEDGYNVSLLFDLDNLPANKEEAVHQAGMLKRNCFASVFEKYFKFQEEGREGEQRAVVHYRDDESMYLEAKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH-TNANARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARP 278          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Sea Lamprey
Match: arpc2 (actin related protein 2/3 complex, subunit 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5276])

HSP 1 Score: 325.865 bits (834), Expect = 1.054e-109
Identity = 171/301 (56.81%), Postives = 212/301 (70.43%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINNEI-DRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTTSK-QAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKPKI------TASGVGFET 951
            MILLE  NR ++E L  KF  A +G K +       DFDG +Y I+N   D++ + VSI+L F+ +LQ+Y ADK+LKREYG  L  +PE G NVS+ YDL N+  +  E    A LLKRNCFASVFE +F++QE G   + +AVI+YRDDETMY++A  DRVTVVFST+FKD DDV+IGKVF+QE  E RR    APQVL++ R+PP+ELK T AAVGDNI YITFVLF RH     AR N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P        T SG  F T
Sbjct:    1 MILLEINNRIIEETLTLKFDNALAGNKPDSVDITFADFDGVLYHISNPGGDKSKVMVSISLKFYAELQKYDADKLLKREYGSYLV-EPESGYNVSLLYDLDNVSANKAEDISRAGLLKRNCFASVFEKYFEFQEKGMEGENRAVIHYRDDETMYVEAKRDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASQTAPQVLFNHRDPPLELKDTDAAVGDNIGYITFVLFPRH-TNAKARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTMSGKTFAT 299          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Yeast
Match: ARC35 (Subunit of the ARP2/3 complex; ARP2/3 is required for the motility and integrity of cortical actin patches; required for cortical localization of calmodulin [Source:SGD;Acc:S000005318])

HSP 1 Score: 153.68 bits (387), Expect = 3.965e-43
Identity = 107/318 (33.65%), Postives = 163/318 (51.26%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINNEI-DRNIIFVSITLNFFKQLQEYGAD------KVLKREY----GDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEM----FFDYQESGTTSKQA----------------VINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRR---VDRAPQVLYSSREPPVELK---GTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAK 915
            M+ L+  N  +++ L +   A + G+ +   +  + DFD   Y I+N   D++I+ +S+    +  + E   D      K L   Y    G  + S+ E G + ++Q  L  L   ++E     ++LK    +  FE+    F +  +      +A                 I YRD+E ++IK   DRVT++F T+F+D  D I GKVF+QE  +AR+R   +  APQVLYS  EPP+ELK           +  +ITFVLF RHF T   + +SI  +  FRNY HYHIKCSKAY+H RMR +  +F+ +L +AK
Sbjct:    1 MLHLQPQNLLIQKTLNEAIEALRKGSPLTMDR-IVSDFDYTTYHISNTAEDKSILLLSVKTKAWVSVSECQLDGSLTLLKFLADHYSSLGGVTIPSEVEPGYDYTLQITLAEL---VQESILQLSVLKTIILSFPFELAISKFIELSQQQPAPVEAEITGGEVAANGDNTLFTIKYRDEENIFIKPSNDRVTIIFETIFQDETDKIFGKVFLQEFVDARKRNRQIQSAPQVLYS-HEPPLELKRLYQPPKVAEQSRRFITFVLFPRHFQTKELQFHSICQLTLFRNYFHYHIKCSKAYMHSRMRFRVDSFIKVLNRAK 313          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Nematostella
Match: EDO43583 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY65])

HSP 1 Score: 308.916 bits (790), Expect = 7.199e-103
Identity = 156/287 (54.36%), Postives = 211/287 (73.52%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINN-EIDRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIE--ELAQNAALLKRNCFASVFEMFFDYQESGTTSKQ-AVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKPK 921
            MILLE  NR +++ L  KF    SG K E  +  + DFDG  + I+N + +++ + VSIT+ F+K LQ+YGAD++LK  Y D + S PE G +VS+ +DL N P + E  ++    A+LKRNCFASVFE +FDYQ +G+  +Q AVI+YRDDET+Y++A EDRVTV+FST+FKD DD+II KVF+QE  E RR    APQVL+S ++PP EL+GT A+ G+NIAYITFVL  RH   P AR+ +I+LIHTFRNYLHYHIKCSKAY+H RMR ++ +F+ +L +A+P+
Sbjct:    1 MILLEINNRIIEDTLRAKF----SGGKFESVEVTIADFDGVQFHISNPDGEKSKLRVSITMKFYKDLQKYGADELLKNIYKDYITS-PEDGYDVSLLFDLENPPPESEREQVINKVAMLKRNCFASVFEKYFDYQAAGSGGEQHAVIHYRDDETLYLQATEDRVTVIFSTVFKDDDDIIISKVFMQEFKEGRRASQTAPQVLFSHKDPPRELQGTGASTGENIAYITFVLEPRH-TNPKAREGTINLIHTFRNYLHYHIKCSKAYLHTRMRARTADFIKILNRARPE 281          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Medaka
Match: arpc2 (actin related protein 2/3 complex subunit 2 [Source:NCBI gene;Acc:101160966])

