SIN1

Overview
NameSIN1 (AFH08798.1)
Smed IDSMED30034394
Length (bp)2007
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SIN1 (SMED30034394) t-SNE clustered cells

Violin plots show distribution of expression levels for SIN1 (SMED30034394) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SIN1 (SMED30034394) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SIN1 (SMED30034394) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034394

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior region of the whole animalSMED30034394SMESG000060418.1 dd_Smed_v4_11576_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SIN1 vs. Ensembl Human
Match: MAPKAP1 (MAPK associated protein 1 [Source:HGNC Symbol;Acc:HGNC:18752])

HSP 1 Score: 103.219 bits (256), Expect = 1.911e-22
Identity = 122/518 (23.55%), Postives = 217/518 (41.89%), Query Frame = 1
Query:   61 MSVLSDSEYLLNYVRNSFIYGDDTGICELI-IEKDFPSKFSIQDVLNGEFNYKITDT---SSPHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVPKQ--VKSQTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFP-PETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRDMSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQW----ESLLTISQDSIEID---SQAPKLPFRFKPKIIRIPILFLADC 1572
            M+ L +   +L ++R S +  DDTG+CE++ I+ D   +      + G+   +I  +   +  +  + S +I  + +  + R+ ++   ++ +  K+       + I + E     +  ++  LF   ++ ++  +  + S+LS  LE      +   N F+ Y++F      KG              VG   + K      +Y   +  Q +R  P+ V+ +   +V DLIGL CW+Y  E R P LN+   VS   L++ ED  ++D  F  L+S++PI+K+ FS LA++E                              GL  K                       S+ V+I  AHG S  +    + ++ +I+   V +R   Q     +Y+LE +SEPN  +D+D+ L     + F LVR+ S R   +     E+  + ++ + + L    Y  F    + +     +  L IS D +EID   +Q     F  K K I I    L  C
Sbjct:    1 MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSVDITSSWDFGIRRRSNTAQRLERLR-KERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQSILSVRLEQCP---LQLNNPFNEYSKFDG----KG-------------HVGTTATKK----IDVYLPLHSSQ-DRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDN--VSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE-------------------------KYSSPGLTSKE----------------------SLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFCLVRENSSRADGV---FEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCAC 440          
BLAST of SIN1 vs. Ensembl Human
Match: MAPKAP1 (MAPK associated protein 1 [Source:HGNC Symbol;Acc:HGNC:18752])

HSP 1 Score: 103.219 bits (256), Expect = 1.911e-22
Identity = 122/518 (23.55%), Postives = 217/518 (41.89%), Query Frame = 1
Query:   61 MSVLSDSEYLLNYVRNSFIYGDDTGICELI-IEKDFPSKFSIQDVLNGEFNYKITDT---SSPHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVPKQ--VKSQTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFP-PETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRDMSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQW----ESLLTISQDSIEID---SQAPKLPFRFKPKIIRIPILFLADC 1572
            M+ L +   +L ++R S +  DDTG+CE++ I+ D   +      + G+   +I  +   +  +  + S +I  + +  + R+ ++   ++ +  K+       + I + E     +  ++  LF   ++ ++  +  + S+LS  LE      +   N F+ Y++F      KG              VG   + K      +Y   +  Q +R  P+ V+ +   +V DLIGL CW+Y  E R P LN+   VS   L++ ED  ++D  F  L+S++PI+K+ FS LA++E                              GL  K                       S+ V+I  AHG S  +    + ++ +I+   V +R   Q     +Y+LE +SEPN  +D+D+ L     + F LVR+ S R   +     E+  + ++ + + L    Y  F    + +     +  L IS D +EID   +Q     F  K K I I    L  C
Sbjct:    1 MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSVDITSSWDFGIRRRSNTAQRLERLR-KERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQSILSVRLEQCP---LQLNNPFNEYSKFDG----KG-------------HVGTTATKK----IDVYLPLHSSQ-DRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDN--VSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE-------------------------KYSSPGLTSKE----------------------SLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFCLVRENSSRADGV---FEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCAC 440          
BLAST of SIN1 vs. Ensembl Human
Match: MAPKAP1 (MAPK associated protein 1 [Source:HGNC Symbol;Acc:HGNC:18752])

HSP 1 Score: 92.8189 bits (229), Expect = 6.558e-20
Identity = 81/300 (27.00%), Postives = 127/300 (42.33%), Query Frame = 1
Query:  697 IIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFP-PETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRDMSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQW----ESLLTISQDSIEID---SQAPKLPFRFKPKIIRIPILFLADC 1572
            + V+ +   +V DLIGL CW+Y  E R P LN+   VS   L++ ED  ++D  F  L+S++PI+K+ FS LA++E                              GL  K                       S+ V+I  AHG S  +    + ++ +I+   V +R   Q     +Y+LE +SEPN  +D+D+ L     + F LVR+ S R   +     E+  + ++ + + L    Y  F    + +     +  L IS D +EID   +Q     F  K K I I    L  C
Sbjct:    1 MTVVTMASARVQDLIGLICWQYTSEGREPKLNDN--VSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE-------------------------KYSSPGLTSKE----------------------SLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFCLVRENSSRADGV---FEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCAC 248          
BLAST of SIN1 vs. Ensembl Human
Match: MAPKAP1 (MAPK associated protein 1 [Source:HGNC Symbol;Acc:HGNC:18752])

HSP 1 Score: 92.8189 bits (229), Expect = 6.558e-20
Identity = 81/300 (27.00%), Postives = 127/300 (42.33%), Query Frame = 1
Query:  697 IIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFP-PETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRDMSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQW----ESLLTISQDSIEID---SQAPKLPFRFKPKIIRIPILFLADC 1572
            + V+ +   +V DLIGL CW+Y  E R P LN+   VS   L++ ED  ++D  F  L+S++PI+K+ FS LA++E                              GL  K                       S+ V+I  AHG S  +    + ++ +I+   V +R   Q     +Y+LE +SEPN  +D+D+ L     + F LVR+ S R   +     E+  + ++ + + L    Y  F    + +     +  L IS D +EID   +Q     F  K K I I    L  C
Sbjct:    1 MTVVTMASARVQDLIGLICWQYTSEGREPKLNDN--VSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE-------------------------KYSSPGLTSKE----------------------SLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFCLVRENSSRADGV---FEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCAC 248          
BLAST of SIN1 vs. Ensembl Human
Match: MAPKAP1 (MAPK associated protein 1 [Source:HGNC Symbol;Acc:HGNC:18752])

HSP 1 Score: 92.4337 bits (228), Expect = 4.711e-19
Identity = 106/448 (23.66%), Postives = 193/448 (43.08%), Query Frame = 1
Query:   61 MSVLSDSEYLLNYVRNSFIYGDDTGICELI-IEKDFPSKFSIQDVLNGEFNYKITDT---SSPHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVPKQ--VKSQTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFP-PETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRD--MSRRKPAIPDLINEECS 1377
            M+ L +   +L ++R S +  DDTG+CE++ I+ D   +      + G+   +I  +   +  +  + S +I  + +  + R+ ++   ++ +  K+       + I + E     +  ++  LF   ++ ++  +  + S+LS  LE      +   N F+ Y++F      KG              VG   + K      +Y   +  Q +R  P+ V+ +   +V DLIGL CW+Y  E R P LN+   VS   L++ ED  ++D  F  L+S++PI+K+ FS LA++E                              GL  K                       S+ V+I  AHG S  +    + ++ +I+   V +R   Q     +Y+LE +SEPN  +D+D+ L     + F LVR+  +S  K  I  + N++ S
Sbjct:    1 MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSVDITSSWDFGIRRRSNTAQRLERLR-KERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQSILSVRLEQCP---LQLNNPFNEYSKFDG----KG-------------HVGTTATKK----IDVYLPLHSSQ-DRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDN--VSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE-------------------------KYSSPGLTSKE----------------------SLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFCLVRENSISGDKVEIDPVTNQKAS 373          
BLAST of SIN1 vs. Ensembl Zebrafish
Match: mapkap1 (MAPK associated protein 1 [Source:ZFIN;Acc:ZDB-GENE-041111-178])

