Snurportin-1

Overview
NameSnurportin-1
Smed IDSMED30034405
Length (bp)1036
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Snurportin-1 (SMED30034405) t-SNE clustered cells

Violin plots show distribution of expression levels for Snurportin-1 (SMED30034405) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Snurportin-1 (SMED30034405) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Snurportin-1 (SMED30034405) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Snurportin-1 vs. Ensembl Human
Match: SNUPN (snurportin 1 [Source:HGNC Symbol;Acc:HGNC:14245])

HSP 1 Score: 122.865 bits (307), Expect = 1.957e-31
Identity = 74/233 (31.76%), Postives = 115/233 (49.36%), Query Frame = 2
Query:  278 WANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMHSGIQTS-GHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYREEIIQYNAKFGYHESREKLV 973
            +AN +ML+EW + VP    + +++  CP GK  +IV+   +T    K+G+ +  F S LPGG   N    + A    I DCIYN+ N   Y+LD++ +    F     + RF W+ + L  +   G +T    + F  L    C  ++L         F +DGLLFY +   Y  GST L  WL+PYMV ++  + V    ++  P DYA ++ + I  + K      +EKL 
Sbjct:   98 YANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRN----STAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGVAVPAGPLTTKP-DYAGHQLQQIMEHKKSQKEGMKEKLT 325          
BLAST of Snurportin-1 vs. Ensembl Human
Match: SNUPN (snurportin 1 [Source:HGNC Symbol;Acc:HGNC:14245])

HSP 1 Score: 122.865 bits (307), Expect = 1.957e-31
Identity = 74/233 (31.76%), Postives = 115/233 (49.36%), Query Frame = 2
Query:  278 WANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMHSGIQTS-GHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYREEIIQYNAKFGYHESREKLV 973
            +AN +ML+EW + VP    + +++  CP GK  +IV+   +T    K+G+ +  F S LPGG   N    + A    I DCIYN+ N   Y+LD++ +    F     + RF W+ + L  +   G +T    + F  L    C  ++L         F +DGLLFY +   Y  GST L  WL+PYMV ++  + V    ++  P DYA ++ + I  + K      +EKL 
Sbjct:   98 YANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRN----STAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGVAVPAGPLTTKP-DYAGHQLQQIMEHKKSQKEGMKEKLT 325          
BLAST of Snurportin-1 vs. Ensembl Human
Match: SNUPN (snurportin 1 [Source:HGNC Symbol;Acc:HGNC:14245])

HSP 1 Score: 122.865 bits (307), Expect = 1.957e-31
Identity = 74/233 (31.76%), Postives = 115/233 (49.36%), Query Frame = 2
Query:  278 WANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMHSGIQTS-GHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYREEIIQYNAKFGYHESREKLV 973
            +AN +ML+EW + VP    + +++  CP GK  +IV+   +T    K+G+ +  F S LPGG   N    + A    I DCIYN+ N   Y+LD++ +    F     + RF W+ + L  +   G +T    + F  L    C  ++L         F +DGLLFY +   Y  GST L  WL+PYMV ++  + V    ++  P DYA ++ + I  + K      +EKL 
Sbjct:   98 YANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRN----STAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGVAVPAGPLTTKP-DYAGHQLQQIMEHKKSQKEGMKEKLT 325          
BLAST of Snurportin-1 vs. Ensembl Human
Match: SNUPN (snurportin 1 [Source:HGNC Symbol;Acc:HGNC:14245])

HSP 1 Score: 122.865 bits (307), Expect = 1.957e-31
Identity = 74/233 (31.76%), Postives = 115/233 (49.36%), Query Frame = 2
Query:  278 WANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMHSGIQTS-GHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYREEIIQYNAKFGYHESREKLV 973
            +AN +ML+EW + VP    + +++  CP GK  +IV+   +T    K+G+ +  F S LPGG   N    + A    I DCIYN+ N   Y+LD++ +    F     + RF W+ + L  +   G +T    + F  L    C  ++L         F +DGLLFY +   Y  GST L  WL+PYMV ++  + V    ++  P DYA ++ + I  + K      +EKL 
Sbjct:   98 YANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRN----STAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGVAVPAGPLTTKP-DYAGHQLQQIMEHKKSQKEGMKEKLT 325          
BLAST of Snurportin-1 vs. Ensembl Human
Match: SNUPN (snurportin 1 [Source:HGNC Symbol;Acc:HGNC:14245])

HSP 1 Score: 81.2629 bits (199), Expect = 1.449e-17
Identity = 50/165 (30.30%), Postives = 79/165 (47.88%), Query Frame = 2
Query:  278 WANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMHSGIQTS-------GHYSFEILPAINCQHDTLKSTF-VRKPI 748
            +AN +ML+EW + VP    + +++  CP GK  +IV+   +T    K+G+ +  F S LPGG   N    + A    I DCIYN+ N   Y+LD++ +    F     + RF W+ + L  +   G +T        G  +F   P   C   ++   F V KP+
Sbjct:   36 YANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRN----STAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVTKPL 196          
BLAST of Snurportin-1 vs. Ensembl Celegans
Match: F23F1.5 (Snurportin-1 [Source:UniProtKB/TrEMBL;Acc:O17066])

HSP 1 Score: 115.161 bits (287), Expect = 2.744e-29
Identity = 82/272 (30.15%), Postives = 124/272 (45.59%), Query Frame = 2
Query:   92 FHLYKNESKIGSFKERMKKDINDIRLKQRKNYFDL-----NRALE--TSDED--EKVNNNCFYRKVFSKNKWANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMHSGIQTSGHYS-FEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDY 877
            +  YKN +K     E+  K   +   +Q+   FD      N A +  TSDED  +K+      +      K+A+ MML+EW + +PE    ++ M   P GK T++V+    T   NK G  +  FQS LPGG    K+         I DCIY+  N   Y+LD++ +   ++     + R   L + L         T G  + F  +P+  C  D +      +  F LDGLLFY     Y  G + L  WLKP+M+PE+ ++ V   Y
Sbjct:   29 YSQYKNLTKAA---EQQAKRREETLERQKNGRFDTFMKLRNLAFDDVTSDEDDEQKIETTTAEKHTGKFKKYADKMMLSEWLVDIPESLSSDWTMVMAPVGKRTLVVASRGFTVAYNKGGREVSRFQSRLPGGNTRAKN-----QAWTILDCIYS--NQTYYVLDLLSWNAHEYVESPYDFRQFMLKSKLEEAPELAKSTPGFRNIFSPIPSCPCSQDQMAELMKNEISFRLDGLLFYHNSVVYQPGQSPLVGWLKPWMLPEILNVPVPEKY 290          
BLAST of Snurportin-1 vs. Ensembl Fly
Match: Snup (gene:FBgn0259199 transcript:FBtr0299683)

