Antigen KI-67

Overview
NameAntigen KI-67
Smed IDSMED30034422
Length (bp)1566
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Antigen KI-67 (SMED30034422) t-SNE clustered cells

Violin plots show distribution of expression levels for Antigen KI-67 (SMED30034422) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Antigen KI-67 (SMED30034422) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Antigen KI-67 (SMED30034422) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034422

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 38

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30034422h1SMcG0005241 SmedASXL_017551SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30034422h1SMcG0005241 SmedASXL_012148SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30034422h1SMcG0005241 SmedASXL_017550SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30034422h1SMcG0005241 SmedASXL_017551SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30034422h1SMcG0005241 SmedASXL_017551SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30034422h1SMcG0005241 SmedASXL_012148SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30034422h1SMcG0005241 SmedASXL_012148SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30034422h1SMcG0005241 SmedASXL_017550SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30034422h1SMcG0005241 SmedASXL_017550SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30034422h1SMcG0005241 dd_Smed_v4_3777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034422h1SMcG0005241 dd_Smed_v4_3777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034422h1SMcG0005241 dd_Smed_v4_3777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034422h1SMcG0005241 dd_Smed_v4_3777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034422h1SMcG0005241 dd_Smed_v4_3777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034422h1SMcG0005241 dd_Smed_v4_3777_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034422h1SMcG0005241 Contig20539uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034422h1SMcG0005241 Contig20539newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034422h1SMcG0005241 Contig37647uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034422h1SMcG0005241 Contig37647newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30034422h1SMcG0005241 dd_Smed_v4_13700_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034422h1SMcG0005241 dd_Smed_v4_13700_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034422h1SMcG0005241 dd_Smed_v4_2548_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034422h1SMcG0005241 dd_Smed_v4_2548_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034422h1SMcG0005241 dd_Smed_v4_2548_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034422h1SMcG0005241 dd_Smed_v4_2548_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30034422h1SMcG0005241 dd_Smed_v6_3777_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30034422h1SMcG0005241 dd_Smed_v6_13700_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30034422h1SMcG0005241 dd_Smed_v6_2548_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30034422h1SMcG0005241 dd_Smed_v6_2548_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034422h1SMcG0005241 dd_Smed_v6_3777_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30034422h1SMcG0005241 dd_Smed_v4_3777_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30034422h1SMcG0005241 dd_Smed_v4_13700_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034422h1SMcG0005241 SMED30023035smed_20140614PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30034422h1SMcG0005242 SMED30023035smed_20140614PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30034422h1SMcG0005242 SMED_29717_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30034422h1SMcG0005242 SMED_29717_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30034422h1SMcG0005241 SMED_29717_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30034422h1SMcG0005241 SMED_29717_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Antigen KI-67 vs. Ensembl Xenopus
Match: fbxo38 (F-box protein 38 [Source:Xenbase;Acc:XB-GENE-969087])

HSP 1 Score: 61.2326 bits (147), Expect = 3.954e-9
Identity = 27/100 (27.00%), Postives = 51/100 (51.00%), Query Frame = 3
Query:   57 GQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHCILKLQKDEQAFLVHVGSNQFKTYLEDIEIKKPHVLNHNSIFTVGKSFIRFQYPQS 356
            G++  + RNG +G        T   G    CDI I    +  +HC ++++ +++ F++++ S    T L  I +++P VL H  + T+     RF+ PQ+
Sbjct:    5 GEIVVIKRNGTDGTHFPLTATTCLFGRKSECDIRIQLPHVSKEHCRVEVKANKEVFVINL-STVNPTQLNGIAVQQPEVLKHGDVITIIDRSFRFEQPQT 103          

HSP 2 Score: 51.2174 bits (121), Expect = 5.131e-6
Identity = 36/106 (33.96%), Postives = 52/106 (49.06%), Query Frame = 3
Query:  633 KTVSFGPNLSPETFDQEMPPAQPIKKGATPMTTADSDSTKVRKRKFSIVPRGSSVGVINKDNDNSYSSFTLSDIEPINDSFTDKAMAKARQSNVESPIHYMVPAKR 950
            K VSFG +LSPE FD+ +PP  P+K+GATP            +R  S+V   + + ++ K    S+  F  + I+    S   ++ AKA      SP     PAKR
Sbjct:  352 KRVSFGGHLSPELFDKRLPPNSPLKRGATPA-----------RRSLSLV---TPLALMRK----SFGGFRQTAIK--GASPAKRSPAKAATPAKRSPAKVATPAKR 437          
BLAST of Antigen KI-67 vs. Ensembl Xenopus
Match: fbxo38 (F-box protein 38 [Source:Xenbase;Acc:XB-GENE-969087])

