C2 NT-type domain-containing protein

Overview
NameC2 NT-type domain-containing protein
Smed IDSMED30034396
Length (bp)1534
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C2 NT-type domain-containing protein (SMED30034396) t-SNE clustered cells

Violin plots show distribution of expression levels for C2 NT-type domain-containing protein (SMED30034396) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C2 NT-type domain-containing protein (SMED30034396) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C2 NT-type domain-containing protein (SMED30034396) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034396

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30034396SMESG000015934.1 dd_Smed_v4_5362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034396SMESG000015934.1 dd_Smed_v4_5362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034396SMESG000015934.1 dd_Smed_v4_5362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30034396SMESG000015934.1 dd_Smed_v4_5362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30034396SMESG000015934.1 dd_Smed_v4_5362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034396SMESG000015934.1 dd_Smed_v4_5362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034396SMESG000015934.1 dd_Smed_v4_5362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
oocyteSMED30034396SMESG000015934.1 Contig29305newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30034396SMESG000015934.1 Contig29305uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30034396SMESG000015934.1 Contig29305newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30034396SMESG000015934.1 Contig29305uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30034396SMESG000015934.1 Contig29305newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30034396SMESG000015934.1 Contig29305uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30034396SMESG000015934.1 dd_Smed_v4_5362_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C2 NT-type domain-containing protein vs. Ensembl Human
Match: FAM102B (family with sequence similarity 102 member B [Source:HGNC Symbol;Acc:HGNC:27637])

HSP 1 Score: 140.969 bits (354), Expect = 7.445e-37
Identity = 70/153 (45.75%), Postives = 103/153 (67.32%), Query Frame = 2
Query:  158 VTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVPDEDTSKCVP 613
            V   LEELSS+PFVNG+LF KMRLLD  +    SSRE ++ + V W     F C++ A+  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G+T   RR +LEGY+ ++ RQDNS+L++  ++  + GDPCF+ P   TS  +P
Sbjct:   11 VDFELEELSSVPFVNGVLFCKMRLLDGGSFTAESSREVVQANCVRWRKKFSFMCKMSASAATGILDPCIYRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTT--RRCLLEGYDTKNTRQDNSILKVLISMQLMSGDPCFKTP-PSTSMSIP 160          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Human
Match: FAM102B (family with sequence similarity 102 member B [Source:HGNC Symbol;Acc:HGNC:27637])

HSP 1 Score: 140.584 bits (353), Expect = 1.010e-36
Identity = 70/153 (45.75%), Postives = 103/153 (67.32%), Query Frame = 2
Query:  158 VTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVPDEDTSKCVP 613
            V   LEELSS+PFVNG+LF KMRLLD  +    SSRE ++ + V W     F C++ A+  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G+T   RR +LEGY+ ++ RQDNS+L++  ++  + GDPCF+ P   TS  +P
Sbjct:   11 VDFELEELSSVPFVNGVLFCKMRLLDGGSFTAESSREVVQANCVRWRKKFSFMCKMSASAATGILDPCIYRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTT--RRCLLEGYDTKNTRQDNSILKVLISMQLMSGDPCFKTP-PSTSMSIP 160          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Human
Match: FAM102A (family with sequence similarity 102 member A [Source:HGNC Symbol;Acc:HGNC:31419])

HSP 1 Score: 132.88 bits (333), Expect = 1.032e-33
Identity = 64/140 (45.71%), Postives = 95/140 (67.86%), Query Frame = 2
Query:  170 LEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            LEEL+++PFVNG+LF K+RLLD  +    SSRE ++ + V W     F C++ AN  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G T   R  +LEGY+ ++ RQDNS+L++   +  L GDPCF+ P
Sbjct:   18 LEELTAVPFVNGVLFCKVRLLDGGDFVSLSSREEVQENCVRWRKRFTFVCKMSANPATGLLDPCVFRVSVRKELKGGKAYSKLGFADLNLAEFAGSGSTV--RCCLLEGYDTKNTRQDNSILKVTIGMFLLSGDPCFKTP 155          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Celegans
Match: sym-3 (SYM-3B [Source:UniProtKB/TrEMBL;Acc:G5EE38])

HSP 1 Score: 115.546 bits (288), Expect = 1.264e-28
Identity = 56/150 (37.33%), Postives = 90/150 (60.00%), Query Frame = 2
Query:  137 KKSYQFEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYNQDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            +K+ +F V L + +LS +P VN  +F KMRLLD  + ++ + R  +KNH  ++N+   F CR+  +  +  LE    ++S+RKE KGGKS+ K+G+V +N++ +A  G     R Y+L GY  ++R DNS + +   +     DP FRVP
Sbjct:    6 RKTVKFSVDLQVCQLSDVPLVNATVFGKMRLLDGGSFEEATERVEVKNHSASFNTRFVFCCRIPCDQTSGTLEKCLCRVSIRKEQKGGKSYYKLGFVDINLSEYAASGVEGISRTYLLNGYTSNQRLDNSKVCIKVAMTHQSADPFFRVP 155          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Celegans
Match: sym-3 (SYM-3B [Source:UniProtKB/TrEMBL;Acc:G5EE38])

HSP 1 Score: 110.153 bits (274), Expect = 3.290e-28
Identity = 55/149 (36.91%), Postives = 89/149 (59.73%), Query Frame = 2
Query:  137 KKSYQFEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYNQDKRQDNSMLQMHFTVCQLFGDPCFRV 583
            +K+ +F V L + +LS +P VN  +F KMRLLD  + ++ + R  +KNH  ++N+   F CR+  +  +  LE    ++S+RKE KGGKS+ K+G+V +N++ +A  G     R Y+L GY  ++R DNS + +   +     DP FRV
Sbjct:    6 RKTVKFSVDLQVCQLSDVPLVNATVFGKMRLLDGGSFEEATERVEVKNHSASFNTRFVFCCRIPCDQTSGTLEKCLCRVSIRKEQKGGKSYYKLGFVDINLSEYAASGVEGISRTYLLNGYTSNQRLDNSKVCIKVAMTHQSADPFFRV 154          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Fly
Match: CG8671 (gene:FBgn0032938 transcript:FBtr0081484)

HSP 1 Score: 143.665 bits (361), Expect = 2.807e-37
Identity = 65/145 (44.83%), Postives = 101/145 (69.66%), Query Frame = 2
Query:  152 FEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYNQDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            F V + L++L  +  VN +LFAK+RLLD  + ++YSSRE ++NH V WN + +F C++ AN  T +L+P  ++IS+RKE+KGG+S+ K+G++ +N+A FA  G T+  RR++LEGY+   R DNSML++   +  L GD  F+ P
Sbjct:   22 FNVEVQLQDLVEVALVNEVLFAKIRLLDGGSFQEYSSREEVRNHRVEWNRSFEFPCKMSANASTGVLDPCHLRISIRKEMKGGRSYYKLGFIDLNLAEFAGAGLTS--RRFLLEGYDSRHRLDNSMLRVSIKMHMLSGDILFKAP 164          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Fly
Match: CG8671 (gene:FBgn0032938 transcript:FBtr0330678)