HSP 1 Score: 106.686 bits (265), Expect = 7.525e-26
Identity = 82/294 (27.89%), Postives = 136/294 (46.26%), Query Frame = 2
Query:   80 ESHFFHLYKNESKIGSFKERMKKDINDIRLKQRKNYFDLNRALETSDEDEKVNNNCFYRKVFSKNKWANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMHSGIQTSGHYSFEILPAINCQHDTLKSTFVRK-PIFP-----LDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYREEIIQYNAKF 943
            ES F  LYK    IG  +++ +K++   +  +R+   D  R L+  ++++ V      ++   +        L+EW    P+   E +L+  CP GK  ++V+    TK  +K G++  +F+SSLPG   + K          I DC+Y +D    Y+LD I F  Q+ +   A  RF WL        +  I  +    F++L   + +  +     + K P FP     LDG LFY ++ +YV   T L  WL P+M+ ++  L V+  Y +  P DY      ++QY   F
Sbjct:    2 ESSFQELYKKGLDIGEQQKQRQKELLKQQKLRRQQEQDDYRPLQ--NQEKPVPRKKSGKRSGHQKGIPYRPQLSEWLRHKPDDLNE-WLLVPCPVGKRCLVVASKGITKAYSKGGWMFVNFRSSLPGDWQLQKGE-------TILDCVYVEDADTFYVLDAISFGLQEVQECEASFRFYWLRARFEEHDYDKISENNEKKFKLLDHFDFEDPSAVEQALHKYPFFPENKPDLDGFLFYHKEASYVCRETPLVCWLFPFMMEDVLGLPVNKCYKA--PEDYQP--SHVLQYMDAF 281          
BLAST of Snurportin-1 vs. Ensembl Zebrafish
Match: snupn (snurportin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3464])

HSP 1 Score: 125.561 bits (314), Expect = 1.535e-32
Identity = 69/228 (30.26%), Postives = 125/228 (54.82%), Query Frame = 2
Query:  254 RKVFSKNKWANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYL-TTQMHSGIQTSGHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYR-EEIIQY 931
            RK   K+ +AN +ML+EW + VP     ++LM  CP GK +++V+   +T    K+G+ +  F S +PGG   N+    +     I DCIY+  +   Y+LD++ +        + E RF WL + +   +  S I     + F  L +I+C  ++++     +  + +DGLLFY ++  Y  GST L  WL+PYMV ++  ++V    +++ P DYA+++ ++I+++
Sbjct:  102 RKKLPKH-YANQLMLSEWLVDVPADLSSDWLMVVCPVGKRSLVVASKGSTTSYTKSGYCVNRFPSLIPGG---NRHNSALGKDYTILDCIYSDVDRTYYILDVMCWRGHPVYDCSTEFRFYWLQSKVDEVESLSEISKINPFRFVALSSISCSTESIQMALAHEYSYKVDGLLFYHKETHYTPGSTPLVGWLRPYMVADILGMDVPECPLTSKP-DYASHQLQQILEH 324          
BLAST of Snurportin-1 vs. Ensembl Zebrafish
Match: snupn (snurportin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3464])

HSP 1 Score: 125.561 bits (314), Expect = 1.535e-32
Identity = 69/228 (30.26%), Postives = 125/228 (54.82%), Query Frame = 2
Query:  254 RKVFSKNKWANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYL-TTQMHSGIQTSGHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYR-EEIIQY 931
            RK   K+ +AN +ML+EW + VP     ++LM  CP GK +++V+   +T    K+G+ +  F S +PGG   N+    +     I DCIY+  +   Y+LD++ +        + E RF WL + +   +  S I     + F  L +I+C  ++++     +  + +DGLLFY ++  Y  GST L  WL+PYMV ++  ++V    +++ P DYA+++ ++I+++
Sbjct:  102 RKKLPKH-YANQLMLSEWLVDVPADLSSDWLMVVCPVGKRSLVVASKGSTTSYTKSGYCVNRFPSLIPGG---NRHNSALGKDYTILDCIYSDVDRTYYILDVMCWRGHPVYDCSTEFRFYWLQSKVDEVESLSEISKINPFRFVALSSISCSTESIQMALAHEYSYKVDGLLFYHKETHYTPGSTPLVGWLRPYMVADILGMDVPECPLTSKP-DYASHQLQQILEH 324          
BLAST of Snurportin-1 vs. Ensembl Xenopus
Match: stag1 (stromal antigen 1 [Source:Xenbase;Acc:XB-GENE-1006155])

HSP 1 Score: 124.405 bits (311), Expect = 3.623e-32
Identity = 71/233 (30.47%), Postives = 115/233 (49.36%), Query Frame = 2
Query:  278 WANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMH-SGIQTSGHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYREEIIQY------NAKFGYHE 955
            +AN +ML+EW + VP+   E +L+  CP GK ++IV+   +T    K+G+ +  F S LPGG   N   G       I DCIYN++    Y+LD++ +          + RF WL + L  Q     I     + F  L    C  ++++   +++  + +DG LFY +   Y  GST L  WL+PYMVPE+    V P  ++  P        +I+++       A+ G++E
Sbjct:  103 YANQLMLSEWLIEVPQDISEFWLLVVCPVGKRSLIVASKGSTASYTKSGYCVNRFPSLLPGGNRHNNASGK---DYTILDCIYNEETRTYYVLDVMCWRGHPVYDCQTDFRFYWLQSKLQEQEGLCDISKRNPFKFVGLQNFPCSLESIQGVLMQEFSYKVDGFLFYHKHTHYTPGSTPLVGWLRPYMVPEILGFSVPPCPLAQKPAYAQEQMRQILEHKKGGKGTAEGGHYE 332          
BLAST of Snurportin-1 vs. Ensembl Xenopus
Match: stag1 (stromal antigen 1 [Source:Xenbase;Acc:XB-GENE-1006155])