HSP 1 Score: 61.2326 bits (147), Expect = 4.283e-9
Identity = 27/100 (27.00%), Postives = 51/100 (51.00%), Query Frame = 3
Query:   57 GQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHCILKLQKDEQAFLVHVGSNQFKTYLEDIEIKKPHVLNHNSIFTVGKSFIRFQYPQS 356
            G++  + RNG +G        T   G    CDI I    +  +HC ++++ +++ F++++ S    T L  I +++P VL H  + T+     RF+ PQ+
Sbjct:    5 GEIVVIKRNGTDGTHFPLTATTCLFGRKSECDIRIQLPHVSKEHCRVEVKANKEVFVINL-STVNPTQLNGIAVQQPEVLKHGDVITIIDRSFRFEQPQT 103          
BLAST of Antigen KI-67 vs. TrEMBL
Match: A0A158QHI7 (Kin17_mid domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS7495 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.754e-14
Identity = 74/308 (24.03%), Postives = 123/308 (39.94%), Query Frame = 3
Query:   51 INGQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHCILKLQKDEQAFLVHVGSNQF-KTYLEDIEIKKPHVLNHNSIFTVGKSFIRFQYPQSSKWFRKENRHIEGQIGQQFPI---------------SIAMSTPKHPMYQIHCHRTNSPTVS---------------------PIMFTNTKISTILPIKRLNVRPFVTPIQNKS----------------IDQLLQKSKLE--------------NKLL-----------------KTVSFGPNLSPETFDQEMPPAQPIKKGATP 722
            + G +  L R+G  G++ +W  +    GS  +CDI I    ++  HC L+   D + F+++V   +F +T L  + +     + HNS+ TVG     F+YP++S W  +  R    +  Q  P+               ++  S+P  P   +   R+ +PT+S                     P    N K  +IL  +  ++   V+P++ K+                I +L + S L+              N+ L                 K V FGP LSPE FD  +PPA P+K+G  P
Sbjct:  778 LRGYIVILKRDGTSGSSCEWRADKCIFGSDSSCDICIKLNSVEPFHCKLENSDDGRVFIINVA--KFSRTLLNGLGVSDRTFVAHNSLITVGDRNFTFKYPETSHWRLQPARSSVSRSAQSSPLVLSSNRLVADVSKLPTVKTSSPNRP--HLRVQRSRTPTLSSQRSGLSTRDRYCPTPTRPAVPSPDVNVKRRSILKKRTPSLEALVSPVRKKAKVLVLSETPILTGVQYIKRLRRSSSLDSFAHSNNSASFYSTNQTLNQSGASSSKLSPCHMQKKGVQFGPRLSPEQFDSRLPPATPLKRGDLP 1081          
BLAST of Antigen KI-67 vs. TrEMBL
Match: A0A402EKE1 (FHA domain-containing protein OS=Paroedura picta OX=143630 GN=parPi_0004011 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.578e-11
Identity = 59/231 (25.54%), Postives = 97/231 (41.99%), Query Frame = 3
Query:   57 GQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHCILKLQKDEQAFLVHVGSNQFKTYLEDIEIKKPHVLNHNSIFTVGKSFIRFQYPQSSKWFRKENRHIEGQIGQQFPISIAMSTPKHPMYQIHCHRTNSPTVSP-------IMFTNTKISTILPIKRLNVRP--FVTPIQNKSIDQLLQKSKLENKLLKTVSFGPNLSPETFDQEMPPAQPIKKGATP 722
            G++  + RNG +G       N+ T G    CDI I    +  +HC +++ ++++A L+++ S    T L     ++P  L H  + T+     RF+YP ++   +K                I  S  K  +  +H  +     + P       +  +  K     P KR   +P   V P+  +                K VSFG +LSPE FD+ +PP  P+KKGA P
Sbjct:  124 GKIVVIKRNGTDGTHFPLTLNSCTFGRIKECDIRIQLPQVSQEHCKIEVNENKEAILINL-STATPTQLNGRNFQQPVYLKHGDVLTIIDRSFRFEYPPATLARKK----------------IPRSEEKETLQVLHAQQVEQEKLHPQNAECKNLQNSGRKTVQKSPQKRKGGKPDLLVHPLGKR----------------KRVSFGGHLSPELFDKRLPPNSPLKKGAIP 321          
BLAST of Antigen KI-67 vs. TrEMBL
Match: A0A564YIF8 (FHA domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS6300 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 4.947e-11
Identity = 33/104 (31.73%), Postives = 57/104 (54.81%), Query Frame = 3
Query:   54 NGQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHCILKLQKDEQAFLVHVGSNQFKTYLEDIEIKKPHVLNHNSIFTVGKSFIRFQYPQSSKW 365
             G +  L R+G  G++ +WH +    GS  +CD+ I  + +D  HC L+   D + F+++V  +  +T L    + +   + HNS+ TVG    +FQYP+ S+W
Sbjct:    4 RGHIVILKRDGTSGSSCEWHADKCVFGSESSCDVCIKLKSVDPFHCKLENSDDGRVFIINVAKSP-RTLLNGSGVFERTFVAHNSLITVGDRNFKFQYPEDSQW 106          
BLAST of Antigen KI-67 vs. TrEMBL
Match: A0A158QG36 (FHA domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS9915 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 8.664e-11
Identity = 33/104 (31.73%), Postives = 57/104 (54.81%), Query Frame = 3
Query:   54 NGQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHCILKLQKDEQAFLVHVGSNQFKTYLEDIEIKKPHVLNHNSIFTVGKSFIRFQYPQSSKW 365
             G +  L R+G  G++ +WH +    GS  +CD+ I  + +D  HC L+   D + F+++V  +  +T L    + +   + HNS+ TVG    +FQYP+ S+W
Sbjct:  472 RGHIVILKRDGTSGSSCEWHADKCVFGSESSCDVCIKLKSVDPFHCKLENSDDGRVFIINVAKSP-RTLLNGSGVFERTFVAHNSLITVGDRNFKFQYPEDSQW 574          
BLAST of Antigen KI-67 vs. TrEMBL
Match: A0A5B7CNU1 (Antigen KI-67 OS=Portunus trituberculatus OX=210409 GN=MKI67 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.231e-10
Identity = 63/237 (26.58%), Postives = 104/237 (43.88%), Query Frame = 3
Query:   48 KINGQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHCILKLQKDEQAFLVHVGSNQFKTYLEDIEIKKPHV--LNHNSIFTVGKSFIRFQYPQSSKWFRKENRHIEGQIGQQFPISIAMSTPKHPMYQIHCHRTNSPTVSPIMFTNTKISTILPIKRLNVRPFVTPIQNK-------SIDQLLQKSKLENKLLKTVSFGPNLSPETFDQEMPPAQPIKKGATPMTT 731
            K+ G +  + R+G +G       ++ +IG +  CDI +    +  + C + +    +A+L ++  N  +T L    +    V  LNH  + +VG+   R++YP+ S                    S+A+S P                 S I   N KI  ++P+ +    P   PI N+       SID+L +  +      K VSFGP L+PE FD+ +PPA P+ KG  P +T
Sbjct:    2 KVVGYVVVIKRSGADGTPYPMVHSSCSIGRNIECDIRVQLNSVSQQQCRIDVDPSGKAYLTNMTQN-GQTMLNGYSLAPKEVCMLNHKQVLSVGERKFRWEYPEGS--------------------SLAVSAP-----------------SSIPSANYKI--LVPVDK---SPVYHPIANRGAAAHRWSIDELSEAKR------KKVSFGPQLNPEHFDKLLPPATPVSKGDKPNST 189          
BLAST of Antigen KI-67 vs. Ensembl Medaka
Match: mki67 (proliferation marker protein Ki-67 [Source:NCBI gene;Acc:101173508])