HSP 1 Score: 143.665 bits (361), Expect = 2.352e-36
Identity = 65/145 (44.83%), Postives = 101/145 (69.66%), Query Frame = 2
Query:  152 FEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYNQDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            F V + L++L  +  VN +LFAK+RLLD  + ++YSSRE ++NH V WN + +F C++ AN  T +L+P  ++IS+RKE+KGG+S+ K+G++ +N+A FA  G T+  RR++LEGY+   R DNSML++   +  L GD  F+ P
Sbjct:   22 FNVEVQLQDLVEVALVNEVLFAKIRLLDGGSFQEYSSREEVRNHRVEWNRSFEFPCKMSANASTGVLDPCHLRISIRKEMKGGRSYYKLGFIDLNLAEFAGAGLTS--RRFLLEGYDSRHRLDNSMLRVSIKMHMLSGDILFKAP 164          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Fly
Match: CG8671 (gene:FBgn0032938 transcript:FBtr0330680)

HSP 1 Score: 143.665 bits (361), Expect = 3.813e-36
Identity = 65/145 (44.83%), Postives = 101/145 (69.66%), Query Frame = 2
Query:  152 FEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYNQDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            F V + L++L  +  VN +LFAK+RLLD  + ++YSSRE ++NH V WN + +F C++ AN  T +L+P  ++IS+RKE+KGG+S+ K+G++ +N+A FA  G T+  RR++LEGY+   R DNSML++   +  L GD  F+ P
Sbjct:   22 FNVEVQLQDLVEVALVNEVLFAKIRLLDGGSFQEYSSREEVRNHRVEWNRSFEFPCKMSANASTGVLDPCHLRISIRKEMKGGRSYYKLGFIDLNLAEFAGAGLTS--RRFLLEGYDSRHRLDNSMLRVSIKMHMLSGDILFKAP 164          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Fly
Match: CG8671 (gene:FBgn0032938 transcript:FBtr0114602)

HSP 1 Score: 143.665 bits (361), Expect = 3.845e-36
Identity = 65/145 (44.83%), Postives = 101/145 (69.66%), Query Frame = 2
Query:  152 FEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYNQDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            F V + L++L  +  VN +LFAK+RLLD  + ++YSSRE ++NH V WN + +F C++ AN  T +L+P  ++IS+RKE+KGG+S+ K+G++ +N+A FA  G T+  RR++LEGY+   R DNSML++   +  L GD  F+ P
Sbjct:   22 FNVEVQLQDLVEVALVNEVLFAKIRLLDGGSFQEYSSREEVRNHRVEWNRSFEFPCKMSANASTGVLDPCHLRISIRKEMKGGRSYYKLGFIDLNLAEFAGAGLTS--RRFLLEGYDSRHRLDNSMLRVSIKMHMLSGDILFKAP 164          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Fly
Match: CG8671 (gene:FBgn0032938 transcript:FBtr0330679)

HSP 1 Score: 143.665 bits (361), Expect = 4.046e-36
Identity = 65/145 (44.83%), Postives = 101/145 (69.66%), Query Frame = 2
Query:  152 FEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYNQDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            F V + L++L  +  VN +LFAK+RLLD  + ++YSSRE ++NH V WN + +F C++ AN  T +L+P  ++IS+RKE+KGG+S+ K+G++ +N+A FA  G T+  RR++LEGY+   R DNSML++   +  L GD  F+ P
Sbjct:   22 FNVEVQLQDLVEVALVNEVLFAKIRLLDGGSFQEYSSREEVRNHRVEWNRSFEFPCKMSANASTGVLDPCHLRISIRKEMKGGRSYYKLGFIDLNLAEFAGAGLTS--RRFLLEGYDSRHRLDNSMLRVSIKMHMLSGDILFKAP 164          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Zebrafish
Match: fam102ba (family with sequence similarity 102 member Ba [Source:ZFIN;Acc:ZDB-GENE-060616-312])

HSP 1 Score: 138.272 bits (347), Expect = 4.119e-36
Identity = 69/144 (47.92%), Postives = 100/144 (69.44%), Query Frame = 2
Query:  158 VTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            V + LEELSS+P+VNG+LF K+RL D   S++ SSREP+  + V W     F C++ AN  T +L+P   ++SVRKE+KGGK+F K+G+  +N+A FA  G T   RR +LEGYN ++ RQDNS+L++  ++  + GDPCF+ P
Sbjct:   15 VDVELEELSSVPYVNGVLFCKVRLTDGGFSEE-SSREPVLVNCVKWKKRFSFICKMSANAGTGVLDPCVFRVSVRKELKGGKTFAKLGFADLNLAEFAGSGSTT--RRCLLEGYNTKNTRQDNSILKVIISMHLMSGDPCFKTP 155          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Zebrafish
Match: fam102ba (family with sequence similarity 102 member Ba [Source:ZFIN;Acc:ZDB-GENE-060616-312])

HSP 1 Score: 138.272 bits (347), Expect = 5.977e-36
Identity = 69/144 (47.92%), Postives = 100/144 (69.44%), Query Frame = 2
Query:  158 VTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            V + LEELSS+P+VNG+LF K+RL D   S++ SSREP+  + V W     F C++ AN  T +L+P   ++SVRKE+KGGK+F K+G+  +N+A FA  G T   RR +LEGYN ++ RQDNS+L++  ++  + GDPCF+ P
Sbjct:   15 VDVELEELSSVPYVNGVLFCKVRLTDGGFSEE-SSREPVLVNCVKWKKRFSFICKMSANAGTGVLDPCVFRVSVRKELKGGKTFAKLGFADLNLAEFAGSGSTT--RRCLLEGYNTKNTRQDNSILKVIISMHLMSGDPCFKTP 155          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Zebrafish
Match: fam102aa (family with sequence similarity 102 member Aa [Source:ZFIN;Acc:ZDB-GENE-081104-233])

HSP 1 Score: 136.732 bits (343), Expect = 3.348e-35
Identity = 68/148 (45.95%), Postives = 100/148 (67.57%), Query Frame = 2
Query:  170 LEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVPDEDTSKCV 610
            LEEL+++PFVNG+LF K+RLLD  +    SSRE +  + V W     F C++ AN  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G TA  R  +LEGY+ ++ RQDNS+L++   +  L GDPCF+ P   T+KC+
Sbjct:   18 LEELTAVPFVNGVLFCKIRLLDGGDFTASSSREEVHQNCVRWRKRFSFVCKMSANSNTGVLDPCMCRVSVRKELKGGKAYSKLGFADLNMAEFAGSGWTA--RCCLLEGYDTKNTRQDNSILKVTIGMTLLSGDPCFKTP-PSTAKCI 162          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Zebrafish
Match: fam102aa (family with sequence similarity 102 member Aa [Source:ZFIN;Acc:ZDB-GENE-081104-233])

HSP 1 Score: 135.961 bits (341), Expect = 4.660e-35
Identity = 68/148 (45.95%), Postives = 100/148 (67.57%), Query Frame = 2
Query:  170 LEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVPDEDTSKCV 610
            LEEL+++PFVNG+LF K+RLLD  +    SSRE +  + V W     F C++ AN  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G TA  R  +LEGY+ ++ RQDNS+L++   +  L GDPCF+ P   T+KC+
Sbjct:   18 LEELTAVPFVNGVLFCKIRLLDGGDFTASSSREEVHQNCVRWRKRFSFVCKMSANSNTGVLDPCMCRVSVRKELKGGKAYSKLGFADLNMAEFAGSGWTA--RCCLLEGYDTKNTRQDNSILKVTIGMTLLSGDPCFKTP-PSTAKCI 162          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Zebrafish
Match: fam102bb (family with sequence similarity 102 member Bb [Source:ZFIN;Acc:ZDB-GENE-041014-330])