HSP 1 Score: 124.405 bits (311), Expect = 3.859e-32
Identity = 71/233 (30.47%), Postives = 115/233 (49.36%), Query Frame = 2
Query:  278 WANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMH-SGIQTSGHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYREEIIQY------NAKFGYHE 955
            +AN +ML+EW + VP+   E +L+  CP GK ++IV+   +T    K+G+ +  F S LPGG   N   G       I DCIYN++    Y+LD++ +          + RF WL + L  Q     I     + F  L    C  ++++   +++  + +DG LFY +   Y  GST L  WL+PYMVPE+    V P  ++  P        +I+++       A+ G++E
Sbjct:  103 YANQLMLSEWLIEVPQDISEFWLLVVCPVGKRSLIVASKGSTASYTKSGYCVNRFPSLLPGGNRHNNASGK---DYTILDCIYNEETRTYYVLDVMCWRGHPVYDCQTDFRFYWLQSKLQEQEGLCDISKRNPFKFVGLQNFPCSLESIQGVLMQEFSYKVDGFLFYHKHTHYTPGSTPLVGWLRPYMVPEILGFSVPPCPLAQKPAYAQEQMRQILEHKKGGKGTAEGGHYE 332          
BLAST of Snurportin-1 vs. Ensembl Xenopus
Match: stag1 (stromal antigen 1 [Source:Xenbase;Acc:XB-GENE-1006155])

HSP 1 Score: 124.405 bits (311), Expect = 4.776e-32
Identity = 71/233 (30.47%), Postives = 115/233 (49.36%), Query Frame = 2
Query:  278 WANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMH-SGIQTSGHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYREEIIQY------NAKFGYHE 955
            +AN +ML+EW + VP+   E +L+  CP GK ++IV+   +T    K+G+ +  F S LPGG   N   G       I DCIYN++    Y+LD++ +          + RF WL + L  Q     I     + F  L    C  ++++   +++  + +DG LFY +   Y  GST L  WL+PYMVPE+    V P  ++  P        +I+++       A+ G++E
Sbjct:  113 YANQLMLSEWLIEVPQDISEFWLLVVCPVGKRSLIVASKGSTASYTKSGYCVNRFPSLLPGGNRHNNASGK---DYTILDCIYNEETRTYYVLDVMCWRGHPVYDCQTDFRFYWLQSKLQEQEGLCDISKRNPFKFVGLQNFPCSLESIQGVLMQEFSYKVDGFLFYHKHTHYTPGSTPLVGWLRPYMVPEILGFSVPPCPLAQKPAYAQEQMRQILEHKKGGKGTAEGGHYE 342          
BLAST of Snurportin-1 vs. Ensembl Mouse
Match: Snupn (snurportin 1 [Source:MGI Symbol;Acc:MGI:1913319])