HSP 1 Score: 79.7221 bits (195), Expect = 3.907e-15
Identity = 60/215 (27.91%), Postives = 94/215 (43.72%), Query Frame = 1
Query:  691 NPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFPP----ETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVR 1323
            +P+ V+ +   +V DLIGL CW+Y  E R P L     V+   L++ ED  ++D  F  L+S++PI+K+ FS LA++E                       +     +G +Q                        S+ V+I  AHG   F   P    + ++  I+Q  + KR   Q G    Y+LE + EPN  +D+D++L       F LVR
Sbjct:  197 HPMTVVTMANARVHDLIGLICWQYTCEGREPKLTEN--VNTYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE-----------------------KYSSPGLGPKQ------------------------SLFVRINAAHG---FSLIPVDSLKVTMKDILQKALKKRKGSQKGSGPLYRLEKQMEPNVAVDLDSSLENQGTLEFCLVR 359          
BLAST of SIN1 vs. Ensembl Xenopus
Match: mapkap1 (MAPK associated protein 1 [Source:NCBI gene;Acc:100101680])

HSP 1 Score: 101.293 bits (251), Expect = 7.927e-22
Identity = 120/520 (23.08%), Postives = 217/520 (41.73%), Query Frame = 1
Query:   61 MSVLSDSEYLLNYVRNSFIYGDDTGICELI-IEKDFPSKFSIQDVLNGEFNYKITDTSS---PHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVPKQV--KSQTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRF-PPETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRD--MSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQW----ESLLTISQDSIEID---SQAPKLPFRFKPKIIRIPILFLADC 1572
            M+ L +   +L ++R S +  DDTG+CE++ I+ D   +   Q  ++GE + ++         +  S S +I  + +  + R+ ++   ++ +  K+       + + + +     +  +++ LF   N  ++   + + S+LS  LE      +   N F+ Y++F      KG              VG   + K      +Y    +  +++  P+ V+ +   KV DLIGL CW+Y  E R P LN+   V    L++ ED  ++D  F  L+S++PI+K+ FS LA++E                              GL  K                       S+ V+I  AHG S  +      ++  I++  + +R   Q     +Y+LE +S+PN  +D+D+ L    +  F LVR+  M  R    P+   EE  + ++ + + L    Y  F    + +     +  L IS + +EID   +Q     F  K K I I    L  C
Sbjct:    1 MAFLDNPLIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKLYQSSVSGENSTQMQSNGGETQGYVYSQSVDITSSWDFGIRRRSNTAQKLERLR-KERQNQIKCKNVQWKDRNTSHSAEELSSLFERKNFKERALNQGKQSILSVRLEQCP---LQLNNPFNEYSKFDG----KG-------------HVGTTATKK----IDVYL-SMQTSQDKLLPMTVVTIANAKVHDLIGLICWQYTTEGREPKLNDN--VDAFCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE-------------------------KYSSPGLAAKQ----------------------SLFVRINAAHGFSLIQVDSTNVTMRDILEKALKRRKGSQRNSGPQYRLEKQSQPNVPVDLDSTLENQNSLEFCLVRENSMCSRGEEPPE---EETQIDIATVQDMLSSHQYKSFKVSMIHRLRFTTDVQLGISGEKVEIDPVTNQKTSTKFWIKQKPISIDSDVLCAC 442          
BLAST of SIN1 vs. Ensembl Xenopus
Match: mapkap1 (MAPK associated protein 1 [Source:NCBI gene;Acc:100101680])

HSP 1 Score: 93.2041 bits (230), Expect = 1.851e-19
Identity = 104/448 (23.21%), Postives = 193/448 (43.08%), Query Frame = 1
Query:   61 MSVLSDSEYLLNYVRNSFIYGDDTGICELI-IEKDFPSKFSIQDVLNGEFNYKITDT---SSPHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVPKQVKSQ--TSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRF-PPETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRD--MSRRKPAIPDLINEECS 1377
            M+ L +   +L ++R S +  DDTG+CE++ I+ D   +   Q  ++GE + ++      +  +  S S +I  + +  + R+ ++   ++ +  K+       + + + +     +  +++ LF   N  ++  +Q   S+LS  LE      +   N F+ Y++F      KG              VG   + K      +Y    +  +++  P+ V+ +   KV DLIGL CW+Y  E R P LN+   V    L++ ED  ++D  F  L+S++PI+K+ FS LA++E                              GL  K                       S+ V+I  AHG S  +      ++  I++  + +R   Q     +Y+LE +S+PN  +D+D+ L    +  F LVR+  +S  K  I  + N++ S
Sbjct:    1 MAFLDNPLIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKLYQSSVSGENSTQMQSNGGETQGYVYSQSVDITSSWDFGIRRRSNTAQKLERLR-KERQNQIKCKNVQWKDRNTSHSAEELSSLFERKNFKERALNQGKQSILSVRLEQCP---LQLNNPFNEYSKFDG----KG-------------HVGTTATKK----IDVYL-SMQTSQDKLLPMTVVTIANAKVHDLIGLICWQYTTEGREPKLNDN--VDAFCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE-------------------------KYSSPGLAAKQ----------------------SLFVRINAAHGFSLIQVDSTNVTMRDILEKALKRRKGSQRNSGPQYRLEKQSQPNVPVDLDSTLENQNSLEFCLVRENRISGEKVEIDPVTNQKTS 373          
BLAST of SIN1 vs. Ensembl Xenopus
Match: mapkap1 (MAPK associated protein 1 [Source:NCBI gene;Acc:100101680])

HSP 1 Score: 79.337 bits (194), Expect = 6.222e-15
Identity = 72/294 (24.49%), Postives = 140/294 (47.62%), Query Frame = 1
Query:   61 MSVLSDSEYLLNYVRNSFIYGDDTGICELI-IEKDFPSKFSIQDVLNGEFNYKITDT---SSPHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVPKQV--KSQTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILE 924
            M+ L +   +L ++R S +  DDTG+CE++ I+ D   +   Q  ++GE + ++      +  +  S S +I  + +  + R+ ++   ++ +  K+       + + + +     +  +++ LF   N  ++   + + S+LS  LE      +   N F+ Y++F      KG              VG   + K      +Y    +  +++  P+ V+ +   KV DLIGL CW+Y  E R P LN+   V    L++ ED  ++D  F  L+S++PI+K+ FS LA++E
Sbjct:    1 MAFLDNPLIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKLYQSSVSGENSTQMQSNGGETQGYVYSQSVDITSSWDFGIRRRSNTAQKLERLR-KERQNQIKCKNVQWKDRNTSHSAEELSSLFERKNFKERALNQGKQSILSVRLEQCP---LQLNNPFNEYSKFDG----KG-------------HVGTTATKK----IDVYL-SMQTSQDKLLPMTVVTIANAKVHDLIGLICWQYTTEGREPKLNDN--VDAFCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE 266          
BLAST of SIN1 vs. Ensembl Xenopus
Match: mapkap1 (MAPK associated protein 1 [Source:NCBI gene;Acc:100101680])

HSP 1 Score: 72.4034 bits (176), Expect = 9.939e-13
Identity = 68/287 (23.69%), Postives = 133/287 (46.34%), Query Frame = 1
Query:   61 MSVLSDSEYLLNYVRNSFIYGDDTGICELI-IEKDFPSKFSIQDVLNGEFNYKITDTSS---PHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVPKQV--KSQTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQF 903
            M+ L +   +L ++R S +  DDTG+CE++ I+ D   +   Q  ++GE + ++         +  S S +I  + +  + R+ ++   ++ +  K+       + + + +     +  +++ LF   N  ++   + + S+LS  LE      +   N F+ Y++F      KG              VG   + K      +Y    +  +++  P+ V+ +   KV DLIGL CW+Y  E R P LN+   V    L++ ED  ++D  F  L+S++PI+K+ F
Sbjct:    1 MAFLDNPLIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKLYQSSVSGENSTQMQSNGGETQGYVYSQSVDITSSWDFGIRRRSNTAQKLERLR-KERQNQIKCKNVQWKDRNTSHSAEELSSLFERKNFKERALNQGKQSILSVRLEQCP---LQLNNPFNEYSKFDG----KG-------------HVGTTATKK----IDVYL-SMQTSQDKLLPMTVVTIANAKVHDLIGLICWQYTTEGREPKLNDN--VDAFCLHIAEDDGEVDTDFPPLDSNEPIHKFGF 259          
BLAST of SIN1 vs. Ensembl Mouse
Match: Mapkap1 (mitogen-activated protein kinase associated protein 1 [Source:MGI Symbol;Acc:MGI:2444554])