HSP 1 Score: 135.576 bits (340), Expect = 5.296e-35
Identity = 67/144 (46.53%), Postives = 99/144 (68.75%), Query Frame = 2
Query:  158 VTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            V   L+ELSS+PFVNG+LF K+RLLD   S++ SSRE ++ + V W     F C++ AN  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G T   RR +LEGY+ ++ RQDNS+L++  +   + GDPCF+ P
Sbjct:   11 VDFELDELSSVPFVNGVLFCKVRLLDGGFSEE-SSRETVQANCVHWRKRFSFPCKMSANAGTGVLDPCVCRVSVRKELKGGKTYAKLGFADLNLAEFAGSGSTT--RRCLLEGYDTKNTRQDNSILKVIISTQLMSGDPCFKTP 151          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Xenopus
Match: spi1 (Spi-1 proto-oncogene [Source:Xenbase;Acc:XB-GENE-1018247])

HSP 1 Score: 134.806 bits (338), Expect = 1.569e-34
Identity = 68/154 (44.16%), Postives = 102/154 (66.23%), Query Frame = 2
Query:  158 VTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFR-VPDEDTSKCVP 613
            V   L+ LSS+PFVNGILF K+RLLD  N    SSRE ++ + V W     F C++ A+  + +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G+T   RR +LEGY+ ++ RQDNS+L++  ++  + GDPCF+  P   TS  +P
Sbjct:   15 VDFELDNLSSVPFVNGILFCKIRLLDGGNFSVESSREVVQANSVHWRKQFTFVCKMSASANSGILDPCVCRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTI--RRCLLEGYDTKNTRQDNSILKVGISMQLMSGDPCFKTAPSTATSIAIP 166          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Xenopus
Match: fam102a (family with sequence similarity 102 member A [Source:NCBI gene;Acc:100036602])

HSP 1 Score: 134.42 bits (337), Expect = 2.472e-34
Identity = 65/145 (44.83%), Postives = 98/145 (67.59%), Query Frame = 2
Query:  155 EVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            + +  LEEL+++PFVNG+LF K+RLLD  +    SSRE ++ + V W     F C++ AN  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G TA  R  +LEGY+ ++ RQDNS+L++   +  L GDPCF+ P
Sbjct:   13 QTSFNLEELTAVPFVNGVLFCKVRLLDGGDFVSQSSREEVQENCVHWRKKFNFVCKMSANPATGVLDPCVCRVSVRKELKGGKTYSKLGFADLNLAEFAGSGSTA--RCCLLEGYDTRNTRQDNSILKVIIGMSLLSGDPCFKTP 155          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Xenopus
Match: fam102a (family with sequence similarity 102 member A [Source:NCBI gene;Acc:100036602])

HSP 1 Score: 115.161 bits (287), Expect = 1.263e-27
Identity = 61/145 (42.07%), Postives = 92/145 (63.45%), Query Frame = 2
Query:  155 EVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            + +  LEEL+++PFVNG+LF K+RLLD  +    SSRE ++ + V W     F C++ AN  T +L+P   ++SVRK  K  + +L  G+  +N+A FA  G TA  R  +LEGY+ ++ RQDNS+L++   +  L GDPCF+ P
Sbjct:   13 QTSFNLEELTAVPFVNGVLFCKVRLLDGGDFVSQSSREEVQENCVHWRKKFNFVCKMSANPATGVLDPCVCRVSVRKVRKINRRWL--GFADLNLAEFAGSGSTA--RCCLLEGYDTRNTRQDNSILKVIIGMSLLSGDPCFKTP 153          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Xenopus
Match: spi1 (Spi-1 proto-oncogene [Source:Xenbase;Acc:XB-GENE-1018247])

HSP 1 Score: 96.2857 bits (238), Expect = 1.987e-21
Identity = 48/126 (38.10%), Postives = 80/126 (63.49%), Query Frame = 2
Query:  266 EPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFR-VPDEDTSKCVPYEVFSQNK 637
            E ++ + V W     F C++ A+  + +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G+T   RR +LEGY+ ++ RQDNS+L++  ++  + GDPCF+  P   TS  +P +  S  K
Sbjct:   17 EVVQANSVHWRKQFTFVCKMSASANSGILDPCVCRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTI--RRCLLEGYDTKNTRQDNSILKVGISMQLMSGDPCFKTAPSTATSIAIPGDSDSLQK 140          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Mouse
Match: Fam102b (family with sequence similarity 102, member B [Source:MGI Symbol;Acc:MGI:3036259])

HSP 1 Score: 140.198 bits (352), Expect = 1.255e-36
Identity = 70/153 (45.75%), Postives = 103/153 (67.32%), Query Frame = 2
Query:  158 VTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVPDEDTSKCVP 613
            V   LEELSS+PFVNG+LF KMRLLD  +    SSRE ++ + V W     F C++ A+  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G+T   RR +LEGY+ ++ RQDNS+L++  ++  + GDPCF+ P   TS  +P
Sbjct:   11 VDFELEELSSVPFVNGVLFCKMRLLDGGSFTAESSREVVQANCVHWRKKFSFMCKMSASASTGILDPCIYRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTT--RRCLLEGYDTKNTRQDNSILKVLISMQLMSGDPCFKTP-PSTSMSIP 160          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Mouse
Match: Fam102a (family with sequence similarity 102, member A [Source:MGI Symbol;Acc:MGI:2138935])

HSP 1 Score: 132.494 bits (332), Expect = 1.393e-33
Identity = 64/140 (45.71%), Postives = 95/140 (67.86%), Query Frame = 2
Query:  170 LEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            LEEL+++PFVNG+LF K+RLLD  +    SSRE ++ + V W     F C++ AN  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G T   R  +LEGY+ ++ RQDNS+L++   +  L GDPCF+ P
Sbjct:   18 LEELTAVPFVNGVLFCKVRLLDGGDFVSLSSREEVQENCVRWRKRFTFVCKMSANPATGLLDPCIFRVSVRKELKGGKAYSKLGFTDLNLAEFAGSGSTV--RCCLLEGYDTKNTRQDNSILKVTIGMFLLSGDPCFKTP 155          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Mouse
Match: Fam102b (family with sequence similarity 102, member B [Source:MGI Symbol;Acc:MGI:3036259])

HSP 1 Score: 110.538 bits (275), Expect = 2.810e-26
Identity = 55/132 (41.67%), Postives = 86/132 (65.15%), Query Frame = 2
Query:  221 MRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVPDEDTSKCVP 613
            MRLLD  +    SSRE ++ + V W     F C++ A+  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G+T   RR +LEGY+ ++ RQDNS+L++  ++  + GDPCF+ P   TS  +P
Sbjct:    1 MRLLDGGSFTAESSREVVQANCVHWRKKFSFMCKMSASASTGILDPCIYRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTT--RRCLLEGYDTKNTRQDNSILKVLISMQLMSGDPCFKTP-PSTSMSIP 129          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Mouse
Match: Fam102a (family with sequence similarity 102, member A [Source:MGI Symbol;Acc:MGI:2138935])