HSP 1 Score: 123.635 bits (309), Expect = 7.779e-32
Identity = 73/235 (31.06%), Postives = 121/235 (51.49%), Query Frame = 2
Query:  275 KWANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMHSGIQTS-GHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYR-EEIIQYNAKFGYHESREKLV 973
            ++AN +ML+EW + VP    + +++  CP GK  +IV+   +T    K+G+ +  F S LPGG   N+     A    I DCIY++ N   Y+LD++ +    F     + RF W+ + L  +   G +T    + F  L    C  ++L         F +DGLLFY +   Y  GST L  WL+PYMV ++  + V    ++  P +YA ++ ++II++  K    +++EKL 
Sbjct:   98 RYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGG---NRRNSTTAKDYTILDCIYSEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKINPFKFVGLKNFPCTPESLCEVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDILGVAVPAGPLTTKP-EYAGHQLQQIIEH--KRSQEDTKEKLT 326          
BLAST of Snurportin-1 vs. UniProt/SwissProt
Match: sp|Q68FP5|SPN1_RAT (Snurportin-1 OS=Rattus norvegicus OX=10116 GN=Snupn PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 2.825e-31
Identity = 73/235 (31.06%), Postives = 122/235 (51.91%), Query Frame = 2
Query:  275 KWANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMHSGIQTS-GHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYR-EEIIQYNAKFGYHESREKLV 973
            ++AN +ML+EW + VP    + +++  CP GK  +IV+   +T    K+G+ +  F S LPGG   N+     A    I DCIY++ N   Y+LD++ +    F     + RF W+++ L  +   G +T    + F  L    C  ++L         F +DGLLFY +   Y  GST L  WL+PYMV ++  + V    ++  P +YA ++ ++II++  K    +++EKL 
Sbjct:   98 RYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGG---NRRNSTTAKDYTILDCIYSEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMNSKLPEEEGLGEKTKINPFKFVGLKNFPCTPESLCKVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDILGVAVPAGPLTTKP-EYAGHQLQQIIEH--KRSQEDTKEKLT 326          
BLAST of Snurportin-1 vs. UniProt/SwissProt
Match: sp|Q80W37|SPN1_MOUSE (Snurportin-1 OS=Mus musculus OX=10090 GN=Snupn PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 5.441e-31
Identity = 73/235 (31.06%), Postives = 121/235 (51.49%), Query Frame = 2
Query:  275 KWANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMHSGIQTS-GHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYR-EEIIQYNAKFGYHESREKLV 973
            ++AN +ML+EW + VP    + +++  CP GK  +IV+   +T    K+G+ +  F S LPGG   N+     A    I DCIY++ N   Y+LD++ +    F     + RF W+ + L  +   G +T    + F  L    C  ++L         F +DGLLFY +   Y  GST L  WL+PYMV ++  + V    ++  P +YA ++ ++II++  K    +++EKL 
Sbjct:   98 RYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGG---NRRNSTTAKDYTILDCIYSEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKINPFKFVGLKNFPCTPESLCEVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDILGVAVPAGPLTTKP-EYAGHQLQQIIEH--KRSQEDTKEKLT 326          
BLAST of Snurportin-1 vs. UniProt/SwissProt
Match: sp|O95149|SPN1_HUMAN (Snurportin-1 OS=Homo sapiens OX=9606 GN=SNUPN PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 9.400e-31
Identity = 74/233 (31.76%), Postives = 115/233 (49.36%), Query Frame = 2
Query:  278 WANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMHSGIQTS-GHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYREEIIQYNAKFGYHESREKLV 973
            +AN +ML+EW + VP    + +++  CP GK  +IV+   +T    K+G+ +  F S LPGG   N    + A    I DCIYN+ N   Y+LD++ +    F     + RF W+ + L  +   G +T    + F  L    C  ++L         F +DGLLFY +   Y  GST L  WL+PYMV ++  + V    ++  P DYA ++ + I  + K      +EKL 
Sbjct:   98 YANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRN----STAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGVAVPAGPLTTKP-DYAGHQLQQIMEHKKSQKEGMKEKLT 325          
BLAST of Snurportin-1 vs. UniProt/SwissProt
Match: sp|Q2TBK8|SPN1_BOVIN (Snurportin-1 OS=Bos taurus OX=9913 GN=SNUPN PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 9.009e-30
Identity = 70/221 (31.67%), Postives = 115/221 (52.04%), Query Frame = 2
Query:  275 KWANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMHSGIQTSGH-YSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYR-EEIIQY 931
            ++AN +ML+EW + VP    + +++  CP GK ++IV+    T    K+G+ + +F S LPGG   N+          I DCIY++ N   Y+LD++ +    F     + RF WL + L  +   G +T  + + F  L    C  ++L         F +DGLLFY +   Y  GST L  WL+PYMV ++  + V    ++  P +YA Y+ ++II++
Sbjct:   98 RYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRSLIVASQGLTSAYTKSGYCVNTFPSLLPGG---NRRNSTTEKDYTILDCIYSEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWLHSKLPEEEGLGEKTKRNPFKFVGLKNFPCTPESLCKVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGVAVPACPLTTKP-EYAGYQLQQIIEH 314          
BLAST of Snurportin-1 vs. UniProt/SwissProt
Match: sp|Q5ZI43|SPN1_CHICK (Snurportin-1 OS=Gallus gallus OX=9031 GN=SNUPN PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.893e-29
Identity = 71/220 (32.27%), Postives = 110/220 (50.00%), Query Frame = 2
Query:  275 KWANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMHSGIQTS-GHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYR-EEIIQ 928
            ++AN +ML+EW + VP    + +++  CP GK  ++V+   +T    K+GF +  F S LPGG   N     V     I DCIYN+     Y+LD++ +          + RF WL + +  +   G ++    Y F  L    C  ++L         F +DGLLFY +   Y  GST L  WL+PYMVP++  L V    ++  P DYA  + ++II+
Sbjct:   99 RYANQLMLSEWLVDVPVDLEQEWIVVVCPVGKRALVVASRGSTAAYTKSGFCVNRFPSLLPGGNRHNTMNEKVY---CILDCIYNEAEQTYYILDVMCWRGHPVYDCQTDFRFFWLSSKIQEEEGLGEKSRINPYKFVGLQNFPCTSESLCEVLTTNFPFEVDGLLFYHKQTHYTPGSTPLVGWLRPYMVPDILGLTVPATPLTAKP-DYAGRQLQQIIE 314          
BLAST of Snurportin-1 vs. TrEMBL
Match: A0A075AJM4 (IBB domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_00530 PE=4 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 9.345e-47
Identity = 97/311 (31.19%), Postives = 162/311 (52.09%), Query Frame = 2
Query:   98 LYKNESKIGSFKERMKKDINDI-RLKQRKNYFDLNRAL--------ETSDEDEKVNNNCFYRKV--FSKNKWANL---MMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIY---------------NKDNGKIYL------LDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMHSGIQTSGHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELF-SLEVDPDYMSNIPMDYANYREEI 922
            LYKN  +I   + R ++++  + R KQR   FD NR L        E +++D  +  N + +K   +    W +    +MLAEW + +P  F+ENY+MK CP G+H  + +   +T+I+++ G++++   S LPGGG+   +  N  + C + DCI                + DN    L      LD+I +    +  +   +R  W++ YL +Q+    Q      FE++PA +C  +++ +    KP + +DG+LFY    TY  G+T L  WLKPYM+ E F  + + PD+M++IP DY +YR E+
Sbjct:   68 LYKNSGRIADQQRRWREELAAVNRKKQRDGKFDTNRGLRSLEDATQENTEDDSALLCNPWAQKPKKYHGKSWRSYSAHLMLAEWLLFLPPTFHENYMMKLCPKGRHVFVWAAQGSTRIISRTGWVLKKTVSRLPGGGLGQSEHQNATY-CTMLDCILLNLTAPSGDNSMQICDGDNASTDLPLEFKVLDLIRYRGTCYASLPFRERCCWMEQYLHSQIEES-QEDDPVRFEVIPAYSCDLESMNAVLSVKPKYEVDGILFYHEVVTYEPGATPLVGWLKPYMLSEWFPEVTLHPDHMADIPADYTDYRNEV 376          
BLAST of Snurportin-1 vs. TrEMBL
Match: A0A3R7CSZ7 (Snurportin-1 OS=Clonorchis sinensis OX=79923 GN=Snupn PE=4 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 2.583e-46
Identity = 98/311 (31.51%), Postives = 162/311 (52.09%), Query Frame = 2
Query:   98 LYKNESKIGSFKERMKKDINDI-RLKQRKNYFDLNRAL--------ETSDEDEKVNNNCFYRKV--FSKNKWANL---MMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIY---------------NKDNGKIYL------LDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMHSGIQTSGHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELF-SLEVDPDYMSNIPMDYANYREEI 922
            LYKN  +I   + R ++++  + R KQR   FD NR L        E +++D     N + +K   +    W +    +MLAEW + +P +F+ENY+MK CP G+H  + +   +T+I+++ G++++   S LPGGG+   +  N A+ C + DCI                + DN    L      LD+I +    +  +   +R  W++ YL +Q+    Q      FE++PA  C  +++ +    KP + +DG+LFY    TY  G+T L  WLKPYM+ E F  + + PD+M++IP DY +YR E+
Sbjct:   39 LYKNSGRIADQQRRWREELAAVNRKKQRDGKFDTNRGLRSLEDATQEDTEDDSAPLCNPWSQKPKNYRGKSWRSYSAHLMLAEWLLFLPPMFHENYMMKLCPKGRHVFVWAAQGSTRIISRTGWVLKKTVSRLPGGGLGQSEHQN-ANYCTMLDCILLNLTAPSGDNSMQICDGDNASTDLPLEFKVLDLIRYRGTCYASLPFRERSCWMEQYLHSQIEES-QEDDPVRFEVIPAYPCDLESMNAVLSVKPKYEVDGILFYHEVVTYEPGATPLVGWLKPYMLTEWFPEVTLHPDHMADIPADYTDYRNEV 347          
BLAST of Snurportin-1 vs. TrEMBL
Match: G7YFR3 (Snurportin-1 OS=Clonorchis sinensis OX=79923 GN=CLF_106808 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 2.753e-46
Identity = 97/311 (31.19%), Postives = 161/311 (51.77%), Query Frame = 2
Query:   98 LYKNESKIGSFKERMKKDINDI-RLKQRKNYFDLNRAL--------ETSDEDEKVNNNCFYRKV--FSKNKWANL---MMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIY---------------NKDNGKIYL------LDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMHSGIQTSGHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELF-SLEVDPDYMSNIPMDYANYREEI 922
            LYKN  +I   + R ++++  + R KQR   FD NR L        E +++D     N + +K   +    W +    +MLAEW + +P +F+ENY+MK CP G+H  + +   +T+I+++ G++++   S LPGGG+   +  N  + C + DCI                + DN    L      LD+I +    +  +   +R  W++ YL +Q+    Q      FE++PA  C  +++ +    KP + +DG+LFY    TY  G+T L  WLKPYM+ E F  + + PD+M++IP DY +YR E+
Sbjct:   39 LYKNSGRIADQQRRWREELAAVNRKKQRDGKFDTNRGLRSLEDATQEDTEDDSAPLCNPWSQKPKNYRGKSWRSYSAHLMLAEWLLFLPPMFHENYMMKLCPKGRHVFVWAAQGSTRIISRTGWVLKKTVSRLPGGGLGQSEHQNATY-CTMLDCILLNLTAPSGDNSMQICDGDNASTDLPLEFKVLDLIRYRGTCYASLPFRERSCWMEQYLHSQIEES-QEDDPVRFEVIPAYPCDLESMNAVLSVKPKYEVDGILFYHEVVTYEPGATPLVGWLKPYMLTEWFPEVTLHPDHMADIPADYTDYRNEV 347          
BLAST of Snurportin-1 vs. TrEMBL
Match: C1LHF7 (Snurportin-1 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 7.503e-44
Identity = 106/330 (32.12%), Postives = 167/330 (50.61%), Query Frame = 2
Query:   20 QYKISTMDSIDNPISNINTHESH-FFHLYKNESKIGSFKERMKKDINDIRLK-QRKNYFDLNRALETSDEDEK--VNNNCFYRKVFSKNKWANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIY-----NKD-------------NGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMHSGIQTSGHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELF-SLEVDPDYMSNIPMDYANYREEIIQYNAK 940
            Q+  ST+D  +     +   E H    LYKN+ +    ++R ++ ++ ++ K +R ++FD NR      E+ K    +      + S  + + ++MLAEWF+ +P  F E YLMK CP G+H  I +    T I  +NG L+ S  S LPGGG+   D  N ++   + DCI      N D               + Y++D+IY     +  +   DR  WL++YL  Q+      +    F ILP+  C  ++++  F   P + +DG+LFY +D  Y  G+T L  WLKPYM+PE F ++    D++ +IP DY +Y  EI QY AK
Sbjct:    8 QHWDSTLDIDEENFETVAESEKHPRLTLYKNKGRAADQEKRWRQKLSILKSKNERLDHFDHNRFPPNKQENSKHPWASTELKSTIKSWRRHSKVLMLAEWFLFMPPDFEEEYLMKICPKGRHVFIKASKGKTTIYTRNGRLLISSVSRLPGGGLGQSDNQNNSYT-TLLDCILYCPEQNTDFSDFQRAYESKQMTFECYVVDLIYMRSTAYVNLPFCDRSQWLEHYLRQQIEE-YDEADVIVFHILPSYPCDTESMQMAFSSIPPYEIDGVLFYHKDVNYEPGATPLVSWLKPYMLPEWFPNINYHSDFLKDIPDDYTDYLNEIQQYEAK 335          
BLAST of Snurportin-1 vs. TrEMBL
Match: A0A4Z2DHH4 (Snurportin-1 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_000921 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 9.671e-44
Identity = 106/330 (32.12%), Postives = 166/330 (50.30%), Query Frame = 2
Query:   20 QYKISTMDSIDNPISNINTHESH-FFHLYKNESKIGSFKERMKKDINDIRLK-QRKNYFDLNRALETSDEDEK--VNNNCFYRKVFSKNKWANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIY-----NKD-------------NGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMHSGIQTSGHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELF-SLEVDPDYMSNIPMDYANYREEIIQYNAK 940
            Q+  ST+D  +     +   E H    LYKN+ +    ++R ++ ++ ++ K +R ++FD NR      E+ K    +      + S  + + ++MLAEWF+ +P  F E YLMK CP G+H  I +    T I  +NG L+ S  S LPGGG+   D  N ++   + DCI      N D               + Y++D+IY     +  +   DR  WL++YL  Q+           F ILP+  C  ++++  F   P + +DG+LFY +D  Y  G+T L  WLKPYM+PE F ++    D++ +IP DY +Y  EI QY AK
Sbjct:    8 QHWDSTLDIDEENFETVAESEKHPRLSLYKNKGRAADQEKRWRQKLSILKSKNERLDHFDHNRFPPNKQENSKHPWASTELKSTIKSWRRHSKVLMLAEWFLFMPPDFEEEYLMKICPKGRHVFIKASKGKTTIYTRNGRLLISSVSRLPGGGLGQSDNQNNSYT-TLLDCILYCPEQNTDFSYFQRAYESKQMTFECYVVDLIYMRSTAYVNLPFCDRSQWLEHYLRQQIEE-YDEGDVIVFHILPSYPCDTESMQMAFSSIPPYEIDGVLFYHKDVNYEPGATPLVSWLKPYMLPEWFPNINYHSDFLKDIPDDYTDYLNEIQQYEAK 335          
BLAST of Snurportin-1 vs. Ensembl Cavefish
Match: snupn (snurportin 1 [Source:NCBI gene;Acc:103035945])