HSP 1 Score: 102.834 bits (255), Expect = 1.827e-22
Identity = 122/518 (23.55%), Postives = 218/518 (42.08%), Query Frame = 1
Query:   61 MSVLSDSEYLLNYVRNSFIYGDDTGICELI-IEKDFPSKFSIQDVLNGEFNYKITDTSS---PHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVPKQVKS--QTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFP-PETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRDMSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQW----ESLLTISQDSIEID---SQAPKLPFRFKPKIIRIPILFLADC 1572
            M+ L +   +L ++R S +  DDTG+CE++ I+ D   + +    + G+   ++  +S     +  + S +I  + +  + R+ ++   ++ +  K+       + I + E     +  ++  LF   ++ ++  S  + S+LS  LE      +   N F+ Y++F      KG              VG   + K      +Y   +  Q +R  P+ V+ +   +V DLIGL CW+Y  E R P LN+   VS   L++ ED  ++D  F  L+S++PI+K+ FS LA++E                              GL  K                       S+ V+I  AHG S  +    + ++ +I+   V +R   Q     +Y+LE +SEPN  +D+++ L     + F LVR+ S R   +     E+  + ++ + + L    Y  F    + +     +  L IS D +EID   +Q     F  K K I I    L  C
Sbjct:    1 MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKTHPPSVPGDSGSEVQGSSGETQGYIYAQSVDITSSWDFGIRRRSNTAQRLERLR-KERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPSSGKQSILSVRLEQCP---LQLNNPFNEYSKFDG----KG-------------HVGTTATKK----IDVYLPLHSSQ-DRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDN--VSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE-------------------------KYSSPGLTSKE----------------------SLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKISGPQYRLEKQSEPNIAVDLESTLESQNAWEFCLVRENSSRADGV---FEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDCDLLCAC 440          
BLAST of SIN1 vs. Ensembl Mouse
Match: Mapkap1 (mitogen-activated protein kinase associated protein 1 [Source:MGI Symbol;Acc:MGI:2444554])

HSP 1 Score: 102.834 bits (255), Expect = 1.827e-22
Identity = 122/518 (23.55%), Postives = 218/518 (42.08%), Query Frame = 1
Query:   61 MSVLSDSEYLLNYVRNSFIYGDDTGICELI-IEKDFPSKFSIQDVLNGEFNYKITDTSS---PHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVPKQVKS--QTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFP-PETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRDMSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQW----ESLLTISQDSIEID---SQAPKLPFRFKPKIIRIPILFLADC 1572
            M+ L +   +L ++R S +  DDTG+CE++ I+ D   + +    + G+   ++  +S     +  + S +I  + +  + R+ ++   ++ +  K+       + I + E     +  ++  LF   ++ ++  S  + S+LS  LE      +   N F+ Y++F      KG              VG   + K      +Y   +  Q +R  P+ V+ +   +V DLIGL CW+Y  E R P LN+   VS   L++ ED  ++D  F  L+S++PI+K+ FS LA++E                              GL  K                       S+ V+I  AHG S  +    + ++ +I+   V +R   Q     +Y+LE +SEPN  +D+++ L     + F LVR+ S R   +     E+  + ++ + + L    Y  F    + +     +  L IS D +EID   +Q     F  K K I I    L  C
Sbjct:    1 MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKTHPPSVPGDSGSEVQGSSGETQGYIYAQSVDITSSWDFGIRRRSNTAQRLERLR-KERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPSSGKQSILSVRLEQCP---LQLNNPFNEYSKFDG----KG-------------HVGTTATKK----IDVYLPLHSSQ-DRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDN--VSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE-------------------------KYSSPGLTSKE----------------------SLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKISGPQYRLEKQSEPNIAVDLESTLESQNAWEFCLVRENSSRADGV---FEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDCDLLCAC 440          
BLAST of SIN1 vs. Ensembl Mouse
Match: Mapkap1 (mitogen-activated protein kinase associated protein 1 [Source:MGI Symbol;Acc:MGI:2444554])

HSP 1 Score: 90.8929 bits (224), Expect = 2.147e-19
Identity = 80/300 (26.67%), Postives = 127/300 (42.33%), Query Frame = 1
Query:  697 IIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFP-PETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRDMSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQW----ESLLTISQDSIEID---SQAPKLPFRFKPKIIRIPILFLADC 1572
            + V+ +   +V DLIGL CW+Y  E R P LN+   VS   L++ ED  ++D  F  L+S++PI+K+ FS LA++E                              GL  K                       S+ V+I  AHG S  +    + ++ +I+   V +R   Q     +Y+LE +SEPN  +D+++ L     + F LVR+ S R   +     E+  + ++ + + L    Y  F    + +     +  L IS D +EID   +Q     F  K K I I    L  C
Sbjct:    1 MTVVTMASARVQDLIGLICWQYTSEGREPKLNDN--VSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE-------------------------KYSSPGLTSKE----------------------SLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKISGPQYRLEKQSEPNIAVDLESTLESQNAWEFCLVRENSSRADGV---FEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDCDLLCAC 248          
BLAST of SIN1 vs. Ensembl Mouse
Match: Mapkap1 (mitogen-activated protein kinase associated protein 1 [Source:MGI Symbol;Acc:MGI:2444554])

HSP 1 Score: 90.5077 bits (223), Expect = 2.232e-19
Identity = 80/300 (26.67%), Postives = 127/300 (42.33%), Query Frame = 1
Query:  697 IIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFP-PETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRDMSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQW----ESLLTISQDSIEID---SQAPKLPFRFKPKIIRIPILFLADC 1572
            + V+ +   +V DLIGL CW+Y  E R P LN+   VS   L++ ED  ++D  F  L+S++PI+K+ FS LA++E                              GL  K                       S+ V+I  AHG S  +    + ++ +I+   V +R   Q     +Y+LE +SEPN  +D+++ L     + F LVR+ S R   +     E+  + ++ + + L    Y  F    + +     +  L IS D +EID   +Q     F  K K I I    L  C
Sbjct:    1 MTVVTMASARVQDLIGLICWQYTSEGREPKLNDN--VSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE-------------------------KYSSPGLTSKE----------------------SLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKISGPQYRLEKQSEPNIAVDLESTLESQNAWEFCLVRENSSRADGV---FEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDCDLLCAC 248          
BLAST of SIN1 vs. Ensembl Mouse
Match: Mapkap1 (mitogen-activated protein kinase associated protein 1 [Source:MGI Symbol;Acc:MGI:2444554])