HSP 1 Score: 59.3066 bits (142), Expect = 6.698e-11
Identity = 26/55 (47.27%), Postives = 37/55 (67.27%), Query Frame = 2
Query:  170 LEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVAN 334
            LEEL+++PFVNG+LF K+RLLD  +    SSRE ++ + V W     F C++ AN
Sbjct:   18 LEELTAVPFVNGVLFCKVRLLDGGDFVSLSSREEVQENCVRWRKRFTFVCKMSAN 72          
BLAST of C2 NT-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5T8I3|F102B_HUMAN (Protein FAM102B OS=Homo sapiens OX=9606 GN=FAM102B PE=1 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 4.849e-36
Identity = 70/153 (45.75%), Postives = 103/153 (67.32%), Query Frame = 2
Query:  158 VTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVPDEDTSKCVP 613
            V   LEELSS+PFVNG+LF KMRLLD  +    SSRE ++ + V W     F C++ A+  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G+T   RR +LEGY+ ++ RQDNS+L++  ++  + GDPCF+ P   TS  +P
Sbjct:   11 VDFELEELSSVPFVNGVLFCKMRLLDGGSFTAESSREVVQANCVRWRKKFSFMCKMSASAATGILDPCIYRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTT--RRCLLEGYDTKNTRQDNSILKVLISMQLMSGDPCFKTP-PSTSMSIP 160          
BLAST of C2 NT-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6GNM6|F102A_XENLA (Protein FAM102A OS=Xenopus laevis OX=8355 GN=fam102a PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.766e-33
Identity = 64/145 (44.14%), Postives = 98/145 (67.59%), Query Frame = 2
Query:  155 EVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            + +  LEEL+++PFVNG+LF K+RLLD  +    SSRE ++ + V W     F C++ AN  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G  A  R  +LEGY+ ++ RQDNS+L+++  +  L GDPCF+ P
Sbjct:   13 QTSFNLEELTAVPFVNGVLFCKVRLLDGGDFVSQSSREEVQENCVRWKKKFNFVCKMSANSATGVLDPCVCRVSVRKELKGGKTYSKLGFADLNLAEFAGSGSAA--RCCLLEGYDTRNTRQDNSILKVNIGMSLLSGDPCFKTP 155          
BLAST of C2 NT-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5T9C2|F102A_HUMAN (Protein FAM102A OS=Homo sapiens OX=9606 GN=FAM102A PE=1 SV=2)

HSP 1 Score: 132.88 bits (333), Expect = 4.954e-33
Identity = 64/140 (45.71%), Postives = 95/140 (67.86%), Query Frame = 2
Query:  170 LEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            LEEL+++PFVNG+LF K+RLLD  +    SSRE ++ + V W     F C++ AN  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G T   R  +LEGY+ ++ RQDNS+L++   +  L GDPCF+ P
Sbjct:   18 LEELTAVPFVNGVLFCKVRLLDGGDFVSLSSREEVQENCVRWRKRFTFVCKMSANPATGLLDPCVFRVSVRKELKGGKAYSKLGFADLNLAEFAGSGSTV--RCCLLEGYDTKNTRQDNSILKVTIGMFLLSGDPCFKTP 155          
BLAST of C2 NT-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q78T81|F102A_MOUSE (Protein FAM102A OS=Mus musculus OX=10090 GN=Fam102a PE=1 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 9.741e-33
Identity = 64/140 (45.71%), Postives = 95/140 (67.86%), Query Frame = 2
Query:  170 LEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            LEEL+++PFVNG+LF K+RLLD  +    SSRE ++ + V W     F C++ AN  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G T   R  +LEGY+ ++ RQDNS+L++   +  L GDPCF+ P
Sbjct:   18 LEELTAVPFVNGVLFCKVRLLDGGDFVSLSSREEVQENCVRWRKRFTFVCKMSANPATGLLDPCIFRVSVRKELKGGKAYSKLGFTDLNLAEFAGSGSTV--RCCLLEGYDTKNTRQDNSILKVTIGMFLLSGDPCFKTP 155          
BLAST of C2 NT-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BQS4|F102B_MOUSE (Protein FAM102B OS=Mus musculus OX=10090 GN=Fam102b PE=2 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 1.965e-25
Identity = 55/132 (41.67%), Postives = 86/132 (65.15%), Query Frame = 2
Query:  221 MRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVPDEDTSKCVP 613
            MRLLD  +    SSRE ++ + V W     F C++ A+  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G+T   RR +LEGY+ ++ RQDNS+L++  ++  + GDPCF+ P   TS  +P
Sbjct:    1 MRLLDGGSFTAESSREVVQANCVHWRKKFSFMCKMSASASTGILDPCIYRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTT--RRCLLEGYDTKNTRQDNSILKVLISMQLMSGDPCFKTP-PSTSMSIP 129          
BLAST of C2 NT-type domain-containing protein vs. TrEMBL
Match: A0A5J4P0X9 (C2 NT-type domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0002162 PE=4 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 8.078e-55
Identity = 101/205 (49.27%), Postives = 136/205 (66.34%), Query Frame = 2
Query:  116 MLCVP--TGKKSYQFEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYNQD-KRQDNSMLQMHFTVCQLFGDPCFRVPDEDTSKCVPYEVFSQNKLLIVTPNS--SLEGIDGLLDSEPIDSEG 715
            M CVP    +K YQFE  + L  L S+P+VN + FAK+RLL++R+S QYS R  I+NH VTWN+ H+F CR  +N++T +LEP+ +KIS+R E KGGKSF K+G+V V++ACF  LGD   RRRYILEGYN+  KR DNS+L + F++ QLFGD CFR P E+   C           LI  P+S  S   + G + ++P D+ G
Sbjct:    1 MACVPILNRRKGYQFEAVVKLHSLISVPYVNAVTFAKLRLLNARHSSQYSPRVEIRNHTVTWNTEHRFLCRFRSNMETTILEPNVLKISIRMETKGGKSFYKVGFVSVDLACFTALGDVTSRRRYILEGYNEKHKRLDNSLLLVSFSMRQLFGDTCFRAPPENLRNC-----------LIEPPDSDESDSALTGTVVTDPPDAMG 194          
BLAST of C2 NT-type domain-containing protein vs. TrEMBL
Match: A0A504YQP9 (C2 NT-type domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_05903 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 1.096e-53
Identity = 88/168 (52.38%), Postives = 124/168 (73.81%), Query Frame = 2
Query:  116 MLCVP--TGKKSYQFEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYNQD-KRQDNSMLQMHFTVCQLFGDPCFRVPDEDTSKCV 610
            M C P  + +K Y FEV + L  L ++P+VN + FAK+RLLD+R++ QYS+R  I+NH V+WN+ H+F C+  +N  TN+LEP  +KIS+R E KGGKSF K+G+V++N+A FA +G   CRRRYIL GY++  KRQDNS+L + F++ QLFGD CFR+P E+ S C+
Sbjct:    1 MDCAPMLSRRKRYHFEVVVRLHSLVAVPYVNAVTFAKLRLLDTRHTSQYSTRAEIRNHTVSWNTEHRFICKFRSNTGTNVLEPKFLKISIRMETKGGKSFYKVGFVIINLASFAAMGSATCRRRYILAGYDEKHKRQDNSLLLVSFSMRQLFGDTCFRIPPENLSNCL 168          
BLAST of C2 NT-type domain-containing protein vs. TrEMBL
Match: A0A4E0RJJ3 (C2 NT-type domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_002417 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 2.985e-53
Identity = 88/168 (52.38%), Postives = 124/168 (73.81%), Query Frame = 2
Query:  116 MLCVP--TGKKSYQFEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYNQD-KRQDNSMLQMHFTVCQLFGDPCFRVPDEDTSKCV 610
            M C P  + +K Y FEV + L  L ++P+VN + FAK+RLLD+R++ QYS+R  I+NH V+WN+ H+F C+  +N  TN+LEP  +KIS+R E KGGKSF K+G+V++N+A FA +G   CRRRYIL GY++  KRQDNS+L + F++ QLFGD CFR+P E+ S C+
Sbjct:    1 MDCAPMLSRRKRYHFEVVVRLHSLVAVPYVNAVTFAKLRLLDTRHTSQYSTRAEIRNHTVSWNTEHRFICKFRSNTGTNVLEPKFLKISIRMETKGGKSFYKVGFVIINLASFAAMGSATCRRRYILAGYDEKHKRQDNSLLLVSFSMRQLFGDTCFRIPPENLSNCL 168          
BLAST of C2 NT-type domain-containing protein vs. TrEMBL
Match: A0A2H1CMN0 (C2 NT-type domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_03860 PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 3.285e-53
Identity = 85/159 (53.46%), Postives = 120/159 (75.47%), Query Frame = 2
Query:  137 KKSYQFEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYNQD-KRQDNSMLQMHFTVCQLFGDPCFRVPDEDTSKCV 610
            +K Y FEV + L  L ++P+VN + FAK+RLLD+R++ QYS+R  I+NH V+WN+ H+F C+  +N  TN+LEP  +KIS+R E KGGKSF K+G+V++N+A FA +G   CRRRYIL GY++  KRQDNS+L + F++ QLFGD CFR+P E+ S C+
Sbjct:    5 RKRYHFEVVVRLHSLVAVPYVNAVTFAKLRLLDTRHTSQYSTRAEIRNHTVSWNTEHRFICKFRSNTGTNVLEPKFLKISIRMETKGGKSFYKVGFVIINLASFAAMGSATCRRRYILAGYDEKHKRQDNSLLLVSFSMRQLFGDTCFRIPPENLSNCL 163          
BLAST of C2 NT-type domain-containing protein vs. TrEMBL
Match: A0A4S2MMB5 (C2 NT-type domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000229 PE=4 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 3.381e-52
Identity = 91/168 (54.17%), Postives = 120/168 (71.43%), Query Frame = 2
Query:  116 MLCVPTG--KKSYQFEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYNQ-DKRQDNSMLQMHFTVCQLFGDPCFRVPDEDTSKCV 610
            M CVP    +K YQFE  + L  L S+P+VN + FAK+RLL +RNS QYS R  I+NH V+WN+ HKF C+  +NV+T +LEP+ +KIS+R E KGGKSF K+G+V V++ACF  LG+   RRRYILEGYN+  KR DNS+L + F++ QL GD CFR P E+   C+
Sbjct:    1 MACVPIPGRRKQYQFEAIVKLHSLISVPYVNAVTFAKLRLLGTRNSSQYSPRVEIRNHTVSWNTEHKFLCKFRSNVETTVLEPNILKISIRMETKGGKSFYKVGFVSVDLACFTALGNVTSRRRYILEGYNERHKRLDNSLLLVSFSMRQLLGDTCFRPPPENLRNCL 168          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Cavefish
Match: fam102bb (family with sequence similarity 102 member B [Source:NCBI gene;Acc:103041129])