HSP 1 Score: 50.8322 bits (120), Expect = 3.462e-6
Identity = 48/152 (31.58%), Postives = 78/152 (51.32%), Query Frame = 3
Query:  456 QIHCHRTNSPTVSPIMFTNTKISTILPIKRLNVRPFVTPIQNKSIDQLLQKSKLENKLLKTVSFGPNLSPETFDQEMPPAQPIKKGATPMTTADSDSTKVRKRKFSIVPRGSSVGVINKDNDNSYSSFTLSDIEP-INDSFTDKAMAKARQS 908
            Q+ C +  S T+S +   N ++S    +K         P + KS +  L+K +L  +  K VSFG  LSPE FD+ +PP  P++KGATP       S  V + K +++ R S +G+I +   +   + T S  +P    S + KA + A++S
Sbjct:  273 QVQCLKCRS-TLSRMSNCNIQVSFSFSVK-------AAPKKRKSGE--LRKDQLSPQKKKRVSFGGQLSPELFDKRLPPNSPLRKGATPRR-----SLMVFRPKSTLLRRASVIGLIKQ---SPAKARTPSPKKPKAGKSASPKAASPAQKS 406          
BLAST of Antigen KI-67 vs. Planmine SMEST
Match: SMESG000050427.1 (SMESG000050427.1)

HSP 1 Score: 1058.9 bits (2737), Expect = 0.000e+0
Identity = 498/508 (98.03%), Postives = 501/508 (98.62%), Query Frame = 3
Query:   42 MEKINGQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHCILKLQKDEQAFLVHVGSNQFKTYLEDIEIKKPHVLNHNSIFTVGKSFIRFQYPQSSKWFRKENRHIEGQIGQQFPISIAMSTPKHPMYQIHCHRTNSPTVSPIMFTNTKISTILPIKRLNVRPFVTPIQNKSIDQLLQKSKLENKLLKTVSFGPNLSPETFDQEMPPAQPIKKGATPMTTADSDSTKVRKRKFSIVPRGSSVGVINKDNDNSYSSFTLSDIEPINDSFTDKAMAKARQSNVESPIHYMVPAKRRILQRNSTDPYEYSEEQEHSISPVRIKRNQSIRINSISEGLSKSVDESLNLDNIKAMENKQNQKILQIINRNEKENNVSLSNSLTKFRQLIRTSRNTNSTLDTDIDILQLNAESTTNYRFAHQNISRQSDARQSLNLQGVQELFDISEDICQEKRQFKPLHKPNHGKKSIVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            MEKINGQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHCILKLQKDEQAFLVHVGSNQFKTYLEDIEIKKPHVLNHNSIFTVGKSFIRFQYPQSSKWFRKENRHIEGQIGQQFPISIAMSTPKHPMYQIHCHRTNSPTVSPIMFTNTKISTILPIKRLNVRPFVTPIQNKSIDQLLQKSKLENKLLKTVSFGPNLSPETFDQEMPPAQPIKKGATPMTTADSDS KVRKRKFSIVPRGSSVGVINK NDNSYSSFTLSDIEPINDSFTDKAMAKARQSNVESPIHYMVPAKRRILQRNSTDPYEYSEEQEHS+SPV IKRNQSIRINS SEGLSK V ESLNLDNIKAMENKQNQKILQIINRNEKENNVSLSNSLTKFRQLIRTSRNTNSTLDTDIDILQLNAESTT YRFAHQNISRQSDARQSLNLQGVQELFDISEDICQEKRQFKP+HKPNHGKKSIVIQSDDKLYETNQKARQSCENQMKLSQ+SNRGRKS
Sbjct:    1 MEKINGQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHCILKLQKDEQAFLVHVGSNQFKTYLEDIEIKKPHVLNHNSIFTVGKSFIRFQYPQSSKWFRKENRHIEGQIGQQFPISIAMSTPKHPMYQIHCHRTNSPTVSPIMFTNTKISTILPIKRLNVRPFVTPIQNKSIDQLLQKSKLENKLLKTVSFGPNLSPETFDQEMPPAQPIKKGATPMTTADSDSIKVRKRKFSIVPRGSSVGVINKVNDNSYSSFTLSDIEPINDSFTDKAMAKARQSNVESPIHYMVPAKRRILQRNSTDPYEYSEEQEHSMSPVGIKRNQSIRINSSSEGLSKRVYESLNLDNIKAMENKQNQKILQIINRNEKENNVSLSNSLTKFRQLIRTSRNTNSTLDTDIDILQLNAESTTYYRFAHQNISRQSDARQSLNLQGVQELFDISEDICQEKRQFKPVHKPNHGKKSIVIQSDDKLYETNQKARQSCENQMKLSQKSNRGRKS 508          

HSP 2 Score: 57.7658 bits (138), Expect = 2.099e-8
Identity = 38/110 (34.55%), Postives = 66/110 (60.00%), Query Frame = 3
Query: 1266 DILQLNAESTTNYRFAHQNISRQSDARQS---LNLQGVQELFDISEDICQ-EKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            +I Q+  ES+ N     Q  +R   +R+S   + +Q  +E ++I E++    ++Q    HK N G+KS      I+++S+++ YE +Q A +S ENQ+++ Q+SNRGRKS
Sbjct: 2484 EIDQVADESSQNQLVVSQKSNRGRKSRKSKAPVIIQSDEEQYEIDEEVVDFAEKQMDVSHKSNRGRKSRKSTGPIIVESEEEHYEIDQVAGESSENQLEILQKSNRGRKS 2593          