HSP 1 Score: 77.411 bits (189), Expect = 1.705e-14
Identity = 74/294 (25.17%), Postives = 140/294 (47.62%), Query Frame = 1
Query:   61 MSVLSDSEYLLNYVRNSFIYGDDTGICELI-IEKDFPSKFSIQDVLNGEFNYKITDTSS---PHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVPKQVKS--QTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILE 924
            M+ L +   +L ++R S +  DDTG+CE++ I+ D   + +    + G+   ++  +S     +  + S +I  + +  + R+ ++   ++ +  K+       + I + E     +  ++  LF   ++ ++  S  + S+LS  LE      +   N F+ Y++F      KG              VG   + K      +Y   +  Q +R  P+ V+ +   +V DLIGL CW+Y  E R P LN+   VS   L++ ED  ++D  F  L+S++PI+K+ FS LA++E
Sbjct:    1 MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKTHPPSVPGDSGSEVQGSSGETQGYIYAQSVDITSSWDFGIRRRSNTAQRLERLR-KERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPSSGKQSILSVRLEQCP---LQLNNPFNEYSKFDG----KG-------------HVGTTATKK----IDVYLPLHSSQ-DRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDN--VSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE 266          
BLAST of SIN1 vs. UniProt/SwissProt
Match: sp|Q9W6S3|SIN1_CHICK (Target of rapamycin complex 2 subunit MAPKAP1 OS=Gallus gallus OX=9031 GN=MAPKAP1 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 7.918e-24
Identity = 137/531 (25.80%), Postives = 217/531 (40.87%), Query Frame = 1
Query:   61 MSVLSDSEYLLNYVRNSFIYGDDTGICELII-------EKDFPSK-----FSIQDVLNGE-----FNYKITDTSSPHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSN--VPKQVKSQTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFPP-ETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRDMSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQW----ESLLTISQDSIEID---SQAPKLPFRFKPKIIRIPILFLADC 1572
            M+ L +   +L ++R S +  DDTG+CE+++       EK  PS       S     NGE     ++  +  TSS  F      I   SNTA  ++L      ++ ++K  ++    R  ++S         +++ LF   N  V      + S+LS  LE      +   N F+ Y++F      KG              VG   + K      +Y   +  Q ++  P+ V+ +   KV DLIGL CW+Y  E R P LN+   VS   L++ ED  ++D  F  L+S++PI+K+ FS LA++E                              GL  K                       S+ V+I  AHG S  +    + ++  I+Q  + +R   Q G   +Y+LE +SEPN  +D+D  L       F LVR+ S R   I +   E+  + ++ + + L    Y  F    + +     +  L IS D +EID   +Q     F  K K I I    L  C
Sbjct:    1 MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKFNPSSTYGDSASETQGSNGETQGYVYSQSVDITSSWDF-----GIRRRSNTA--QRLERLRKERQNQIKCKNVQWKDRNTSYSA-------EELSSLFEKKNFRVRSPCSGKQSILSVRLEQCP---LQLNNPFNEYSKFDG----KG-------------HVGTTATKK----IDVYLPLHANQ-DKLQPMTVVTIANAKVHDLIGLICWQYTSEGREPKLNDN--VSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE-------------------------KYSSPGLAAKQ----------------------SLFVRINAAHGFSLIQVDSMKVTMKDILQKALKRRKGSQRGSGPQYRLEKQSEPNVPVDLDCTLESQSTLEFCLVRENSSRGEEISE---EDPQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSELLCAC 440          
BLAST of SIN1 vs. UniProt/SwissProt
Match: sp|A4IIM3|SIN1_XENTR (Target of rapamycin complex 2 subunit MAPKAP1 OS=Xenopus tropicalis OX=8364 GN=mapkap1 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 3.801e-22
Identity = 120/518 (23.17%), Postives = 217/518 (41.89%), Query Frame = 1
Query:   61 MSVLSDSEYLLNYVRNSFIYGDDTGICELI-IEKDFPSKFSIQDVLNGEFNYKITDTSS---PHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVPKQV--KSQTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRF-PPETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRDMSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQW----ESLLTISQDSIEID---SQAPKLPFRFKPKIIRIPILFLADC 1572
            M+ L +   +L ++R S +  DDTG+CE++ I+ D   +   Q  ++GE + ++         +  S S +I  + +  + R+ ++   ++ +  K+       + + + +     +  +++ LF   N  ++   + + S+LS  LE      +   N F+ Y++F      KG              VG   + K      +Y    +  +++  P+ V+ +   KV DLIGL CW+Y  E R P LN+   V    L++ ED  ++D  F  L+S++PI+K+ FS LA++E                              GL  K                       S+ V+I  AHG S  +      ++  I++  + +R   Q     +Y+LE +S+PN  +D+D+ L    +  F LVR+ S R    P+   EE  + ++ + + L    Y  F    + +     +  L IS + +EID   +Q     F  K K I I    L  C
Sbjct:    1 MAFLDNPLIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKLYQSSVSGENSTQMQSNGGETQGYVYSQSVDITSSWDFGIRRRSNTAQKLERLR-KERQNQIKCKNVQWKDRNTSHSAEELSSLFERKNFKERALNQGKQSILSVRLEQCP---LQLNNPFNEYSKFDG----KG-------------HVGTTATKK----IDVYL-SMQTSQDKLLPMTVVTIANAKVHDLIGLICWQYTTEGREPKLNDN--VDAFCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE-------------------------KYSSPGLAAKQ----------------------SLFVRINAAHGFSLIQVDSTNVTMRDILEKALKRRKGSQRNSGPQYRLEKQSQPNVPVDLDSTLENQNSLEFCLVRENSSRGEEPPE---EETQIDIATVQDMLSSHQYKSFKVSMIHRLRFTTDVQLGISGEKVEIDPVTNQKTSTKFWIKQKPISIDSDVLCAC 440          
BLAST of SIN1 vs. UniProt/SwissProt
Match: sp|Q9BPZ7|SIN1_HUMAN (Target of rapamycin complex 2 subunit MAPKAP1 OS=Homo sapiens OX=9606 GN=MAPKAP1 PE=1 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 9.178e-22
Identity = 122/518 (23.55%), Postives = 217/518 (41.89%), Query Frame = 1
Query:   61 MSVLSDSEYLLNYVRNSFIYGDDTGICELI-IEKDFPSKFSIQDVLNGEFNYKITDT---SSPHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVPKQ--VKSQTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFP-PETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRDMSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQW----ESLLTISQDSIEID---SQAPKLPFRFKPKIIRIPILFLADC 1572
            M+ L +   +L ++R S +  DDTG+CE++ I+ D   +      + G+   +I  +   +  +  + S +I  + +  + R+ ++   ++ +  K+       + I + E     +  ++  LF   ++ ++  +  + S+LS  LE      +   N F+ Y++F      KG              VG   + K      +Y   +  Q +R  P+ V+ +   +V DLIGL CW+Y  E R P LN+   VS   L++ ED  ++D  F  L+S++PI+K+ FS LA++E                              GL  K                       S+ V+I  AHG S  +    + ++ +I+   V +R   Q     +Y+LE +SEPN  +D+D+ L     + F LVR+ S R   +     E+  + ++ + + L    Y  F    + +     +  L IS D +EID   +Q     F  K K I I    L  C
Sbjct:    1 MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSVDITSSWDFGIRRRSNTAQRLERLR-KERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQSILSVRLEQCP---LQLNNPFNEYSKFDG----KG-------------HVGTTATKK----IDVYLPLHSSQ-DRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDN--VSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE-------------------------KYSSPGLTSKE----------------------SLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFCLVRENSSRADGV---FEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCAC 440          
BLAST of SIN1 vs. UniProt/SwissProt
Match: sp|Q7ZYH1|SIN1_XENLA (Target of rapamycin complex 2 subunit MAPKAP1 OS=Xenopus laevis OX=8355 GN=mapkap1 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.155e-21
Identity = 128/534 (23.97%), Postives = 213/534 (39.89%), Query Frame = 1
Query:   61 MSVLSDSEYLLNYVRNSFIYGDDTGICELII-----------EKDFPSKFSIQDVLNGE------FNYKITDTSSPHFRSSSPEIPLTSNTA-----VARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVPKQVKSQTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRF-PPETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRDMSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQW----ESLLTISQDSIEID---SQAPKLPFRFKPKIIRIPILFLADC 1572
            M+ L +   +L ++R S +  DDTG+CE+++           +   P + S Q   NG       ++  +  TSS  F      I   SNTA     + ++  ++   K V+ KD +       +      +   E D+N              + S+LS  LE      +   N F+ Y++F      KG              VG   + K      +Y    +  +++  P+ V+ +   KV DLIGL CW+Y  E+R P LN+   V    L++ ED  ++D  F  L+S++PI+K+ FS LA++E                              GL  K                       S+ V+I  AHG S  +      ++ +I++  + +R   Q     +Y+LE +S+PN  +D+D+ L    +  F LVR+ S R    P+   EE  + ++ + + L    Y  F    + +     +  L IS + +EID   +Q     F  K K I I    L  C
Sbjct:    1 MAFLDNPLIILAHIRQSHVTSDDTGMCEMVLIDHDIDLEKLYQSSVPGENSTQMQSNGGETQGYVYSQSVDITSSWDFG-----IRRRSNTAQKLERLRKERQNQIKCKNVQWKDRNTSHSAEELGSLFERKNFKERDLN------------HGKQSILSVRLEQCP---LQLNNPFNEYSKFDG----KG-------------HVGTTATKK----IDVYL-SMQTSQDKLLPMTVVTIANAKVHDLIGLICWQYTTESREPKLNDN--VDAFCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE-------------------------KYSSPGLAAKQ----------------------SLFVRINAAHGFSLIQVDSTNVTMQEILEKALKRRKGSQRNSGPQYRLEKQSQPNVPVDLDSTLESQNSLEFCLVRENSSRGEEHPE---EETQIDIATVQDMLSSHQYKSFKVSMIHRLRFTTDVQLGISGEKVEIDPVTNQKTSTKFWIKQKPISIDSDLLCAC 440          
BLAST of SIN1 vs. UniProt/SwissProt
Match: sp|Q8BKH7|SIN1_MOUSE (Target of rapamycin complex 2 subunit MAPKAP1 OS=Mus musculus OX=10090 GN=Mapkap1 PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.278e-21
Identity = 122/518 (23.55%), Postives = 218/518 (42.08%), Query Frame = 1
Query:   61 MSVLSDSEYLLNYVRNSFIYGDDTGICELI-IEKDFPSKFSIQDVLNGEFNYKITDTSS---PHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVPKQVKS--QTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFP-PETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRDMSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQW----ESLLTISQDSIEID---SQAPKLPFRFKPKIIRIPILFLADC 1572
            M+ L +   +L ++R S +  DDTG+CE++ I+ D   + +    + G+   ++  +S     +  + S +I  + +  + R+ ++   ++ +  K+       + I + E     +  ++  LF   ++ ++  S  + S+LS  LE      +   N F+ Y++F      KG              VG   + K      +Y   +  Q +R  P+ V+ +   +V DLIGL CW+Y  E R P LN+   VS   L++ ED  ++D  F  L+S++PI+K+ FS LA++E                              GL  K                       S+ V+I  AHG S  +    + ++ +I+   V +R   Q     +Y+LE +SEPN  +D+++ L     + F LVR+ S R   +     E+  + ++ + + L    Y  F    + +     +  L IS D +EID   +Q     F  K K I I    L  C
Sbjct:    1 MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKTHPPSVPGDSGSEVQGSSGETQGYIYAQSVDITSSWDFGIRRRSNTAQRLERLR-KERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPSSGKQSILSVRLEQCP---LQLNNPFNEYSKFDG----KG-------------HVGTTATKK----IDVYLPLHSSQ-DRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDN--VSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE-------------------------KYSSPGLTSKE----------------------SLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKISGPQYRLEKQSEPNIAVDLESTLESQNAWEFCLVRENSSRADGV---FEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDCDLLCAC 440          
BLAST of SIN1 vs. TrEMBL
Match: H9XVZ9 (SIN1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 692.575 bits (1786), Expect = 0.000e+0
Identity = 355/357 (99.44%), Postives = 357/357 (100.00%), Query Frame = 1
Query:  400 ENDINDLFGVSNVPKQVKSQTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFPPETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRDMSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQWESLLT 1470
            ENDINDLFGVSNVPKQVKSQTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRSKFVSVSSMISDSSFVTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFPPETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVR+MSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQWESLL+
Sbjct:    7 ENDINDLFGVSNVPKQVKSQTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRSKFVSVSSMISDSSFVTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFPPETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVREMSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQWESLLS 363          
BLAST of SIN1 vs. TrEMBL
Match: A0A5K4EN27 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.092e-25
Identity = 148/557 (26.57%), Postives = 239/557 (42.91%), Query Frame = 1
Query:   88 LLNYVRNSFIYGDDTGICELIIE--KDFPSKFSIQDVLNGEFNYKITDTSSPHFRSSSPEIPLTSN----TAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVP-KQVKSQTSVLSKLLESTSKEEIVSVN-IFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNP---IIVLPVLETKVSDLIGLACWKYVEENRSPPLNNA-----------SIVSKLKLYMF-------EDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFPPETSVGQIIQHTVNKRHLQQHGENYRYKLELESE-----------------PNKELDIDTNLSQFEN----FSFVLVRDMSRRKPAIPDLINE-------ECSLSLSKMME----CLDKKTYNVFLKKPLKQWESLLTISQDSIEIDSQAPKLPFRF-KPKIIRIPILFLADC 1572
            +LNYVRN F  GDD+G CE ++   KD   +  I+ +L+G++  ++ +T S  F   SPE          +A    ++S    ++  L      ++ R ++  E  +      I      +N P   +KS+ S L+  LE       +  N +FS++A + A R T G     N+ + +  F   N  +  +R+F ++ W     R R  P   I V P L T V   +GL  W+Y  E  +  +++            S +++L L+MF       +D ED+D  F  L  +DPI+KY+F   A++E                       Q+ +E+   ++ S                       +LV I +A G+S  RFP +T +  +++  V +R L+QHG  Y Y+LEL                     N +LD+   LS F        F+LVR+ SR   A+ D  ++       E  L+L   +E     L  + Y V   K L   E  L IS + ++I+ + PKL  +  KP II+I    +ADC
Sbjct:   10 ILNYVRNCFASGDDSGFCEKLLNKVKDVTDE-EIESILSGQYFNEVVNTDSDDFYRHSPECAFVPCEDPLSAFYSSINSFEDSQQSSLSHKKNASNIRQLSAEEVDKYFPSKPIVR----TNKPDTALKSEKSGLTLALEQAKLSGHLKRNKLFSDFAIYDA-RSTLG----TNQRVPDSRFPDAN-VDPSLRQFNVWLW-----RLRGFPRTSIKVQPRLGTTVQQFVGLTLWQYFNEFSTSDVDSTLAPTQLDDLDESFLNRLALHMFDTLDDEYDDNEDVDSEFPPLELNDPIHKYEFKSFALVE---------------------RVQTPLEEASKKEIS----------------------HVLVTIHMAQGMSVLRFPSDTCLSTVLERAVYRRRLRQHG-GYAYRLELWPRNTDQQNNNIKSNNILLNKNSQLDLSKPLSYFIAAGLPLHFLLVRESSRCDTALSDQNDDIEATKTLESMLALDTTLEPVHTALHLRQYQVTYLKGLFPPEVQLNISSNELKIEQKRPKLFSKLMKPIIIQINA--IADC 504          
BLAST of SIN1 vs. TrEMBL
Match: A0A3Q0KMI7 (CRIM domain-containing protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.490e-25
Identity = 148/557 (26.57%), Postives = 239/557 (42.91%), Query Frame = 1
Query:   88 LLNYVRNSFIYGDDTGICELIIE--KDFPSKFSIQDVLNGEFNYKITDTSSPHFRSSSPEIPLTSN----TAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVP-KQVKSQTSVLSKLLESTSKEEIVSVN-IFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNP---IIVLPVLETKVSDLIGLACWKYVEENRSPPLNNA-----------SIVSKLKLYMF-------EDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFPPETSVGQIIQHTVNKRHLQQHGENYRYKLELESE-----------------PNKELDIDTNLSQFEN----FSFVLVRDMSRRKPAIPDLINE-------ECSLSLSKMME----CLDKKTYNVFLKKPLKQWESLLTISQDSIEIDSQAPKLPFRF-KPKIIRIPILFLADC 1572
            +LNYVRN F  GDD+G CE ++   KD   +  I+ +L+G++  ++ +T S  F   SPE          +A    ++S    ++  L      ++ R ++  E  +      I      +N P   +KS+ S L+  LE       +  N +FS++A + A R T G     N+ + +  F   N  +  +R+F ++ W     R R  P   I V P L T V   +GL  W+Y  E  +  +++            S +++L L+MF       +D ED+D  F  L  +DPI+KY+F   A++E                       Q+ +E+   ++ S                       +LV I +A G+S  RFP +T +  +++  V +R L+QHG  Y Y+LEL                     N +LD+   LS F        F+LVR+ SR   A+ D  ++       E  L+L   +E     L  + Y V   K L   E  L IS + ++I+ + PKL  +  KP II+I    +ADC
Sbjct:   10 ILNYVRNCFASGDDSGFCEKLLNKVKDVTDE-EIESILSGQYFNEVVNTDSDDFYRHSPECAFVPCEDPLSAFYSSINSFEDSQQSSLSHKKNASNIRQLSAEEVDKYFPSKPI----VRTNKPDTALKSEKSGLTLALEQAKLSGHLKRNKLFSDFAIYDA-RSTLG----TNQRVPDSRFPDAN-VDPSLRQFNVWLW-----RLRGFPRTSIKVQPRLGTTVQQFVGLTLWQYFNEFSTSDVDSTLAPTQLDDLDESFLNRLALHMFDTLDDEYDDNEDVDSEFPPLELNDPIHKYEFKSFALVE---------------------RVQTPLEEASKKEIS----------------------HVLVTIHMAQGMSVLRFPSDTCLSTVLERAVYRRRLRQHG-GYAYRLELWPRNTDQQNNNIKSNNILLNKNSQLDLSKPLSYFIAAGLPLHFLLVRESSRCDTALSDQNDDIEATKTLESMLALDTTLEPVHTALHLRQYQVTYLKGLFPPEVQLNISSNELKIEQKRPKLFSKLMKPIIIQINA--IADC 504          
BLAST of SIN1 vs. TrEMBL
Match: G4VT49 (CRIM domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_136490 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.847e-25
Identity = 148/557 (26.57%), Postives = 239/557 (42.91%), Query Frame = 1
Query:   88 LLNYVRNSFIYGDDTGICELIIE--KDFPSKFSIQDVLNGEFNYKITDTSSPHFRSSSPEIPLTSN----TAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVP-KQVKSQTSVLSKLLESTSKEEIVSVN-IFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNP---IIVLPVLETKVSDLIGLACWKYVEENRSPPLNNA-----------SIVSKLKLYMF-------EDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFPPETSVGQIIQHTVNKRHLQQHGENYRYKLELESE-----------------PNKELDIDTNLSQFEN----FSFVLVRDMSRRKPAIPDLINE-------ECSLSLSKMME----CLDKKTYNVFLKKPLKQWESLLTISQDSIEIDSQAPKLPFRF-KPKIIRIPILFLADC 1572
            +LNYVRN F  GDD+G CE ++   KD   +  I+ +L+G++  ++ +T S  F   SPE          +A    ++S    ++  L      ++ R ++  E  +      I      +N P   +KS+ S L+  LE       +  N +FS++A + A R T G     N+ + +  F   N  +  +R+F ++ W     R R  P   I V P L T V   +GL  W+Y  E  +  +++            S +++L L+MF       +D ED+D  F  L  +DPI+KY+F   A++E                       Q+ +E+   ++ S                       +LV I +A G+S  RFP +T +  +++  V +R L+QHG  Y Y+LEL                     N +LD+   LS F        F+LVR+ SR   A+ D  ++       E  L+L   +E     L  + Y V   K L   E  L IS + ++I+ + PKL  +  KP II+I    +ADC
Sbjct:   10 ILNYVRNCFASGDDSGFCEKLLNKVKDVTDE-EIESILSGQYFNEVVNTDSDDFYRHSPECAFVPCEDPLSAFYSSINSFEDSQQSSLSHKKNASNIRQLSAEEVDKYFPSKPI----VRTNKPDTALKSEKSGLTLALEQAKLSGHLKRNKLFSDFAIYDA-RSTLG----TNQRVPDSRFPDAN-VDPSLRQFNVWLW-----RLRGFPRTSIKVQPRLGTTVQQFVGLTLWQYFNEFSTSDVDSTLAPTQLDDLDESFLNRLALHMFDTLDDEYDDNEDVDSEFPPLELNDPIHKYEFKSFALVE---------------------RVQTPLEEASKKEIS----------------------HVLVTIHMAQGMSVLRFPSDTCLSTVLERAVYRRRLRQHG-GYAYRLELWPRNTDQQNNNIKSNNILLNKNSQLDLSKPLSYFIAAGLPLHFLLVRESSRCDTALSDQNDDIEATKTLESMLALDTTLEPVHTALHLRQYQVTYLKGLFPPEVQLNISSNELKIEQKRPKLFSKLMKPIIIQINA--IADC 504          
BLAST of SIN1 vs. TrEMBL
Match: A0A183QCP6 (CRIM domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 7.434e-25
Identity = 148/557 (26.57%), Postives = 238/557 (42.73%), Query Frame = 1
Query:   88 LLNYVRNSFIYGDDTGICELIIE--KDFPSKFSIQDVLNGEFNYKITDTSSPHFRSSSPEIPLTSN----TAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVP-KQVKSQTSVLSKLLESTSKEEIVSVN-IFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNP---IIVLPVLETKVSDLIGLACWKYVEENRSPPLNNA-----------SIVSKLKLYMF-------EDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFPPETSVGQIIQHTVNKRHLQQHGENYRYKLELESE-----------------PNKELDIDTNLSQFEN----FSFVLVRDMSRRKPAIPDLINE-------ECSLSLSKMME----CLDKKTYNVFLKKPLKQWESLLTISQDSIEIDSQAPKLPFRF-KPKIIRIPILFLADC 1572
            +LNYVRN F  GDD+G CE ++   KD   +  I+ +L+G++  ++ +T S  F   SPE          +A    ++S    ++  L      ++ R ++  E  +      I      +N P   +KS+ S L+  LE       +  N +FS++A + A R T G     N+ + +  F   N  +  +R+F ++ W     R R  P   I V P L T V   +GL  W+Y  E  +   ++            S +++L L+MF       +D ED+D  F  L  +DPI+KY+F   A++E                       Q+ +E+   ++ S                       +LV I +A G+S  RFP +T +  +++  V +R L+QHG  Y Y+LEL                     N +LD+   LS F        F+LVR+ SR   A+ D  ++       E  L+L   +E     L  + Y V   K L   E  L IS + ++I+ + PKL  +  KP II+I    +ADC
Sbjct:   10 ILNYVRNCFASGDDSGFCEKLLNKVKDVTDE-EIESILSGQYFNEVVNTDSDDFYRHSPECAFVPCEDPLSAFYSSINSFEDSQQSSLSHRKNASNIRQLSAEEVDKYFPSKPI----VRTNKPDTALKSEKSGLTLALEQAKLSGHLKRNKLFSDFAIYDA-RSTLG----TNQRVPDSRFPDAN-VDPSLRQFNVWLW-----RLRGFPRTSITVQPRLGTTVQQFMGLTLWQYFNEFSTSDGDSTLAPTQLDDLDESFLNRLALHMFDTLDDEYDDNEDVDSEFPPLELNDPIHKYEFKSFALVE---------------------RVQTPLEEASKKEIS----------------------HVLVTIHMAQGMSVLRFPSDTCLSTVLERAVYRRRLRQHG-GYAYRLELWPRNTDQQNNNIKSNNILLNKNSQLDLSKPLSYFIAAGLPLHFLLVRESSRCDTALSDQNDDIEATKPLESMLALDTTLEPVHTALHLRQYQVTYLKGLFPPEVQLNISPNELKIEQKRPKLFSKLMKPIIIQINA--IADC 504          
BLAST of SIN1 vs. Ensembl Cavefish
Match: mapkap1 (MAPK associated protein 1 [Source:NCBI gene;Acc:103031846])