HSP 1 Score: 132.88 bits (333), Expect = 2.293e-34
Identity = 66/144 (45.83%), Postives = 99/144 (68.75%), Query Frame = 2
Query:  158 VTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            V   L+ELSS+PFVNG+LF K+RLLD   S++ SSRE ++ + V W     F C++ A+  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G T   RR +LEGY+ ++ RQDNS+L++  +   + GDPCF+ P
Sbjct:   11 VDFQLDELSSVPFVNGVLFCKVRLLDGGFSEE-SSREMVQANCVHWRKKFSFPCKMSASAGTGVLDPCVCRVSVRKELKGGKTYAKLGFADLNLAEFAGSGSTT--RRCLLEGYDTKNTRQDNSILKVVISTQLMSGDPCFKTP 151          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Cavefish
Match: fam102aa (protein FAM102A-like [Source:NCBI gene;Acc:103038477])

HSP 1 Score: 133.265 bits (334), Expect = 3.373e-34
Identity = 64/140 (45.71%), Postives = 94/140 (67.14%), Query Frame = 2
Query:  170 LEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            LEEL+++PFVNG+LF K+RLLD  +    SSRE ++ + V W     F C++ AN  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G T   R  +LEGYN ++ RQDNS+L++   +  L  DPCF+ P
Sbjct:   18 LEELTAVPFVNGVLFCKIRLLDGGDFAASSSREEVRENSVRWRKRFSFVCKMSANPNTGVLDPCICRVSVRKELKGGKAYSKLGFADLNMAEFAGSGSTV--RCSLLEGYNTKNTRQDNSILKVTIEMTLLSADPCFKAP 155          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Cavefish
Match: fam102bb (family with sequence similarity 102 member B [Source:NCBI gene;Acc:103041129])

HSP 1 Score: 133.265 bits (334), Expect = 3.642e-34
Identity = 66/144 (45.83%), Postives = 99/144 (68.75%), Query Frame = 2
Query:  158 VTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            V   L+ELSS+PFVNG+LF K+RLLD   S++ SSRE ++ + V W     F C++ A+  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G T   RR +LEGY+ ++ RQDNS+L++  +   + GDPCF+ P
Sbjct:   11 VDFQLDELSSVPFVNGVLFCKVRLLDGGFSEE-SSREMVQANCVHWRKKFSFPCKMSASAGTGVLDPCVCRVSVRKELKGGKTYAKLGFADLNLAEFAGSGSTT--RRCLLEGYDTKNTRQDNSILKVVISTQLMSGDPCFKTP 151          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Cavefish
Match: fam102ab (family with sequence similarity 102 member A [Source:NCBI gene;Acc:103033975])

HSP 1 Score: 130.954 bits (328), Expect = 3.044e-33
Identity = 64/145 (44.14%), Postives = 97/145 (66.90%), Query Frame = 2
Query:  155 EVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            +V   LEEL+++PF+NG+LF K+RLL+  +    SSR+ ++ + V W     F C++ AN  T +L+P   ++SVRKE+KGGK+F K+G+  +N+A FA  G T   R  ILEGY+ ++ RQDNS+L++   +  L GDPCF+ P
Sbjct:   13 QVHFTLEELTAVPFINGMLFCKIRLLEGGDFAIASSRQEVQENCVRWRKKFSFVCKMSANPTTGVLDPCICRVSVRKELKGGKAFSKLGFADLNMAEFAGSGSTV--RCCILEGYDTKNTRQDNSILKVTIGMTLLSGDPCFKTP 155          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Cavefish
Match: fam102bb (family with sequence similarity 102 member B [Source:NCBI gene;Acc:103041129])