HSP 1 Score: 131.724 bits (330), Expect = 5.453e-35
Identity = 87/322 (27.02%), Postives = 154/322 (47.83%), Query Frame = 2
Query:   17 TQYKIST-MDSIDNPISNINTHESHFFHLYKNESKIGSFKERMKKDINDIRLKQRKNYFDLNRALETSDEDEKVNNN------------CFYRKVFSKNKWANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYL-TTQMHSGIQTSGHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYREEIIQYNAK 940
            + + +ST  +S   P   +  ++  +  L +NE +    +++ +K +N +   +R    D   A    +++EK   N               RK   K+ +AN +ML+EW + VP     ++L+  CP GK +++V+   +T    K+G+ +  F S LPGG   N+    +     I DCIY++ +   Y+LD++ +          E RF WL +        S +     + F  L +I+C  ++++        F +DGLLFY R+  Y  GST L  WL+PYMV ++  +EV    ++  P DYA ++ + I+ + K
Sbjct:   10 SSFSVSTEANSTAAPHPRLAQYKGRYSALEQNERRRRFLEQQKEKRLNYVNHARRLAEGDWTGADSDEEQEEKTQKNQQQDEAEDEGMEVEQRKKLPKH-YANQLMLSEWLVDVPADLSSDWLLVVCPVGKRSLVVASKGSTASYTKSGYCVNRFPSLLPGG---NRHNSAMGKDYTILDCIYSEVDRTYYILDVMCWRGHPVYDCPTEFRFYWLQSKAEEVDGLSEVAKRNPFRFVNLNSISCSTESIQKALAHDYSFSVDGLLFYHRETHYTPGSTPLVGWLRPYMVADILGIEVPQCPLTTKP-DYACHQMQQIREHKK 326          
BLAST of Snurportin-1 vs. Ensembl Nematostella
Match: EDO34636 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNW6])