HSP 1 Score: 90.8929 bits (224), Expect = 7.926e-19
Identity = 100/434 (23.04%), Postives = 180/434 (41.47%), Query Frame = 1
Query:   70 LSDSEYLLNYVRNSFIYGDDTGICELII-------EKDFPSKFSIQDVLNGEF--NYKITDTSSPHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLF---GVSNVPKQVKSQTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFPP----ETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVR 1323
            L +   +L ++R S +  DD+G+CE+++       EK   +  S   V  G    +  ++        S S +I  + +  + R+ ++   ++ +  K+       + + + E     +  D+  LF      + P+   ++ S LS  LE   ++     N F+ Y++F      KG              VG   + K      +Y    +  + + +P++V+ +   +V DLIGL CW+Y  E R P LN    V+   L++ ED  ++D  F  L+S++PI+K+ FS LA++E                       +     +G +Q                        S+ V+I  AHG   F   P    + ++ +I+Q  + KR   Q G    Y+LE ++EPN  +D+D+ L       F LVR
Sbjct:    4 LDNPTIILAHIRQSHVTSDDSGMCEMVLIDHDVDLEKCHSAAVSTGSVSMGGVLGDGSVSGDGQACDLSQSMDITSSWDFGIRRRSNTAQRLERLR-KERQNQIKCKNVQWKERSSSQSAEDLGSLFEKKDFKDRPRCTGTK-STLSLRLEQCPQQ---LNNPFNEYSKFDG----KG-------------HVGTTATKK----IDVYL-SMQSAQEKLHPMMVVTMANARVHDLIGLICWQYTSEGREPKLNEN--VNTYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE-----------------------KYSSPGLGPKQ------------------------SLFVRINAAHG---FSLIPVDSLKVTMKEILQKALKKRKGSQKGSGPMYRLEKQTEPNVAVDLDSTLETQSTLEFCLVR 358          
BLAST of SIN1 vs. Ensembl Cavefish
Match: mapkap1 (MAPK associated protein 1 [Source:NCBI gene;Acc:103031846])