HSP 1 Score: 328.561 bits (841), Expect = 3.272e-110
Identity = 167/284 (58.80%), Postives = 209/284 (73.59%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINNEI-DRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTTSK-QAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKP 918
            MILLE  NR ++E L  KF  A +G K E       DFDG +Y I+N   D+  + VSI+L F+K+LQE+GAD++LKR YG+ L S  E G NVS+ YDL  LP + +++   A +LKRNCFASVFE +F +QE G   + +AV++YRDDE+MY++A +DRVTVVFST+FKD DDVIIGKVF+QE  E RR    APQVL+S REPP+ELK T AAVGDNI YITFVLF RH     AR N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P
Sbjct:    1 MILLEVNNRIIEETLTLKFDGASNGTKPEAVDVTFADFDGVLYHISNPNGDKTKLMVSISLKFYKELQEHGADELLKRIYGNFLVST-EAGYNVSLLYDLEALPANKDDVIHQAGMLKRNCFASVFEKYFKFQEEGREGESRAVVHYRDDESMYVEAKKDRVTVVFSTVFKDDDDVIIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH-TNANARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARP 282          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Medaka
Match: arpc2 (actin related protein 2/3 complex subunit 2 [Source:NCBI gene;Acc:101160966])

HSP 1 Score: 319.316 bits (817), Expect = 1.721e-106
Identity = 165/289 (57.09%), Postives = 210/289 (72.66%), Query Frame = 1
Query:   73 MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLV-----DFDGAVYKINNEI-DRNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLTNLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTTSK-QAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKP 918
            MILLE  NR ++E L  KF  A +G +     +  +     DFDG +Y I+N   D+  + VSI+L F+K+LQE+GAD++LKR YG+ L S  E G NVS+ YDL  LP + +++   A +LKRNCFASVFE +F +QE G   + +AV++YRDDE+MY++A +DRVTVVFST+FKD DDVIIGKVF+QE  E RR    APQVL+S REPP+ELK T AAVGDNI YITFVLF RH     AR N+I+LIHTFR+YLHYHIKCSKAYIH RMR K+ +FL +L +A+P
Sbjct:    1 MILLEVNNRIIEETLTLKFDGASNGPEETLPARLTLLFTPADFDGVLYHISNPNGDKTKLMVSISLKFYKELQEHGADELLKRIYGNFLVST-EAGYNVSLLYDLEALPANKDDVIHQAGMLKRNCFASVFEKYFKFQEEGREGESRAVVHYRDDESMYVEAKKDRVTVVFSTVFKDDDDVIIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRH-TNANARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARP 287          
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Medaka
Match: ENSORLT00000041427.1 (pep primary_assembly:ASM223467v1:2:6027746:6031587:1 gene:ENSORLG00000000213.2 transcript:ENSORLT00000041427.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 1.599e-25
Identity = 48/75 (64.00%), Postives = 58/75 (77.33%), Query Frame = 1
Query:  523 MYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFV 747
            MY++A ++RV V+FST+FKD DDVIIGKVF+      RR    APQVL+S REPP+EL+ T AAVGDNI YITFV
Sbjct:    1 MYVEATKERVMVLFSTVFKDEDDVIIGKVFMSS-RRGRRASHTAPQVLFSHREPPLELEDTDAAVGDNIGYITFV 74          
BLAST of Arp2/3 complex 34 kDa subunit vs. Planmine SMEST
Match: SMESG000073809.1 (SMESG000073809.1)