HSP 1 Score: 51.6026 bits (122), Expect = 1.477e-7
Identity = 44/186 (23.66%), Postives = 68/186 (36.56%), Query Frame = 2
Query:  506 AIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTT-----------------------------QMHSGIQTSGHYSFEILPAINC------QHDTLKS-TFVRKPIFPL---------------------DGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIP 892
            +I DCI+ +     Y+LDI+ +          E RF WL   L                                +HSG   +  +  + +P +        Q DT  + TF    +F +                     DGLLF+ +   Y  G T L  WLKPYM+PE+  + V P+ +++ P
Sbjct:    9 SILDCIFCEITSTFYILDIMCWRGHPVFDTETEFRFYWLKTKLQELSALGQATASNPFIVRVFFPVQVYLLGILSLHSGSHFTCSFHSDSIPDLGSLWQSAIQGDTKAAMTFRTCSVFTMMLKAPSIYTANTTAKPKNYLVDGLLFFHKRTHYSQGRTPLVGWLKPYMLPEILGIPVSPEIIASAP 194          
BLAST of Snurportin-1 vs. Ensembl Medaka
Match: snupn (snurportin 1 [Source:NCBI gene;Acc:101171661])

HSP 1 Score: 124.79 bits (312), Expect = 2.659e-32
Identity = 69/220 (31.36%), Postives = 116/220 (52.73%), Query Frame = 2
Query:  278 WANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLT-TQMHSGIQTSGHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYR-EEIIQY 931
            +AN +ML+EW + VP     ++L+  CP GK ++IV+   +T    K+G+ +  F S LPGG   N+    +     I DCIY++ +   Y+LD++ +          E RF WL + +  T+  S I     + F  L +  C   +++     +  F +DGLLFY R   Y  GST L  WL+PYMV ++  + V    ++  P +YA+++ ++I+Q+
Sbjct:  111 YANQLMLSEWLVDVPSELDTDWLLVVCPVGKRSLIVASKGSTAAYTKSGYCVNRFPSLLPGG---NRHNSAMGKDYTILDCIYSEVDRTFYILDVMCWRGHPVYDCPTEFRFFWLQSKVQETEGMSEIAKRNPFRFVSLQSSECTPASIQKVLAAEYSFSVDGLLFYHRQTHYTPGSTPLVGWLRPYMVADILGMAVPEGPLTTKP-EYASHQLQQILQH 326          
BLAST of Snurportin-1 vs. Ensembl Medaka
Match: snupn (snurportin 1 [Source:NCBI gene;Acc:101171661])

HSP 1 Score: 124.79 bits (312), Expect = 2.966e-32
Identity = 69/220 (31.36%), Postives = 116/220 (52.73%), Query Frame = 2
Query:  278 WANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLT-TQMHSGIQTSGHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYR-EEIIQY 931
            +AN +ML+EW + VP     ++L+  CP GK ++IV+   +T    K+G+ +  F S LPGG   N+    +     I DCIY++ +   Y+LD++ +          E RF WL + +  T+  S I     + F  L +  C   +++     +  F +DGLLFY R   Y  GST L  WL+PYMV ++  + V    ++  P +YA+++ ++I+Q+
Sbjct:  120 YANQLMLSEWLVDVPSELDTDWLLVVCPVGKRSLIVASKGSTAAYTKSGYCVNRFPSLLPGG---NRHNSAMGKDYTILDCIYSEVDRTFYILDVMCWRGHPVYDCPTEFRFFWLQSKVQETEGMSEIAKRNPFRFVSLQSSECTPASIQKVLAAEYSFSVDGLLFYHRQTHYTPGSTPLVGWLRPYMVADILGMAVPEGPLTTKP-EYASHQLQQILQH 335          
BLAST of Snurportin-1 vs. Planmine SMEST
Match: SMESG000003622.1 (SMESG000003622.1)