HSP 1 Score: 83.9593 bits (206), Expect = 1.352e-16
Identity = 100/443 (22.57%), Postives = 181/443 (40.86%), Query Frame = 1
Query:   70 LSDSEYLLNYVRNSFIYGDDTGICELII-------EKDFPSKFSIQDVLNGEF--NYKITDTSSPHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLF---GVSNVPKQVKSQTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFPP----ETSVGQIIQHTVNKRHLQQHGENYR---------YKLELESEPNKELDIDTNLSQFENFSFVLVR 1323
            L +   +L ++R S +  DD+G+CE+++       EK   +  S   V  G    +  ++        S S +I  + +  + R+ ++   ++ +  K+       + + + E     +  D+  LF      + P+   ++ S LS  LE   ++     N F+ Y++F      KG              VG   + K      +Y    +  + + +P++V+ +   +V DLIGL CW+Y  E R P LN    V+   L++ ED  ++D  F  L+S++PI+K+ FS LA++E                       +     +G +Q                        S+ V+I  AHG   F   P    + ++ +I+Q  + KR   Q G  +          Y+LE ++EPN  +D+D+ L       F LVR
Sbjct:    4 LDNPTIILAHIRQSHVTSDDSGMCEMVLIDHDVDLEKCHSAAVSTGSVSMGGVLGDGSVSGDGQACDLSQSMDITSSWDFGIRRRSNTAQRLERLR-KERQNQIKCKNVQWKERSSSQSAEDLGSLFEKKDFKDRPRCTGTK-STLSLRLEQCPQQ---LNNPFNEYSKFDG----KG-------------HVGTTATKK----IDVYL-SMQSAQEKLHPMMVVTMANARVHDLIGLICWQYTSEGREPKLNEN--VNTYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE-----------------------KYSSPGLGPKQ------------------------SLFVRINAAHG---FSLIPVDSLKVTMKEILQKALKKRKGSQKGSVFATDFGCQGPMYRLEKQTEPNVAVDLDSTLETQSTLEFCLVR 367          
BLAST of SIN1 vs. Ensembl Cavefish
Match: mapkap1 (MAPK associated protein 1 [Source:NCBI gene;Acc:103031846])