HSP 3 Score: 52.373 bits (124), Expect = 9.551e-7
Identity = 29/76 (38.16%), Postives = 50/76 (65.79%), Query Frame = 3
Query: 1359 LQGVQELFDISEDICQ-EKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            +Q  +E  +I E++    ++Q    HK N G+KS      ++IQSD++ Y+ +++A +  ENQ+++SQ+SNRGRKS
Sbjct: 1687 IQSDEEQNEIDEEVVDFAEKQMDVSHKTNRGRKSRKSSAPVIIQSDEEQYKIDEEAGEFSENQLEISQKSNRGRKS 1762          

HSP 4 Score: 51.2174 bits (121), Expect = 1.959e-6
Identity = 28/71 (39.44%), Postives = 46/71 (64.79%), Query Frame = 3
Query: 1371 QELFDISEDICQEKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            +E+ D +E      +Q    HK N G+KS      ++IQSD++ Y+ +++A +  ENQ+++SQ+SNRGRKS
Sbjct: 2070 EEVVDFAE------KQMDVSHKTNRGRKSRKSSAPVIIQSDEEQYKIDEEAGEFSENQLEISQKSNRGRKS 2134          

HSP 5 Score: 50.8322 bits (120), Expect = 3.003e-6
Identity = 27/63 (42.86%), Postives = 43/63 (68.25%), Query Frame = 3
Query: 1395 DICQEKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            D+   ++Q    HK N G+KS      I+++S+++ YE +Q A +S ENQ+++SQ+SNRGRKS
Sbjct: 1532 DVDFAEKQMDVSHKSNPGRKSRKSTGPIIVESEEEHYEIDQVAGESSENQLEISQKSNRGRKS 1594          

HSP 6 Score: 50.8322 bits (120), Expect = 3.003e-6
Identity = 27/63 (42.86%), Postives = 43/63 (68.25%), Query Frame = 3
Query: 1395 DICQEKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            D+   ++Q    HK N G+KS      I+++S+++ YE +Q A +S ENQ+++SQ+SNRGRKS
Sbjct: 1952 DVDFAEKQMDVSHKSNPGRKSRKSTGPIIVESEEEHYEIDQVAGESSENQLEISQKSNRGRKS 2014          
BLAST of Antigen KI-67 vs. Planmine SMEST
Match: SMESG000050427.1 (SMESG000050427.1)

HSP 1 Score: 1058.51 bits (2736), Expect = 0.000e+0
Identity = 498/508 (98.03%), Postives = 501/508 (98.62%), Query Frame = 3
Query:   42 MEKINGQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHCILKLQKDEQAFLVHVGSNQFKTYLEDIEIKKPHVLNHNSIFTVGKSFIRFQYPQSSKWFRKENRHIEGQIGQQFPISIAMSTPKHPMYQIHCHRTNSPTVSPIMFTNTKISTILPIKRLNVRPFVTPIQNKSIDQLLQKSKLENKLLKTVSFGPNLSPETFDQEMPPAQPIKKGATPMTTADSDSTKVRKRKFSIVPRGSSVGVINKDNDNSYSSFTLSDIEPINDSFTDKAMAKARQSNVESPIHYMVPAKRRILQRNSTDPYEYSEEQEHSISPVRIKRNQSIRINSISEGLSKSVDESLNLDNIKAMENKQNQKILQIINRNEKENNVSLSNSLTKFRQLIRTSRNTNSTLDTDIDILQLNAESTTNYRFAHQNISRQSDARQSLNLQGVQELFDISEDICQEKRQFKPLHKPNHGKKSIVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            MEKINGQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHCILKLQKDEQAFLVHVGSNQFKTYLEDIEIKKPHVLNHNSIFTVGKSFIRFQYPQSSKWFRKENRHIEGQIGQQFPISIAMSTPKHPMYQIHCHRTNSPTVSPIMFTNTKISTILPIKRLNVRPFVTPIQNKSIDQLLQKSKLENKLLKTVSFGPNLSPETFDQEMPPAQPIKKGATPMTTADSDS KVRKRKFSIVPRGSSVGVINK NDNSYSSFTLSDIEPINDSFTDKAMAKARQSNVESPIHYMVPAKRRILQRNSTDPYEYSEEQEHS+SPV IKRNQSIRINS SEGLSK V ESLNLDNIKAMENKQNQKILQIINRNEKENNVSLSNSLTKFRQLIRTSRNTNSTLDTDIDILQLNAESTT YRFAHQNISRQSDARQSLNLQGVQELFDISEDICQEKRQFKP+HKPNHGKKSIVIQSDDKLYETNQKARQSCENQMKLSQ+SNRGRKS
Sbjct:    1 MEKINGQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHCILKLQKDEQAFLVHVGSNQFKTYLEDIEIKKPHVLNHNSIFTVGKSFIRFQYPQSSKWFRKENRHIEGQIGQQFPISIAMSTPKHPMYQIHCHRTNSPTVSPIMFTNTKISTILPIKRLNVRPFVTPIQNKSIDQLLQKSKLENKLLKTVSFGPNLSPETFDQEMPPAQPIKKGATPMTTADSDSIKVRKRKFSIVPRGSSVGVINKVNDNSYSSFTLSDIEPINDSFTDKAMAKARQSNVESPIHYMVPAKRRILQRNSTDPYEYSEEQEHSMSPVGIKRNQSIRINSSSEGLSKRVYESLNLDNIKAMENKQNQKILQIINRNEKENNVSLSNSLTKFRQLIRTSRNTNSTLDTDIDILQLNAESTTYYRFAHQNISRQSDARQSLNLQGVQELFDISEDICQEKRQFKPVHKPNHGKKSIVIQSDDKLYETNQKARQSCENQMKLSQKSNRGRKS 508          