HSP 1 Score: 118.627 bits (296), Expect = 3.927e-29
Identity = 60/129 (46.51%), Postives = 90/129 (69.77%), Query Frame = 2
Query:  158 VTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMH 541
            V   L+ELSS+PFVNG+LF K+RLLD   S++ SSRE ++ + V W     F C++ A+  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G T   RR +LEGY+ ++ RQDNS+L++ 
Sbjct:   11 VDFQLDELSSVPFVNGVLFCKVRLLDGGFSEE-SSREMVQANCVHWRKKFSFPCKMSASAGTGVLDPCVCRVSVRKELKGGKTYAKLGFADLNLAEFAGSGSTT--RRCLLEGYDTKNTRQDNSILKVQ 136          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Sea Lamprey
Match: fam102aa (family with sequence similarity 102 member Aa [Source:ZFIN;Acc:ZDB-GENE-081104-233])

HSP 1 Score: 139.428 bits (350), Expect = 4.083e-37
Identity = 66/151 (43.71%), Postives = 102/151 (67.55%), Query Frame = 2
Query:  137 KKSYQFEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            KK Y+F+V L L+ELS +PF+N +LF K+RLLD  N   YSSRE ++ + V W    +F C++ A+  + +L+    ++S+RKE+KGGK++ K+G+  +N+A FA  G     RR +LEGY+ ++ RQDNS+L++   +  L GDPCF+ P
Sbjct:    7 KKRYRFQVVLELDELSHIPFLNAVLFCKLRLLDGGNFTDYSSREEVRENCVRWKKKFEFVCKMTASPTSGVLDHCVCRVSIRKELKGGKAYSKLGFADLNMAEFA--GSRCTTRRCLLEGYDTKNARQDNSILKVIIGMTLLSGDPCFKTP 155          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Medaka
Match: fam102ba (protein FAM102B [Source:NCBI gene;Acc:101166419])

HSP 1 Score: 143.28 bits (360), Expect = 7.085e-38
Identity = 71/151 (47.02%), Postives = 105/151 (69.54%), Query Frame = 2
Query:  137 KKSYQFEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            KK ++F++   L+ELSS+PFVNG+LF K+RLLD   +++ SSR+P+  + V W     F C++ AN  T +L+P   ++SVRKE KGGK+F KMG+  +N++ FA  G T   RR +LEGY+ ++ RQDNS+L++  T   + GDPCF+VP
Sbjct:    8 KKRFKFKIDFDLDELSSVPFVNGVLFCKVRLLDGGFAEE-SSRQPVHANCVRWKKKFSFLCKISANSGTGVLDPCMCRVSVRKEKKGGKTFAKMGFADLNLSEFAGSGTTV--RRCLLEGYDTKNTRQDNSILKVVITTQLMSGDPCFKVP 155          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Medaka
Match: fam102bb (family with sequence similarity 102 member B [Source:NCBI gene;Acc:101160726])

HSP 1 Score: 138.658 bits (348), Expect = 4.389e-36
Identity = 68/144 (47.22%), Postives = 100/144 (69.44%), Query Frame = 2
Query:  158 VTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            V   L+ELSS+PFVNG+LF K+RLLD   S++ SSREP++ + V W     F C++ AN  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G+T   RR +LEGY+ ++ RQDNS+L++      + GDPCF+ P
Sbjct:   15 VDFELDELSSVPFVNGVLFCKVRLLDGGFSEE-SSREPVQANCVRWRKQFSFPCKMSANAGTGVLDPCVCRVSVRKELKGGKTYAKLGFADLNLAEFAGSGNTT--RRCLLEGYDTKNTRQDNSILKVIIGTQLMSGDPCFKTP 155          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Medaka
Match: fam102aa (family with sequence similarity 102 member A [Source:NCBI gene;Acc:101157302])

HSP 1 Score: 127.872 bits (320), Expect = 3.186e-32
Identity = 65/145 (44.83%), Postives = 98/145 (67.59%), Query Frame = 2
Query:  155 EVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            +  L LEEL+++PFVNG+LF K+RLLD  +    SSRE ++ + V W     F  ++ AN  T +L+PS  ++SVRKE+KGGK+++K+G+  +N+A FA  G T   R  +LEGY+ ++ RQDNS+L++   +  L GDPCF+ P
Sbjct:   13 QTQLTLEELTAVPFVNGVLFCKLRLLDG-DFVATSSREEVQENCVCWRKRFTFVSKMSANPHTGVLDPSVCRVSVRKELKGGKAYMKLGFTDLNMAEFAGSGSTI--RCCLLEGYDTKNTRQDNSILKVIIGMTLLSGDPCFKRP 154          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Medaka
Match: fam102bb (family with sequence similarity 102 member B [Source:NCBI gene;Acc:101160726])

HSP 1 Score: 125.176 bits (313), Expect = 1.969e-31
Identity = 63/132 (47.73%), Postives = 93/132 (70.45%), Query Frame = 2
Query:  158 VTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTV 550
            V   L+ELSS+PFVNG+LF K+RLLD   S++ SSREP++ + V W     F C++ AN  T +L+P   ++SVRKE+KGGK++ K+G+  +N+A FA  G+T   RR +LEGY+ ++ RQDNS+L++   V
Sbjct:   11 VDFELDELSSVPFVNGVLFCKVRLLDGGFSEE-SSREPVQANCVRWRKQFSFPCKMSANAGTGVLDPCVCRVSVRKELKGGKTYAKLGFADLNLAEFAGSGNTT--RRCLLEGYDTKNTRQDNSILKVPGCV 139          
BLAST of C2 NT-type domain-containing protein vs. Ensembl Medaka
Match: fam102ba (protein FAM102B [Source:NCBI gene;Acc:101166419])

HSP 1 Score: 121.709 bits (304), Expect = 4.022e-30
Identity = 64/151 (42.38%), Postives = 97/151 (64.24%), Query Frame = 2
Query:  137 KKSYQFEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYN-QDKRQDNSMLQMHFTVCQLFGDPCFRVP 586
            KK ++F++   L+ELSS+PFVNG+LF K+RLLD   +++ SSR+P+  + V W     F C++ AN  T +L+P   ++SVR          KMG+  +N++ FA  G T   RR +LEGY+ ++ RQDNS+L++  T   + GDPCF+VP
Sbjct:    8 KKRFKFKIDFDLDELSSVPFVNGVLFCKVRLLDGGFAEE-SSRQPVHANCVRWKKKFSFLCKISANSGTGVLDPCMCRVSVR----------KMGFADLNLSEFAGSGTTV--RRCLLEGYDTKNTRQDNSILKVVITTQLMSGDPCFKVP 145          
BLAST of C2 NT-type domain-containing protein vs. Planmine SMEST
Match: SMESG000015934.1 (SMESG000015934.1)