HSP 1 Score: 72.4034 bits (176), Expect = 6.094e-13
Identity = 71/297 (23.91%), Postives = 134/297 (45.12%), Query Frame = 1
Query:   70 LSDSEYLLNYVRNSFIYGDDTGICELII-------EKDFPSKFSIQDVLNGEF--NYKITDTSSPHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLF---GVSNVPKQVKSQTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILE 924
            L +   +L ++R S +  DD+G+CE+++       EK   +  S   V  G    +  ++        S S +I  + +  + R+ ++   ++ +  K+       + + + E     +  D+  LF      + P+   ++ S LS  LE   ++     N F+ Y++F      KG              VG   + K      +Y    +  + + +P++V+ +   +V DLIGL CW+Y  E R P LN    V+   L++ ED  ++D  F  L+S++PI+K+ FS LA++E
Sbjct:    4 LDNPTIILAHIRQSHVTSDDSGMCEMVLIDHDVDLEKCHSAAVSTGSVSMGGVLGDGSVSGDGQACDLSQSMDITSSWDFGIRRRSNTAQRLERLR-KERQNQIKCKNVQWKERSSSQSAEDLGSLFEKKDFKDRPRCTGTK-STLSLRLEQCPQQ---LNNPFNEYSKFDG----KG-------------HVGTTATKK----IDVYL-SMQSAQEKLHPMMVVTMANARVHDLIGLICWQYTSEGREPKLNEN--VNTYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE 271          
BLAST of SIN1 vs. Ensembl Medaka
Match: mapkap1 (MAPK associated protein 1 [Source:NCBI gene;Acc:101174206])

HSP 1 Score: 85.8853 bits (211), Expect = 3.367e-17
Identity = 63/218 (28.90%), Postives = 98/218 (44.95%), Query Frame = 1
Query:  679 RNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFPPET---SVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVR 1323
            + + +P+ V+ +   +V DLIGL CW+Y  E R P LN    V+   L++ ED  ++D  F  L+S++PI+K+ FS LA++E                                       +   T R+SL            V+I  AHG S    P +T   ++ +I+Q  + KR   Q G    Y+LE + EPN  +D+D++L       F LVR
Sbjct:  195 QEKVHPMTVVTIANARVHDLIGLICWQYTSEGREPKLNEN--VNAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE------------------------------------KYSSPGLTSRQSL-----------FVRINAAHGFS--LIPVDTLKVTMKEILQKALKKRKGSQKGAGPMYRLEKQMEPNLAVDLDSSLESQNTLEFCLVR 361          
BLAST of SIN1 vs. Ensembl Medaka
Match: mapkap1 (MAPK associated protein 1 [Source:NCBI gene;Acc:101174206])

HSP 1 Score: 68.1662 bits (165), Expect = 1.218e-11
Identity = 32/82 (39.02%), Postives = 52/82 (63.41%), Query Frame = 1
Query:  679 RNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILE 924
            + + +P+ V+ +   +V DLIGL CW+Y  E R P LN    V+   L++ ED  ++D  F  L+S++PI+K+ FS LA++E
Sbjct:  195 QEKVHPMTVVTIANARVHDLIGLICWQYTSEGREPKLNEN--VNAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVE 274          
BLAST of SIN1 vs. Planmine SMEST
Match: SMESG000060418.1 (SMESG000060418.1)