HSP 2 Score: 57.7658 bits (138), Expect = 2.099e-8
Identity = 38/110 (34.55%), Postives = 66/110 (60.00%), Query Frame = 3
Query: 1266 DILQLNAESTTNYRFAHQNISRQSDARQS---LNLQGVQELFDISEDICQ-EKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            +I Q+  ES+ N     Q  +R   +R+S   + +Q  +E ++I E++    ++Q    HK N G+KS      I+++S+++ YE +Q A +S ENQ+++ Q+SNRGRKS
Sbjct: 2489 EIDQVADESSQNQLVVSQKSNRGRKSRKSKAPVIIQSDEEQYEIDEEVVDFAEKQMDVSHKSNRGRKSRKSTGPIIVESEEEHYEIDQVAGESSENQLEILQKSNRGRKS 2598          

HSP 3 Score: 52.7582 bits (125), Expect = 6.556e-7
Identity = 30/79 (37.97%), Postives = 52/79 (65.82%), Query Frame = 3
Query: 1350 SLNLQGVQELFDISEDICQ-EKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            S+ +Q  +E  +I E++    ++Q    HK N G+KS      ++IQSD++ Y+ +++A +  ENQ+++SQ+SNRGRKS
Sbjct: 2061 SIIIQSDEEQNEIDEEVVDFAEKQMDVSHKTNRGRKSRKSSAPVIIQSDEEQYKIDEEAGEFSENQLEISQKSNRGRKS 2139          

HSP 4 Score: 52.373 bits (124), Expect = 9.552e-7
Identity = 29/76 (38.16%), Postives = 50/76 (65.79%), Query Frame = 3
Query: 1359 LQGVQELFDISEDICQ-EKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            +Q  +E  +I E++    ++Q    HK N G+KS      ++IQSD++ Y+ +++A +  ENQ+++SQ+SNRGRKS
Sbjct: 1687 IQSDEEQNEIDEEVVDFAEKQMDVSHKTNRGRKSRKSSAPVIIQSDEEQYKIDEEAGEFSENQLEISQKSNRGRKS 1762          

HSP 5 Score: 50.8322 bits (120), Expect = 3.029e-6
Identity = 27/63 (42.86%), Postives = 43/63 (68.25%), Query Frame = 3
Query: 1395 DICQEKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            D+   ++Q    HK N G+KS      I+++S+++ YE +Q A +S ENQ+++SQ+SNRGRKS
Sbjct: 1532 DVDFAEKQMDVSHKSNPGRKSRKSTGPIIVESEEEHYEIDQVAGESSENQLEISQKSNRGRKS 1594          

HSP 6 Score: 50.8322 bits (120), Expect = 3.029e-6
Identity = 27/63 (42.86%), Postives = 43/63 (68.25%), Query Frame = 3
Query: 1395 DICQEKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            D+   ++Q    HK N G+KS      I+++S+++ YE +Q A +S ENQ+++SQ+SNRGRKS
Sbjct: 1952 DVDFAEKQMDVSHKSNPGRKSRKSTGPIIVESEEEHYEIDQVAGESSENQLEISQKSNRGRKS 2014          
BLAST of Antigen KI-67 vs. Planmine SMEST
Match: SMESG000050427.1 (SMESG000050427.1)

HSP 1 Score: 1058.51 bits (2736), Expect = 0.000e+0
Identity = 498/508 (98.03%), Postives = 501/508 (98.62%), Query Frame = 3
Query:   42 MEKINGQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHCILKLQKDEQAFLVHVGSNQFKTYLEDIEIKKPHVLNHNSIFTVGKSFIRFQYPQSSKWFRKENRHIEGQIGQQFPISIAMSTPKHPMYQIHCHRTNSPTVSPIMFTNTKISTILPIKRLNVRPFVTPIQNKSIDQLLQKSKLENKLLKTVSFGPNLSPETFDQEMPPAQPIKKGATPMTTADSDSTKVRKRKFSIVPRGSSVGVINKDNDNSYSSFTLSDIEPINDSFTDKAMAKARQSNVESPIHYMVPAKRRILQRNSTDPYEYSEEQEHSISPVRIKRNQSIRINSISEGLSKSVDESLNLDNIKAMENKQNQKILQIINRNEKENNVSLSNSLTKFRQLIRTSRNTNSTLDTDIDILQLNAESTTNYRFAHQNISRQSDARQSLNLQGVQELFDISEDICQEKRQFKPLHKPNHGKKSIVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            MEKINGQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHCILKLQKDEQAFLVHVGSNQFKTYLEDIEIKKPHVLNHNSIFTVGKSFIRFQYPQSSKWFRKENRHIEGQIGQQFPISIAMSTPKHPMYQIHCHRTNSPTVSPIMFTNTKISTILPIKRLNVRPFVTPIQNKSIDQLLQKSKLENKLLKTVSFGPNLSPETFDQEMPPAQPIKKGATPMTTADSDS KVRKRKFSIVPRGSSVGVINK NDNSYSSFTLSDIEPINDSFTDKAMAKARQSNVESPIHYMVPAKRRILQRNSTDPYEYSEEQEHS+SPV IKRNQSIRINS SEGLSK V ESLNLDNIKAMENKQNQKILQIINRNEKENNVSLSNSLTKFRQLIRTSRNTNSTLDTDIDILQLNAESTT YRFAHQNISRQSDARQSLNLQGVQELFDISEDICQEKRQFKP+HKPNHGKKSIVIQSDDKLYETNQKARQSCENQMKLSQ+SNRGRKS
Sbjct:    1 MEKINGQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHCILKLQKDEQAFLVHVGSNQFKTYLEDIEIKKPHVLNHNSIFTVGKSFIRFQYPQSSKWFRKENRHIEGQIGQQFPISIAMSTPKHPMYQIHCHRTNSPTVSPIMFTNTKISTILPIKRLNVRPFVTPIQNKSIDQLLQKSKLENKLLKTVSFGPNLSPETFDQEMPPAQPIKKGATPMTTADSDSIKVRKRKFSIVPRGSSVGVINKVNDNSYSSFTLSDIEPINDSFTDKAMAKARQSNVESPIHYMVPAKRRILQRNSTDPYEYSEEQEHSMSPVGIKRNQSIRINSSSEGLSKRVYESLNLDNIKAMENKQNQKILQIINRNEKENNVSLSNSLTKFRQLIRTSRNTNSTLDTDIDILQLNAESTTYYRFAHQNISRQSDARQSLNLQGVQELFDISEDICQEKRQFKPVHKPNHGKKSIVIQSDDKLYETNQKARQSCENQMKLSQKSNRGRKS 508          