HSP 1 Score: 739.569 bits (1908), Expect = 0.000e+0
Identity = 389/390 (99.74%), Postives = 389/390 (99.74%), Query Frame = 2
Query:  116 MLCVPTGKKSYQFEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYNQDKRQDNSMLQMHFTVCQLFGDPCFRVPDEDTSKCVPYEVFSQNKLLIVTPNSSLEGIDGLLDSEPIDSEGNVASFLLNLDQECGITKSGVKLQSKDAVTNIYNEISRQNLTRSQENSSPDYFKKVSNDHCWDVQLGEPLIATIPKFSKQTALTQNPGYSTCPHPMSHSKLSNVSTSQSSKFQPIQLDLDIKSESDHRKHRRFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCTHSRSPQNWISTSLDRCEEQNMIPP 1285
            MLCVPTGKKSYQFEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYNQDKRQDNSMLQMHFTVCQLFGDPCFRVPDEDTSKCVPYEVFSQNKLLIVTPNSSLEGIDGLLDSEPID EGNVASFLLNLDQECGITKSGVKLQSKDAVTNIYNEISRQNLTRSQENSSPDYFKKVSNDHCWDVQLGEPLIATIPKFSKQTALTQNPGYSTCPHPMSHSKLSNVSTSQSSKFQPIQLDLDIKSESDHRKHRRFGSSTQGSGSTAAKTTSSGYGSHSRHSSNESTSCTHSRSPQNWISTSLDRCEEQNMIPP
Sbjct:    1 MLCVPTGKKSYQFEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYNQDKRQDNSMLQMHFTVCQLFGDPCFRVPDEDTSKCVPYEVFSQNKLLIVTPNSSLEGIDGLLDSEPIDPEGNVASFLLNLDQECGITKSGVKLQSKDAVTNIYNEISRQNLTRSQENSSPDYFKKVSNDHCWDVQLGEPLIATIPKFSKQTALTQNPGYSTCPHPMSHSKLSNVSTSQSSKFQPIQLDLDIKSESDHRKHRRFGSSTQGSGSTAAKTTSSGYGSHSRHSSNESTSCTHSRSPQNWISTSLDRCEEQNMIPP 390          
BLAST of C2 NT-type domain-containing protein vs. Planmine SMEST
Match: SMESG000020475.1 (SMESG000020475.1)

HSP 1 Score: 165.622 bits (418), Expect = 9.504e-47
Identity = 75/157 (47.77%), Postives = 102/157 (64.97%), Query Frame = 2
Query:  140 KSYQFEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYNQDKRQDNSMLQMHFTVCQLFGDPCFRVPDEDTSKCV 610
            K   F +TL LEELSS+P VNGI FAK++ L+S     YS    + NH V W S H   C+L    +TN LE + +KI++++E   GK+    G+V++NI+ FA+ G+  CRRRYIL   N+  RQ NS+LQ+   +CQ FGDPCFRVP+ED S C+
Sbjct:    2 KKVHFNITLLLEELSSVPCVNGIFFAKIKFLESLKMTSYSPHTSVSNHKVQWKSNHAIMCKLAIEPETNTLESAFLKITIKQESTDGKTSTNYGFVIINISSFADKGNVECRRRYILASKNESIRQTNSLLQISLQMCQTFGDPCFRVPEEDFSSCI 158          
BLAST of C2 NT-type domain-containing protein vs. Planmine SMEST
Match: SMESG000020475.1 (SMESG000020475.1)