HSP 1 Score: 287.345 bits (734), Expect = 7.709e-97
Identity = 135/139 (97.12%), Postives = 136/139 (97.84%), Query Frame = 2
Query:  587 RIMTAEDRFNWLDNYLTTQMHSGIQTSGHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYREEIIQYNAKFGYHESREKLVVDTDLKMDLV 1003
            R + AEDRFNWLDNYLTTQMHSGIQTSGHYSFEILPAINCQHDTLKSTFVRKP FPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYREEIIQYNAKFGYHESREKLVVDTDLKMDLV
Sbjct:  104 RCIKAEDRFNWLDNYLTTQMHSGIQTSGHYSFEILPAINCQHDTLKSTFVRKPTFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYREEIIQYNAKFGYHESREKLVVDTDLKMDLV 242          

HSP 2 Score: 194.512 bits (493), Expect = 2.128e-60
Identity = 93/95 (97.89%), Postives = 94/95 (98.95%), Query Frame = 2
Query:   38 MDSIDNPISNINTHESHFFHLYKNESKIGSFKERMKKDINDIRLKQRKNYFDLNRALETSDEDEKVNNNCFYRKVFSKNKWANLMMLAEWFMLVP 322
            MDSIDNPISNINTHESHFFHLYKNESKIGSFKERMKKDINDIRLKQRKNYFDLNRALETSDEDEKVNNNCFYRKVFSKNKWANLMMLAEWF+L P
Sbjct:    1 MDSIDNPISNINTHESHFFHLYKNESKIGSFKERMKKDINDIRLKQRKNYFDLNRALETSDEDEKVNNNCFYRKVFSKNKWANLMMLAEWFILRP 95          
BLAST of Snurportin-1 vs. Planmine SMEST
Match: SMESG000003622.1 (SMESG000003622.1)