HSP 2 Score: 57.7658 bits (138), Expect = 2.248e-8
Identity = 38/110 (34.55%), Postives = 66/110 (60.00%), Query Frame = 3
Query: 1266 DILQLNAESTTNYRFAHQNISRQSDARQS---LNLQGVQELFDISEDICQ-EKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            +I Q+  ES+ N     Q  +R   +R+S   + +Q  +E ++I E++    ++Q    HK N G+KS      I+++S+++ YE +Q A +S ENQ+++ Q+SNRGRKS
Sbjct: 2481 EIDQVADESSQNQLVVSQKSNRGRKSRKSKAPVIIQSDEEQYEIDEEVVDFAEKQMDVSHKSNRGRKSRKSTGPIIVESEEEHYEIDQVAGESSENQLEILQKSNRGRKS 2590          

HSP 3 Score: 52.373 bits (124), Expect = 9.883e-7
Identity = 29/76 (38.16%), Postives = 50/76 (65.79%), Query Frame = 3
Query: 1359 LQGVQELFDISEDICQ-EKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            +Q  +E  +I E++    ++Q    HK N G+KS      ++IQSD++ Y+ +++A +  ENQ+++SQ+SNRGRKS
Sbjct: 1687 IQSDEEQNEIDEEVVDFAEKQMDVSHKTNRGRKSRKSSAPVIIQSDEEQYKIDEEAGEFSENQLEISQKSNRGRKS 1762          

HSP 4 Score: 52.373 bits (124), Expect = 9.883e-7
Identity = 29/76 (38.16%), Postives = 50/76 (65.79%), Query Frame = 3
Query: 1359 LQGVQELFDISEDICQ-EKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            +Q  +E  +I E++    ++Q    HK N G+KS      ++IQSD++ Y+ +++A +  ENQ+++SQ+SNRGRKS
Sbjct: 2056 IQSDEEQNEIDEEVVDFAEKQMDVSHKTNRGRKSRKSSAPVIIQSDEEQYKIDEEAGEFSENQLEISQKSNRGRKS 2131          

HSP 5 Score: 50.8322 bits (120), Expect = 3.134e-6
Identity = 27/63 (42.86%), Postives = 43/63 (68.25%), Query Frame = 3
Query: 1395 DICQEKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            D+   ++Q    HK N G+KS      I+++S+++ YE +Q A +S ENQ+++SQ+SNRGRKS
Sbjct: 1532 DVDFAEKQMDVSHKSNPGRKSRKSTGPIIVESEEEHYEIDQVAGESSENQLEISQKSNRGRKS 1594          

HSP 6 Score: 50.8322 bits (120), Expect = 3.134e-6
Identity = 27/63 (42.86%), Postives = 43/63 (68.25%), Query Frame = 3
Query: 1395 DICQEKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            D+   ++Q    HK N G+KS      I+++S+++ YE +Q A +S ENQ+++SQ+SNRGRKS
Sbjct: 1952 DVDFAEKQMDVSHKSNPGRKSRKSTGPIIVESEEEHYEIDQVAGESSENQLEISQKSNRGRKS 2014          
BLAST of Antigen KI-67 vs. Planmine SMEST
Match: SMESG000050427.1 (SMESG000050427.1)

HSP 1 Score: 1058.13 bits (2735), Expect = 0.000e+0
Identity = 498/508 (98.03%), Postives = 501/508 (98.62%), Query Frame = 3
Query:   42 MEKINGQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHCILKLQKDEQAFLVHVGSNQFKTYLEDIEIKKPHVLNHNSIFTVGKSFIRFQYPQSSKWFRKENRHIEGQIGQQFPISIAMSTPKHPMYQIHCHRTNSPTVSPIMFTNTKISTILPIKRLNVRPFVTPIQNKSIDQLLQKSKLENKLLKTVSFGPNLSPETFDQEMPPAQPIKKGATPMTTADSDSTKVRKRKFSIVPRGSSVGVINKDNDNSYSSFTLSDIEPINDSFTDKAMAKARQSNVESPIHYMVPAKRRILQRNSTDPYEYSEEQEHSISPVRIKRNQSIRINSISEGLSKSVDESLNLDNIKAMENKQNQKILQIINRNEKENNVSLSNSLTKFRQLIRTSRNTNSTLDTDIDILQLNAESTTNYRFAHQNISRQSDARQSLNLQGVQELFDISEDICQEKRQFKPLHKPNHGKKSIVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            MEKINGQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHCILKLQKDEQAFLVHVGSNQFKTYLEDIEIKKPHVLNHNSIFTVGKSFIRFQYPQSSKWFRKENRHIEGQIGQQFPISIAMSTPKHPMYQIHCHRTNSPTVSPIMFTNTKISTILPIKRLNVRPFVTPIQNKSIDQLLQKSKLENKLLKTVSFGPNLSPETFDQEMPPAQPIKKGATPMTTADSDS KVRKRKFSIVPRGSSVGVINK NDNSYSSFTLSDIEPINDSFTDKAMAKARQSNVESPIHYMVPAKRRILQRNSTDPYEYSEEQEHS+SPV IKRNQSIRINS SEGLSK V ESLNLDNIKAMENKQNQKILQIINRNEKENNVSLSNSLTKFRQLIRTSRNTNSTLDTDIDILQLNAESTT YRFAHQNISRQSDARQSLNLQGVQELFDISEDICQEKRQFKP+HKPNHGKKSIVIQSDDKLYETNQKARQSCENQMKLSQ+SNRGRKS
Sbjct:    1 MEKINGQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHCILKLQKDEQAFLVHVGSNQFKTYLEDIEIKKPHVLNHNSIFTVGKSFIRFQYPQSSKWFRKENRHIEGQIGQQFPISIAMSTPKHPMYQIHCHRTNSPTVSPIMFTNTKISTILPIKRLNVRPFVTPIQNKSIDQLLQKSKLENKLLKTVSFGPNLSPETFDQEMPPAQPIKKGATPMTTADSDSIKVRKRKFSIVPRGSSVGVINKVNDNSYSSFTLSDIEPINDSFTDKAMAKARQSNVESPIHYMVPAKRRILQRNSTDPYEYSEEQEHSMSPVGIKRNQSIRINSSSEGLSKRVYESLNLDNIKAMENKQNQKILQIINRNEKENNVSLSNSLTKFRQLIRTSRNTNSTLDTDIDILQLNAESTTYYRFAHQNISRQSDARQSLNLQGVQELFDISEDICQEKRQFKPVHKPNHGKKSIVIQSDDKLYETNQKARQSCENQMKLSQKSNRGRKS 508          