HSP 1 Score: 409.453 bits (1051), Expect = 1.287e-143
Identity = 196/196 (100.00%), Postives = 196/196 (100.00%), Query Frame = 1
Query:  451 MFFDYQESGTTSKQAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKPKITASGVGFETVDFKGVTDLGIEGLGAGDNNQKKTITGRT 1038
            MFFDYQESGTTSKQAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKPKITASGVGFETVDFKGVTDLGIEGLGAGDNNQKKTITGRT
Sbjct:    1 MFFDYQESGTTSKQAVINYRDDETMYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYSSREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNYLHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKPKITASGVGFETVDFKGVTDLGIEGLGAGDNNQKKTITGRT 196          
The following BLAST results are available for this feature:
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARPC28.763e-11258.80actin related protein 2/3 complex subunit 2 [Sourc... [more]
ARPC28.763e-11258.80actin related protein 2/3 complex subunit 2 [Sourc... [more]
ARPC23.449e-3968.04actin related protein 2/3 complex subunit 2 [Sourc... [more]
ARPC25.568e-1646.67actin related protein 2/3 complex subunit 2 [Sourc... [more]
ARPC26.356e-1646.67actin related protein 2/3 complex subunit 2 [Sourc... [more]
back to top
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
arx-41.206e-11155.33Probable actin-related protein 2/3 complex subunit... [more]
back to top
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Arpc21.923e-11254.01gene:FBgn0032859 transcript:FBtr0346418[more]
Arpc21.923e-11254.01gene:FBgn0032859 transcript:FBtr0081358[more]
back to top
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
arpc21.579e-11259.51actin related protein 2/3 complex, subunit 2 [Sour... [more]
back to top
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
arpc21.641e-11058.10actin related protein 2/3 complex subunit 2 [Sourc... [more]
arpc21.795e-11058.10actin related protein 2/3 complex subunit 2 [Sourc... [more]
arpc21.491e-10557.04actin related protein 2/3 complex subunit 2 [Sourc... [more]
back to top
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Arpc21.782e-11158.80actin related protein 2/3 complex, subunit 2 [Sour... [more]
Arpc21.782e-11158.80actin related protein 2/3 complex, subunit 2 [Sour... [more]
Arpc21.228e-10359.69actin related protein 2/3 complex, subunit 2 [Sour... [more]
back to top
BLAST of Arp2/3 complex 34 kDa subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0IH88|ARC2A_XENLA1.690e-11158.80Actin-related protein 2/3 complex subunit 2-A OS=X... [more]
sp|Q9VIM5|ARPC2_DROME1.928e-11154.01Actin-related protein 2/3 complex subunit 2 OS=Dro... [more]
sp|Q3MHR7|ARPC2_BOVIN2.638e-11158.80Actin-related protein 2/3 complex subunit 2 OS=Bos... [more]
sp|Q5R5Z5|ARPC2_PONAB4.208e-11158.80Actin-related protein 2/3 complex subunit 2 OS=Pon... [more]
sp|O15144|ARPC2_HUMAN4.208e-11158.80Actin-related protein 2/3 complex subunit 2 OS=Hom... [more]
back to top
BLAST of Arp2/3 complex 34 kDa subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0R6944.283e-12159.73Arp2/3 complex 34 kDa subunit OS=Fasciola hepatica... [more]
A0A504YMX28.588e-12159.39Arp2/3 complex 34 kDa subunit OS=Fasciola gigantic... [more]
A0A5J4NM501.272e-11960.54Arp2/3 complex 34 kDa subunit OS=Paragonimus weste... [more]
A0A3Q0KL931.908e-11660.42Putative arp2/3 OS=Schistosoma mansoni OX=6183 PE=... [more]
V4BB724.612e-11555.25Arp2/3 complex 34 kDa subunit OS=Lottia gigantea O... [more]
back to top
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ARPC21.413e-11359.86actin related protein 2/3 complex subunit 2 [Sourc... [more]
arpc28.204e-11158.80actin-related protein 2/3 complex subunit 2-like [... [more]
arpc25.823e-11058.80actin-related protein 2/3 complex subunit 2-like [... [more]
back to top
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
arpc21.054e-10956.81actin related protein 2/3 complex, subunit 2 [Sour... [more]
back to top
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ARC353.965e-4333.65Subunit of the ARP2/3 complex; ARP2/3 is required ... [more]
back to top
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO435837.199e-10354.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Arp2/3 complex 34 kDa subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
arpc23.272e-11058.80actin related protein 2/3 complex subunit 2 [Sourc... [more]
arpc21.721e-10657.09actin related protein 2/3 complex subunit 2 [Sourc... [more]
ENSORLT00000041427.11.599e-2564.00pep primary_assembly:ASM223467v1:2:6027746:6031587... [more]
back to top
BLAST of Arp2/3 complex 34 kDa subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000073809.11.287e-143100.00SMESG000073809.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034430 ID=SMED30034430|Name=Arp2/3 complex 34 kDa subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1414bp
TTTAATTATTGTGCATTTAATTTTGTTTATAAATTTTGAATTTATAGTTC
CGTGTATTGTTTTCTCCAAAACATGATCCTTCTTGAGTATTTCAATAGAG
GAGTGAAAGAAATTCTTTTACAAAAATTCACAGCAGCAAAATCTGGAGCA
AAAATTGAAAAAAGTAAACAATGTTTGGTTGATTTTGATGGAGCTGTTTA
TAAAATAAATAATGAGATTGACAGAAATATTATATTTGTTAGTATAACCC
TTAATTTTTTCAAACAATTGCAGGAATATGGTGCAGATAAAGTTTTAAAA
CGGGAATATGGTGATAGATTATGTAGTCAACCTGAACAAGGATGCAATGT
AAGCATTCAATATGATTTAACAAATTTGCCCGATGACATAGAGGAATTGG
CTCAAAATGCAGCACTTTTGAAAAGAAATTGTTTTGCTTCAGTTTTTGAA
ATGTTTTTTGATTATCAAGAATCTGGAACTACTAGCAAACAGGCCGTGAT
TAATTATCGTGACGATGAAACGATGTACATTAAGGCAATGGAAGATCGTG
TTACTGTGGTTTTTAGTACATTGTTCAAAGATGCTGACGACGTTATAATT
GGAAAAGTTTTCATTCAGGAGCTCACTGAGGCAAGAAGAAGAGTCGATAG
GGCTCCTCAAGTGCTCTATTCATCAAGAGAACCTCCAGTAGAGTTAAAGG
GAACTAAAGCTGCAGTTGGTGATAATATAGCTTATATAACTTTTGTTTTG
TTTAATCGCCATTTTGCTACTCCAGCAGCTCGAAAAAACTCAATTGATTT
GATACATACATTCCGAAATTATTTACATTATCATATTAAGTGCAGTAAAG
CTTATATTCACATGAGAATGCGAAACAAGTCTGGTAACTTCCTAATGTTA
TTGAAACAGGCGAAACCAAAAATTACTGCCAGTGGAGTGGGTTTCGAAAC
TGTAGATTTTAAAGGAGTCACTGATCTAGGCATTGAAGGACTGGGTGCTG
GCGATAATAATCAGAAGAAAACAATTACTGGTCGCACTTTCCAGCAGCAG
ATTTAGCTTCGGATTCGGCTTATATTCTAATTGATCATGCTTAATTACTT
TTTGATAAATTGTTAAAAATTATAACAGGCCTTTTATATATTTTTTCTAT
GTTCTTGGCATTATTGTAATTTATCGTAATTGCCCATGATCGATCATACC
AAAAAGTGTAATTAAGTTTTGATAAAGCTGTTTAACGCAGTTATTTACGG
AATTCAAGTAGTAAACAATATTTTTGTAACTTTCTTCATTGTATTTTATT
AGGTACTTTGGTTTCATGTTATTTATGTTCTACATTTTGAATACTGACAG
ATTTTGACCTGACATTTACATTCCAGTATTAGTGTTAAATTTATAACTTA
ATAATAACTCAGCC
back to top