HSP 1 Score: 165.622 bits (418), Expect = 1.407e-46
Identity = 75/157 (47.77%), Postives = 102/157 (64.97%), Query Frame = 2
Query:  140 KSYQFEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSREPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLKMGYVLVNIACFANLGDTACRRRYILEGYNQDKRQDNSMLQMHFTVCQLFGDPCFRVPDEDTSKCV 610
            K   F +TL LEELSS+P VNGI FAK++ L+S     YS    + NH V W S H   C+L    +TN LE + +KI++++E   GK+    G+V++NI+ FA+ G+  CRRRYIL   N+  RQ NS+LQ+   +CQ FGDPCFRVP+ED S C+
Sbjct:   17 KKVHFNITLLLEELSSVPCVNGIFFAKIKFLESLKMTSYSPHTSVSNHKVQWKSNHAIMCKLAIEPETNTLESAFLKITIKQESTDGKTSTNYGFVIINISSFADKGNVECRRRYILASKNESIRQTNSLLQISLQMCQTFGDPCFRVPEEDFSSCI 173          
The following BLAST results are available for this feature:
BLAST of C2 NT-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
FAM102B7.445e-3745.75family with sequence similarity 102 member B [Sour... [more]
FAM102B1.010e-3645.75family with sequence similarity 102 member B [Sour... [more]
FAM102A1.032e-3345.71family with sequence similarity 102 member A [Sour... [more]
back to top
BLAST of C2 NT-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sym-31.264e-2837.33SYM-3B [Source:UniProtKB/TrEMBL;Acc:G5EE38][more]
sym-33.290e-2836.91SYM-3B [Source:UniProtKB/TrEMBL;Acc:G5EE38][more]
back to top
BLAST of C2 NT-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG86712.807e-3744.83gene:FBgn0032938 transcript:FBtr0081484[more]
CG86712.352e-3644.83gene:FBgn0032938 transcript:FBtr0330678[more]
CG86713.813e-3644.83gene:FBgn0032938 transcript:FBtr0330680[more]
CG86713.845e-3644.83gene:FBgn0032938 transcript:FBtr0114602[more]
CG86714.046e-3644.83gene:FBgn0032938 transcript:FBtr0330679[more]
back to top
BLAST of C2 NT-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fam102ba4.119e-3647.92family with sequence similarity 102 member Ba [Sou... [more]
fam102ba5.977e-3647.92family with sequence similarity 102 member Ba [Sou... [more]
fam102aa3.348e-3545.95family with sequence similarity 102 member Aa [Sou... [more]
fam102aa4.660e-3545.95family with sequence similarity 102 member Aa [Sou... [more]
fam102bb5.296e-3546.53family with sequence similarity 102 member Bb [Sou... [more]
back to top
BLAST of C2 NT-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
spi11.569e-3444.16Spi-1 proto-oncogene [Source:Xenbase;Acc:XB-GENE-1... [more]
fam102a2.472e-3444.83family with sequence similarity 102 member A [Sour... [more]
fam102a1.263e-2742.07family with sequence similarity 102 member A [Sour... [more]
spi11.987e-2138.10Spi-1 proto-oncogene [Source:Xenbase;Acc:XB-GENE-1... [more]
back to top
BLAST of C2 NT-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Fam102b1.255e-3645.75family with sequence similarity 102, member B [Sou... [more]
Fam102a1.393e-3345.71family with sequence similarity 102, member A [Sou... [more]
Fam102b2.810e-2641.67family with sequence similarity 102, member B [Sou... [more]
Fam102a6.698e-1147.27family with sequence similarity 102, member A [Sou... [more]
back to top
BLAST of C2 NT-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5T8I3|F102B_HUMAN4.849e-3645.75Protein FAM102B OS=Homo sapiens OX=9606 GN=FAM102B... [more]
sp|Q6GNM6|F102A_XENLA1.766e-3344.14Protein FAM102A OS=Xenopus laevis OX=8355 GN=fam10... [more]
sp|Q5T9C2|F102A_HUMAN4.954e-3345.71Protein FAM102A OS=Homo sapiens OX=9606 GN=FAM102A... [more]
sp|Q78T81|F102A_MOUSE9.741e-3345.71Protein FAM102A OS=Mus musculus OX=10090 GN=Fam102... [more]
sp|Q8BQS4|F102B_MOUSE1.965e-2541.67Protein FAM102B OS=Mus musculus OX=10090 GN=Fam102... [more]
back to top
BLAST of C2 NT-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4P0X98.078e-5549.27C2 NT-type domain-containing protein OS=Paragonimu... [more]
A0A504YQP91.096e-5352.38C2 NT-type domain-containing protein OS=Fasciola g... [more]
A0A4E0RJJ32.985e-5352.38C2 NT-type domain-containing protein OS=Fasciola h... [more]
A0A2H1CMN03.285e-5353.46C2 NT-type domain-containing protein OS=Fasciola h... [more]
A0A4S2MMB53.381e-5254.17C2 NT-type domain-containing protein OS=Opisthorch... [more]
back to top
BLAST of C2 NT-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fam102bb2.293e-3445.83family with sequence similarity 102 member B [Sour... [more]
fam102aa3.373e-3445.71protein FAM102A-like [Source:NCBI gene;Acc:1030384... [more]
fam102bb3.642e-3445.83family with sequence similarity 102 member B [Sour... [more]
fam102ab3.044e-3344.14family with sequence similarity 102 member A [Sour... [more]
fam102bb3.927e-2946.51family with sequence similarity 102 member B [Sour... [more]
back to top
BLAST of C2 NT-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fam102aa4.083e-3743.71family with sequence similarity 102 member Aa [Sou... [more]
back to top
BLAST of C2 NT-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 NT-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 NT-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fam102ba7.085e-3847.02protein FAM102B [Source:NCBI gene;Acc:101166419][more]
fam102bb4.389e-3647.22family with sequence similarity 102 member B [Sour... [more]
fam102aa3.186e-3244.83family with sequence similarity 102 member A [Sour... [more]
fam102bb1.969e-3147.73family with sequence similarity 102 member B [Sour... [more]
fam102ba4.022e-3042.38protein FAM102B [Source:NCBI gene;Acc:101166419][more]
back to top
BLAST of C2 NT-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000015934.10.000e+099.74SMESG000015934.1[more]
SMESG000020475.19.504e-4747.77SMESG000020475.1[more]
SMESG000020475.11.407e-4647.77SMESG000020475.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034396 ID=SMED30034396|Name=C2 NT-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1534bp
TCTATATAAATCTTATATGATCTTTTGTCACATAAAATCATAACAGTAAA
CTTAAATTTCTTCAATATCTGGCTTGTTGTATTTGGAAAAATGATGTTTA
ATCAATGATAAAATTATGCTCTGTGTTCCTACAGGGAAGAAAAGCTACCA
GTTTGAAGTGACACTAGGTCTCGAGGAATTGAGTTCACTTCCATTTGTTA
ACGGAATTTTATTTGCAAAAATGCGATTATTGGACTCGAGAAATTCCAAA
CAGTATTCTTCACGCGAACCAATTAAAAACCATGTAGTGACATGGAACAG
CACTCATAAATTTCAATGCCGCCTGGTGGCCAACGTTCAGACAAACATGC
TAGAACCCAGTGAAATGAAAATATCTGTTAGAAAAGAAATTAAAGGAGGA
AAATCTTTTTTGAAAATGGGATATGTTCTTGTAAATATTGCATGCTTCGC
AAATCTTGGTGATACCGCCTGTCGACGACGGTATATTCTCGAAGGATACA
ATCAAGATAAACGTCAAGACAATTCCATGTTACAAATGCATTTCACAGTT
TGCCAATTATTTGGAGATCCTTGTTTCCGAGTCCCAGATGAAGATACAAG
TAAATGTGTGCCCTATGAAGTATTTTCCCAGAATAAACTGCTAATTGTGA
CTCCTAACAGTAGTCTTGAAGGTATTGATGGACTACTGGATTCAGAACCG
ATAGATTCAGAAGGGAATGTCGCCTCATTTCTTTTGAATCTAGATCAGGA
ATGCGGAATAACAAAATCTGGTGTAAAACTTCAATCAAAAGATGCAGTAA
CTAATATTTACAATGAAATATCTCGTCAGAATTTAACTCGATCTCAAGAA
AATTCCTCACCCGATTACTTTAAAAAAGTCTCGAACGATCACTGTTGGGA
CGTTCAACTTGGAGAGCCCTTAATCGCTACAATACCCAAGTTTTCTAAAC
AAACTGCTTTAACTCAAAACCCCGGCTATTCGACTTGCCCTCATCCTATG
TCCCATTCTAAACTATCAAATGTGTCTACTTCGCAATCTTCAAAGTTTCA
ACCTATTCAATTGGACTTAGACATAAAATCAGAAAGTGATCATAGAAAAC
ATCGACGATTTGGTAGCAGTACTCAAGGCAGCGGCAGTACTGCTGCCAAA
ACAACCAGTTCGGGTTATGGCAGCCATTCTAGACATTCTAGCAATGAATC
TACATCATGTACTCACTCCAGATCTCCTCAAAACTGGATAAGCACCAGTC
TTGACAGGTGCGAAGAACAAAACATGATCCCTCCTTGAAAAACAAAAATA
ACAGAAGATGTAATAGTGAATATTAACGTGACTTTTAAAATTATCATCAA
ATTTCTATTTCCATATTTTGTTTATTTTGCAATTGAATTGTTCTTTGTCT
GAATTTAGATGGTGCTTCTTCGTTCCTGGAATTTTCTCAATTTAATTATT
CTTCATTTTTGAAAATATGGTGTCTACAATTGCTACCAGATTCAAATATT
TAAATACATAATTAGTCAAGAATAATATAAATAG
back to top

protein sequence of SMED30034396-orf-1

>SMED30034396-orf-1 ID=SMED30034396-orf-1|Name=SMED30034396-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=391bp
MLCVPTGKKSYQFEVTLGLEELSSLPFVNGILFAKMRLLDSRNSKQYSSR
EPIKNHVVTWNSTHKFQCRLVANVQTNMLEPSEMKISVRKEIKGGKSFLK
MGYVLVNIACFANLGDTACRRRYILEGYNQDKRQDNSMLQMHFTVCQLFG
DPCFRVPDEDTSKCVPYEVFSQNKLLIVTPNSSLEGIDGLLDSEPIDSEG
NVASFLLNLDQECGITKSGVKLQSKDAVTNIYNEISRQNLTRSQENSSPD
YFKKVSNDHCWDVQLGEPLIATIPKFSKQTALTQNPGYSTCPHPMSHSKL
SNVSTSQSSKFQPIQLDLDIKSESDHRKHRRFGSSTQGSGSTAAKTTSSG
YGSHSRHSSNESTSCTHSRSPQNWISTSLDRCEEQNMIPP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005575cellular_component
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR039931FAM102-like
IPR019448NT-C2
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019448NT-type C2 domainPFAMPF10358NT-C2coord: 8..154
e-value: 4.1E-21
score: 75.2
IPR019448NT-type C2 domainPROSITEPS51840C2_NTcoord: 3..147
score: 28.223
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 334..383
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 319..390
IPR039931Protein FAM102-likePANTHERPTHR21456UNCHARACTERIZEDcoord: 6..365