HSP 2 Score: 57.7658 bits (138), Expect = 2.064e-8
Identity = 38/110 (34.55%), Postives = 66/110 (60.00%), Query Frame = 3
Query: 1266 DILQLNAESTTNYRFAHQNISRQSDARQS---LNLQGVQELFDISEDICQ-EKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            +I Q+  ES+ N     Q  +R   +R+S   + +Q  +E ++I E++    ++Q    HK N G+KS      I+++S+++ YE +Q A +S ENQ+++ Q+SNRGRKS
Sbjct: 2491 EIDQVADESSQNQLVVSQKSNRGRKSRKSKAPVIIQSDEEQYEIDEEVVDFAEKQMDVSHKSNRGRKSRKSTGPIIVESEEEHYEIDQVAGESSENQLEILQKSNRGRKS 2600          

HSP 3 Score: 52.373 bits (124), Expect = 9.310e-7
Identity = 29/76 (38.16%), Postives = 50/76 (65.79%), Query Frame = 3
Query: 1359 LQGVQELFDISEDICQ-EKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            +Q  +E  +I E++    ++Q    HK N G+KS      ++IQSD++ Y+ +++A +  ENQ+++SQ+SNRGRKS
Sbjct: 1687 IQSDEEQNEIDEEVVDFAEKQMDVSHKTNRGRKSRKSSAPVIIQSDEEQYKIDEEAGEFSENQLEISQKSNRGRKS 1762          

HSP 4 Score: 52.373 bits (124), Expect = 9.310e-7
Identity = 29/76 (38.16%), Postives = 50/76 (65.79%), Query Frame = 3
Query: 1359 LQGVQELFDISEDICQ-EKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            +Q  +E  +I E++    ++Q    HK N G+KS      ++IQSD++ Y+ +++A +  ENQ+++SQ+SNRGRKS
Sbjct: 2066 IQSDEEQNEIDEEVVDFAEKQMDVSHKTNRGRKSRKSSAPVIIQSDEEQYKIDEEAGEFSENQLEISQKSNRGRKS 2141          

HSP 5 Score: 50.8322 bits (120), Expect = 3.003e-6
Identity = 27/63 (42.86%), Postives = 43/63 (68.25%), Query Frame = 3
Query: 1395 DICQEKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            D+   ++Q    HK N G+KS      I+++S+++ YE +Q A +S ENQ+++SQ+SNRGRKS
Sbjct: 1532 DVDFAEKQMDVSHKSNPGRKSRKSTGPIIVESEEEHYEIDQVAGESSENQLEISQKSNRGRKS 1594          