protein sequence of SMED30034430-orf-1

>SMED30034430-orf-1 ID=SMED30034430-orf-1|Name=SMED30034430-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=328bp
MILLEYFNRGVKEILLQKFTAAKSGAKIEKSKQCLVDFDGAVYKINNEID
RNIIFVSITLNFFKQLQEYGADKVLKREYGDRLCSQPEQGCNVSIQYDLT
NLPDDIEELAQNAALLKRNCFASVFEMFFDYQESGTTSKQAVINYRDDET
MYIKAMEDRVTVVFSTLFKDADDVIIGKVFIQELTEARRRVDRAPQVLYS
SREPPVELKGTKAAVGDNIAYITFVLFNRHFATPAARKNSIDLIHTFRNY
LHYHIKCSKAYIHMRMRNKSGNFLMLLKQAKPKITASGVGFETVDFKGVT
DLGIEGLGAGDNNQKKTITGRTFQQQI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0030041actin filament polymerization
GO:0030833regulation of actin filament polymerization
GO:0034314Arp2/3 complex-mediated actin nucleation
GO:0000902cell morphogenesis
GO:0008360regulation of cell shape
GO:0030031cell projection assembly
GO:0030866cortical actin cytoskeleton organization
GO:0046331lateral inhibition
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR034666ARPC2/4
IPR007188ARPC2
Vocabulary: cellular component
TermDefinition
GO:0015629actin cytoskeleton
GO:0005885Arp2/3 protein complex
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0045179apical cortex
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0005200structural constituent of cytoskeleton
GO:0051015actin filament binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007188Actin-related protein 2/3 complex subunit 2PFAMPF04045P34-Arccoord: 9..157
e-value: 8.8E-71
score: 238.4
IPR007188Actin-related protein 2/3 complex subunit 2PANTHERPTHR12058ARP2/3 COMPLEX 34 KDA SUBUNITcoord: 5..199
IPR034666Arp2/3 complex subunit 2/4GENE3DG3DSA:3.30.1460.20coord: 3..167
e-value: 1.0E-68
score: 232.4
IPR034666Arp2/3 complex subunit 2/4SUPERFAMILYSSF69645Arp2/3 complex subunitscoord: 5..157
NoneNo IPR availablePANTHERPTHR12058:SF0ACTIN-RELATED PROTEIN 2/3 COMPLEX SUBUNIT 2coord: 5..199