HSP 1 Score: 251.906 bits (642), Expect = 1.018e-84
Identity = 119/120 (99.17%), Postives = 119/120 (99.17%), Query Frame = 2
Query:  644 MHSGIQTSGHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYREEIIQYNAKFGYHESREKLVVDTDLKMDLV 1003
            MHSGIQTSGHYSFEILPAINCQHDTLKSTFVRKP FPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYREEIIQYNAKFGYHESREKLVVDTDLKMDLV
Sbjct:    1 MHSGIQTSGHYSFEILPAINCQHDTLKSTFVRKPTFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYREEIIQYNAKFGYHESREKLVVDTDLKMDLV 120          
BLAST of Snurportin-1 vs. Planmine SMEST
Match: SMESG000003593.1 (SMESG000003593.1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.602e-20
Identity = 80/292 (27.40%), Postives = 127/292 (43.49%), Query Frame = 2
Query:   62 SNINTHE-----SHFFHLYKNESKIGSFKERMKKDINDIRLKQRKNYFDLNRALETSDEDEKVNNNCFYRKVFSKN----------KWANLMMLAEWFMLVPELFYENYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGGNVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLTTQMHSGIQTSGHYSFE--ILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDGTYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSN 886
            SNI+  E       F   YKN  K    +     DI   R  +RK  FDLNR  +           C  +++ ++           + A L+MLA     +     ++YL+K CP GK  I+VSQ+N T+I++ +G  +    S  P GG  +    N     +I D I +++  K+YLLD+I +        +  DR      YL  ++ S I ++    FE  I+P++ C    L S         +DG++ Y +  TY SG +    W+    + +L S     DY +N
Sbjct:    9 SNISRDENIKLTCRFLKYYKNNFKNLHDQADKWSDIEINRKVKRKICFDLNRIYD---------QECLSQEILARTPNQIQININVQLAKLLMLANDVSKLQINEADDYLIKCCPVGKRVILVSQHNRTRIVSVDGKFVTFIHSKFP-GGFSDSSPCNKQDNFSILDGILDENLKKLYLLDVIRYGEHMLHDHSFTDRC----QYLEEKVFSAISSTDASEFEICIIPSLPCNKFVLSSLVNAGSESLMDGMVVYSKCDTYTSGRSNSVTWVPIERIADLLSACDWRDYSTN 286          
The following BLAST results are available for this feature:
BLAST of Snurportin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNUPN1.957e-3131.76snurportin 1 [Source:HGNC Symbol;Acc:HGNC:14245][more]
SNUPN1.957e-3131.76snurportin 1 [Source:HGNC Symbol;Acc:HGNC:14245][more]
SNUPN1.957e-3131.76snurportin 1 [Source:HGNC Symbol;Acc:HGNC:14245][more]
SNUPN1.957e-3131.76snurportin 1 [Source:HGNC Symbol;Acc:HGNC:14245][more]
SNUPN1.449e-1730.30snurportin 1 [Source:HGNC Symbol;Acc:HGNC:14245][more]
back to top
BLAST of Snurportin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F23F1.52.744e-2930.15Snurportin-1 [Source:UniProtKB/TrEMBL;Acc:O17066][more]
back to top
BLAST of Snurportin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Snup7.525e-2627.89gene:FBgn0259199 transcript:FBtr0299683[more]
back to top
BLAST of Snurportin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
snupn1.535e-3230.26snurportin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3464... [more]
snupn1.535e-3230.26snurportin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3464... [more]
back to top
BLAST of Snurportin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
stag13.623e-3230.47stromal antigen 1 [Source:Xenbase;Acc:XB-GENE-1006... [more]
stag13.859e-3230.47stromal antigen 1 [Source:Xenbase;Acc:XB-GENE-1006... [more]
stag14.776e-3230.47stromal antigen 1 [Source:Xenbase;Acc:XB-GENE-1006... [more]
back to top
BLAST of Snurportin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Snupn7.779e-3231.06snurportin 1 [Source:MGI Symbol;Acc:MGI:1913319][more]
back to top
BLAST of Snurportin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q68FP5|SPN1_RAT2.825e-3131.06Snurportin-1 OS=Rattus norvegicus OX=10116 GN=Snup... [more]
sp|Q80W37|SPN1_MOUSE5.441e-3131.06Snurportin-1 OS=Mus musculus OX=10090 GN=Snupn PE=... [more]
sp|O95149|SPN1_HUMAN9.400e-3131.76Snurportin-1 OS=Homo sapiens OX=9606 GN=SNUPN PE=1... [more]
sp|Q2TBK8|SPN1_BOVIN9.009e-3031.67Snurportin-1 OS=Bos taurus OX=9913 GN=SNUPN PE=2 S... [more]
sp|Q5ZI43|SPN1_CHICK1.893e-2932.27Snurportin-1 OS=Gallus gallus OX=9031 GN=SNUPN PE=... [more]
back to top
BLAST of Snurportin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A075AJM49.345e-4731.19IBB domain-containing protein OS=Opisthorchis vive... [more]
A0A3R7CSZ72.583e-4631.51Snurportin-1 OS=Clonorchis sinensis OX=79923 GN=Sn... [more]
G7YFR32.753e-4631.19Snurportin-1 OS=Clonorchis sinensis OX=79923 GN=CL... [more]
C1LHF77.503e-4432.12Snurportin-1 OS=Schistosoma japonicum OX=6182 PE=2... [more]
A0A4Z2DHH49.671e-4432.12Snurportin-1 isoform 1 OS=Schistosoma japonicum OX... [more]
back to top
BLAST of Snurportin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
snupn5.453e-3527.02snurportin 1 [Source:NCBI gene;Acc:103035945][more]
back to top
BLAST of Snurportin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Snurportin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Snurportin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO346361.477e-723.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Snurportin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
snupn2.659e-3231.36snurportin 1 [Source:NCBI gene;Acc:101171661][more]
snupn2.966e-3231.36snurportin 1 [Source:NCBI gene;Acc:101171661][more]
back to top
BLAST of Snurportin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000003622.17.709e-9797.12SMESG000003622.1[more]
SMESG000003622.11.018e-8499.17SMESG000003622.1[more]
SMESG000003593.12.602e-2027.40SMESG000003593.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034405 ID=SMED30034405|Name=Snurportin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1036bp
GAAAATTTTTATTTAAACTCAATACAAAATATCTACAATGGATTCAATTG
ATAATCCAATTTCAAATATCAATACTCACGAAAGCCATTTTTTTCATTTA
TATAAAAATGAAAGTAAAATAGGCTCATTTAAAGAGCGTATGAAAAAAGA
TATTAATGATATTAGGTTGAAACAAAGAAAAAATTATTTTGATTTAAATC
GAGCGTTGGAAACATCAGATGAAGATGAAAAAGTTAACAATAACTGCTTT
TACCGAAAAGTATTTTCTAAAAACAAATGGGCAAATTTAATGATGCTTGC
TGAGTGGTTTATGTTAGTTCCAGAATTATTTTATGAAAATTATCTTATGA
AATTCTGTCCATTTGGAAAACACACCATCATTGTATCACAAAATAACACA
ACAAAAATTTTAAACAAGAATGGCTTTTTAATCGAAAGTTTCCAATCGTC
TCTTCCAGGAGGAGGAATCGTAAACAAAGATGGCGGAAATGTCGCTCATA
AATGCGCAATTTTTGACTGTATTTATAATAAAGACAACGGGAAGATTTAT
TTACTGGATATAATTTACTTTATGAGACAAGATTTCCGAATTATGACGGC
GGAGGACAGATTTAACTGGCTGGATAATTATTTGACCACTCAAATGCATA
GTGGCATTCAAACATCTGGCCATTATTCTTTTGAAATTCTTCCCGCCATT
AATTGCCAGCACGACACCCTAAAATCGACATTTGTTAGGAAACCCATTTT
TCCGTTAGATGGGCTGCTATTTTATCTGAGAGACGGCACTTATGTCAGTG
GCTCAACTTATTTGACTATGTGGTTGAAACCTTACATGGTGCCGGAATTA
TTTTCCCTTGAGGTCGATCCTGACTATATGTCAAACATTCCCATGGATTA
CGCCAATTATCGGGAGGAAATTATTCAATATAATGCAAAATTTGGATACC
ACGAATCTCGGGAAAAACTAGTTGTTGATACAGACCTAAAGATGGATCTA
GTGTAATAGATATCTATTTCGTTCTTTTTTTCAAAA
back to top

protein sequence of SMED30034405-orf-1

>SMED30034405-orf-1 ID=SMED30034405-orf-1|Name=SMED30034405-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=323bp
MDSIDNPISNINTHESHFFHLYKNESKIGSFKERMKKDINDIRLKQRKNY
FDLNRALETSDEDEKVNNNCFYRKVFSKNKWANLMMLAEWFMLVPELFYE
NYLMKFCPFGKHTIIVSQNNTTKILNKNGFLIESFQSSLPGGGIVNKDGG
NVAHKCAIFDCIYNKDNGKIYLLDIIYFMRQDFRIMTAEDRFNWLDNYLT
TQMHSGIQTSGHYSFEILPAINCQHDTLKSTFVRKPIFPLDGLLFYLRDG
TYVSGSTYLTMWLKPYMVPELFSLEVDPDYMSNIPMDYANYREEIIQYNA
KFGYHESREKLVVDTDLKMDLV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0061015snRNA import into nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR017336Snurportin-1
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.470.30coord: 3..296
e-value: 2.1E-63
score: 215.9
NoneNo IPR availableSUPERFAMILYSSF56091DNA ligase/mRNA capping enzyme, catalytic domaincoord: 83..264
IPR017336Snurportin-1PANTHERPTHR13403SNURPORTIN1 RNUT1 PROTEIN RNA, U TRANSPORTER 1coord: 22..289