HSP 6 Score: 50.8322 bits (120), Expect = 3.003e-6
Identity = 27/63 (42.86%), Postives = 43/63 (68.25%), Query Frame = 3
Query: 1395 DICQEKRQFKPLHKPNHGKKS------IVIQSDDKLYETNQKARQSCENQMKLSQQSNRGRKS 1565
            D+   ++Q    HK N G+KS      I+++S+++ YE +Q A +S ENQ+++SQ+SNRGRKS
Sbjct: 1952 DVDFAEKQMDVSHKSNPGRKSRKSTGPIIVESEEEHYEIDQVAGESSENQLEISQKSNRGRKS 2014          
The following BLAST results are available for this feature:
BLAST of Antigen KI-67 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Antigen KI-67 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Antigen KI-67 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Antigen KI-67 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Antigen KI-67 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fbxo383.954e-927.00F-box protein 38 [Source:Xenbase;Acc:XB-GENE-96908... [more]
fbxo384.283e-927.00F-box protein 38 [Source:Xenbase;Acc:XB-GENE-96908... [more]
back to top
BLAST of Antigen KI-67 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Antigen KI-67 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Antigen KI-67 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A158QHI71.754e-1424.03Kin17_mid domain-containing protein OS=Rodentolepi... [more]
A0A402EKE13.578e-1125.54FHA domain-containing protein OS=Paroedura picta O... [more]
A0A564YIF84.947e-1131.73FHA domain-containing protein OS=Hymenolepis dimin... [more]
A0A158QG368.664e-1131.73FHA domain-containing protein OS=Hymenolepis dimin... [more]
A0A5B7CNU11.231e-1026.58Antigen KI-67 OS=Portunus trituberculatus OX=21040... [more]
back to top
BLAST of Antigen KI-67 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Antigen KI-67 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Antigen KI-67 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Antigen KI-67 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Antigen KI-67 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mki673.462e-631.58proliferation marker protein Ki-67 [Source:NCBI ge... [more]
back to top
BLAST of Antigen KI-67 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000050427.12.099e-898.03SMESG000050427.1[more]
SMESG000050427.12.099e-898.03SMESG000050427.1[more]
SMESG000050427.12.248e-898.03SMESG000050427.1[more]
SMESG000050427.12.064e-898.03SMESG000050427.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034422 ID=SMED30034422|Name=Antigen KI-67|organism=Schmidtea mediterranea sexual|type=transcript|length=1566bp
GATTTTAGTAATATTTATTTATAATCTTTATTTCATTTTAGATGGAAAAG
ATAAATGGACAGCTAACATTTTTAAACCGAAATGGATTAGAAGGTGCAAC
AATAAAATGGCATAAAAACACTTTTACAATTGGAAGCCACGATAATTGTG
ATATTTCTATTGTGTCTGAATTTATTGATTCAAAGCACTGTATTTTAAAA
CTACAAAAGGACGAACAAGCTTTTTTAGTGCACGTAGGGTCAAATCAATT
TAAAACATATTTAGAAGACATTGAAATTAAAAAACCCCATGTGCTAAATC
ATAATTCAATTTTCACAGTAGGAAAATCTTTTATTCGTTTTCAATATCCA
CAATCTTCAAAATGGTTTCGAAAAGAGAATCGTCACATTGAAGGTCAGAT
AGGTCAGCAATTTCCAATTTCTATAGCTATGTCAACCCCAAAACATCCAA
TGTATCAAATACATTGTCATAGAACAAATAGTCCAACAGTTTCACCAATA
ATGTTCACTAACACGAAAATTAGCACGATATTGCCCATTAAACGATTGAA
TGTACGCCCATTCGTAACTCCAATTCAAAATAAGTCGATCGACCAACTTC
TACAAAAAAGTAAATTGGAAAACAAATTATTGAAAACCGTATCATTTGGG
CCTAATTTGAGCCCTGAAACATTTGATCAGGAAATGCCACCAGCTCAACC
AATTAAAAAAGGCGCAACTCCGATGACAACGGCCGATTCCGATAGCACCA
AAGTCAGGAAAAGAAAATTCAGTATTGTTCCGCGTGGAAGTTCTGTTGGT
GTTATTAACAAGGATAACGACAATTCCTATTCATCCTTCACTCTTTCTGA
CATCGAACCAATCAATGATTCATTCACCGATAAGGCAATGGCAAAAGCCC
GTCAATCTAATGTCGAATCACCAATACATTATATGGTGCCAGCAAAACGC
AGAATCTTACAGAGGAATTCAACAGATCCATACGAATATTCAGAGGAACA
AGAGCATTCGATATCTCCAGTCAGGATCAAAAGAAACCAATCGATTCGTA
TAAACTCTATTAGTGAAGGCCTTTCAAAAAGTGTTGACGAAAGCTTAAAT
TTGGACAATATTAAGGCAATGGAAAATAAACAAAATCAGAAAATATTACA
AATCATCAATAGAAATGAAAAGGAGAATAATGTTTCTCTTTCAAATAGTC
TCACAAAATTCAGACAGCTTATCAGGACTTCAAGAAACACAAATTCAACA
TTGGATACTGATATCGACATACTACAGCTCAATGCGGAATCAACGACTAA
TTATCGATTTGCCCATCAAAACATTTCACGTCAATCCGATGCGAGGCAGT
CTTTAAATCTTCAAGGAGTCCAAGAGCTATTTGATATTTCAGAAGATATT
TGTCAAGAAAAGAGACAATTTAAACCTCTTCACAAACCAAACCATGGAAA
AAAATCAATTGTTATCCAATCAGACGATAAATTATATGAAACGAATCAAA
AGGCGCGACAATCATGCGAAAATCAAATGAAACTTTCACAACAATCGAAC
CGTGGAAGAAAGTCTC
back to top

protein sequence of SMED30034422-orf-1

>SMED30034422-orf-1 ID=SMED30034422-orf-1|Name=SMED30034422-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=508bp
MEKINGQLTFLNRNGLEGATIKWHKNTFTIGSHDNCDISIVSEFIDSKHC
ILKLQKDEQAFLVHVGSNQFKTYLEDIEIKKPHVLNHNSIFTVGKSFIRF
QYPQSSKWFRKENRHIEGQIGQQFPISIAMSTPKHPMYQIHCHRTNSPTV
SPIMFTNTKISTILPIKRLNVRPFVTPIQNKSIDQLLQKSKLENKLLKTV
SFGPNLSPETFDQEMPPAQPIKKGATPMTTADSDSTKVRKRKFSIVPRGS
SVGVINKDNDNSYSSFTLSDIEPINDSFTDKAMAKARQSNVESPIHYMVP
AKRRILQRNSTDPYEYSEEQEHSISPVRIKRNQSIRINSISEGLSKSVDE
SLNLDNIKAMENKQNQKILQIINRNEKENNVSLSNSLTKFRQLIRTSRNT
NSTLDTDIDILQLNAESTTNYRFAHQNISRQSDARQSLNLQGVQELFDIS
EDICQEKRQFKPLHKPNHGKKSIVIQSDDKLYETNQKARQSCENQMKLSQ
QSNRGRKS
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002075pigment cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000253FHA_dom
IPR029334PP1-bd
IPR008984SMAD_FHA_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003779actin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.60.200.20coord: 1..102
e-value: 3.0E-15
score: 58.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 484..508
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 487..501
IPR029334Protein phosphatase 1 binding domainPFAMPF15276PP1_bindcoord: 198..238
e-value: 2.4E-10
score: 40.5
IPR000253Forkhead-associated (FHA) domainPFAMPF00498FHAcoord: 29..94
e-value: 2.7E-7
score: 30.9
IPR000253Forkhead-associated (FHA) domainPROSITEPS50006FHA_DOMAINcoord: 28..79
score: 8.159
IPR000253Forkhead-associated (FHA) domainCDDcd00060FHAcoord: 25..102
e-value: 3.80057E-8
score: 49.307
IPR008984SMAD/FHA domain superfamilySUPERFAMILYSSF49879SMAD/FHA domaincoord: 12..103