HSP 1 Score: 1219.91 bits (3155), Expect = 0.000e+0
Identity = 631/632 (99.84%), Postives = 631/632 (99.84%), Query Frame = 1
Query:   61 MSVLSDSEYLLNYVRNSFIYGDDTGICELIIEKDFPSKFSIQDVLNGEFNYKITDTSSPHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVPKQVKSQTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRXXXXXXXXXXXXXXXXTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFPPETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRDMSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQWESLLTISQDSIEIDSQAPKLPFRFKPKIIRIPILFLADCVINYHDLNLQDLNKVTIKFVHXXXXXXXXXXXXXXFGNEYSFFDSETNSIKSQNRSQVDVSYQAQESLLNNLPSELTSHSISCQSTSGKLIFEQTMSIVNFKNHFIRKKYLTLVNNRDSNAVISGNKL 1956
            MSVLSDSEYLLNYVRNSFIYGDDTGICELIIEKDFPSKFSIQDVLNGEFNYKITDTSSPHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVPKQVKSQTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRSKFVSVSSMISDSSFVTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFPPETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRDMSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQWESLLTISQDSIEIDSQAPKLPFRFKPKIIRIPILFLADCVINYHDLNLQDLNKVTIKFVHLKSKSPLAKSLKSSFGNEYSFFDSETNSIKSQNRSQVDVSYQAQESLLNNLPSELTSHSISCQS SGKLIFEQTMSIVNFKNHFIRKKYLTLVNNRDSNAVISGNKL
Sbjct:    1 MSVLSDSEYLLNYVRNSFIYGDDTGICELIIEKDFPSKFSIQDVLNGEFNYKITDTSSPHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADHRYINFSEWPRVLTENDINDLFGVSNVPKQVKSQTSVLSKLLESTSKEEIVSVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYFWDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVSKLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRSKFVSVSSMISDSSFVTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILVQILLAHGVSKFRFPPETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPNKELDIDTNLSQFENFSFVLVRDMSRRKPAIPDLINEECSLSLSKMMECLDKKTYNVFLKKPLKQWESLLTISQDSIEIDSQAPKLPFRFKPKIIRIPILFLADCVINYHDLNLQDLNKVTIKFVHLKSKSPLAKSLKSSFGNEYSFFDSETNSIKSQNRSQVDVSYQAQESLLNNLPSELTSHSISCQSASGKLIFEQTMSIVNFKNHFIRKKYLTLVNNRDSNAVISGNKL 632          
The following BLAST results are available for this feature:
BLAST of SIN1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAPKAP11.911e-2223.55MAPK associated protein 1 [Source:HGNC Symbol;Acc:... [more]
MAPKAP11.911e-2223.55MAPK associated protein 1 [Source:HGNC Symbol;Acc:... [more]
MAPKAP16.558e-2027.00MAPK associated protein 1 [Source:HGNC Symbol;Acc:... [more]
MAPKAP16.558e-2027.00MAPK associated protein 1 [Source:HGNC Symbol;Acc:... [more]
MAPKAP14.711e-1923.66MAPK associated protein 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of SIN1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SIN1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SIN1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mapkap13.907e-1527.91MAPK associated protein 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of SIN1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mapkap17.927e-2223.08MAPK associated protein 1 [Source:NCBI gene;Acc:10... [more]
mapkap11.851e-1923.21MAPK associated protein 1 [Source:NCBI gene;Acc:10... [more]
mapkap16.222e-1524.49MAPK associated protein 1 [Source:NCBI gene;Acc:10... [more]
mapkap19.939e-1323.69MAPK associated protein 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of SIN1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mapkap11.827e-2223.55mitogen-activated protein kinase associated protei... [more]
Mapkap11.827e-2223.55mitogen-activated protein kinase associated protei... [more]
Mapkap12.147e-1926.67mitogen-activated protein kinase associated protei... [more]
Mapkap12.232e-1926.67mitogen-activated protein kinase associated protei... [more]
Mapkap11.705e-1425.17mitogen-activated protein kinase associated protei... [more]
back to top
BLAST of SIN1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W6S3|SIN1_CHICK7.918e-2425.80Target of rapamycin complex 2 subunit MAPKAP1 OS=G... [more]
sp|A4IIM3|SIN1_XENTR3.801e-2223.17Target of rapamycin complex 2 subunit MAPKAP1 OS=X... [more]
sp|Q9BPZ7|SIN1_HUMAN9.178e-2223.55Target of rapamycin complex 2 subunit MAPKAP1 OS=H... [more]
sp|Q7ZYH1|SIN1_XENLA1.155e-2123.97Target of rapamycin complex 2 subunit MAPKAP1 OS=X... [more]
sp|Q8BKH7|SIN1_MOUSE1.278e-2123.55Target of rapamycin complex 2 subunit MAPKAP1 OS=M... [more]
back to top
BLAST of SIN1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9XVZ90.000e+099.44SIN1 (Fragment) OS=Schmidtea mediterranea OX=79327... [more]
A0A5K4EN271.092e-2526.57Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A3Q0KMI71.490e-2526.57CRIM domain-containing protein OS=Schistosoma mans... [more]
G4VT491.847e-2526.57CRIM domain-containing protein OS=Schistosoma mans... [more]
A0A183QCP67.434e-2526.57CRIM domain-containing protein OS=Schistosoma rodh... [more]
back to top
BLAST of SIN1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mapkap17.926e-1923.04MAPK associated protein 1 [Source:NCBI gene;Acc:10... [more]
mapkap11.352e-1622.57MAPK associated protein 1 [Source:NCBI gene;Acc:10... [more]
mapkap16.094e-1323.91MAPK associated protein 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of SIN1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SIN1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SIN1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SIN1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mapkap13.367e-1728.90MAPK associated protein 1 [Source:NCBI gene;Acc:10... [more]
mapkap11.218e-1139.02MAPK associated protein 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of SIN1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000060418.10.000e+099.84SMESG000060418.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30034394
GenBankAFH08798.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034394 ID=SMED30034394|Name=SIN1|organism=Schmidtea mediterranea sexual|type=transcript|length=2007bp
CTTATATGATATTTTAATACTTAACGCGATTTTTATTTATTGATATCTTT
TCAAATCAAAATGTCTGTTTTAAGTGATTCAGAATATCTATTGAATTATG
TCAGAAATTCATTTATTTATGGAGATGATACTGGAATTTGTGAATTAATT
ATTGAAAAAGACTTTCCTTCAAAATTTTCTATACAAGATGTGTTGAATGG
AGAATTCAATTACAAAATAACTGATACTTCTAGTCCTCATTTTAGGAGTT
CGTCTCCTGAAATACCTTTAACTAGTAACACAGCCGTTGCTAGAAAATTA
TCATCTGAAACAGTAATCAAAGAAGTCGAATTAAAAGATGCGAGTATACC
TGCTGATCATAGATATATTAATTTCAGTGAATGGCCAAGAGTTTTAACTG
AAAATGATATAAATGATTTATTCGGTGTCAGCAATGTTCCAAAACAAGTC
AAATCACAGACTTCGGTTTTATCTAAATTACTCGAATCAACGAGTAAAGA
AGAGATCGTTTCAGTAAATATATTTTCCAACTATGCACGATTTAGTGCAC
TGCGATATACAAAGGGTAAAAATCCAAACAATAATGAAATAATCACAAAT
CAGTTATTCGTTGGTGAAAATGATTCCAATAAACCGATGCGAGAATTTCG
TATTTATTTTTGGGATTATGAAGAGCAGAGAAACCGATCTAACCCGATAA
TTGTTCTGCCGGTTTTGGAAACGAAAGTGTCAGATCTAATTGGACTTGCT
TGTTGGAAGTACGTTGAAGAAAATCGCAGCCCCCCTTTGAACAACGCTTC
AATAGTCAGCAAATTGAAGTTGTATATGTTTGAAGACATTGAAGATTTAG
ATCTTGGGTTTGGATCTTTGAACAGCAGTGATCCAATATACAAATATCAA
TTCAGTCATCTCGCTATTTTAGAATGCCAACGAGATGGAAGAAGTAAATT
TGTGTCAGTTAGCTCGATGATTAGTGATAGCAGCTTCGTAACTCAATCGC
ACATGGAAAAGATGGGTTTACGACAAAAATCCATCACTGAAACTGACAGC
TTTACTGATCGGCGTTCACTCAGTAATTCCAGTGATATAACAGATGGCTC
GATATTAGTTCAAATACTTTTGGCTCATGGAGTATCGAAATTTCGATTTC
CACCAGAGACATCTGTAGGGCAAATCATTCAACACACTGTCAACAAACGA
CATCTTCAACAGCATGGCGAAAATTATAGATATAAACTAGAATTGGAATC
GGAACCAAACAAGGAACTCGATATAGATACGAATCTTAGTCAATTTGAAA
ATTTTTCATTCGTATTAGTAAGAGACATGAGTCGCAGAAAACCTGCAATT
CCTGATCTAATCAATGAAGAATGTTCGCTTTCTTTATCGAAAATGATGGA
ATGCCTGGATAAGAAAACTTATAACGTATTTTTAAAAAAACCTTTAAAAC
AATGGGAATCATTATTAACTATTTCACAAGATTCGATAGAAATAGACTCA
CAGGCCCCGAAATTGCCATTTCGATTCAAACCGAAAATTATCCGCATTCC
AATTTTATTTTTAGCGGATTGCGTAATTAATTATCACGACCTAAATCTAC
AGGACTTGAATAAAGTTACCATTAAATTTGTTCATTTGAAATCCAAATCT
CCACTGGCCAAGAGTTTGAAGTCTTCATTTGGCAATGAATATTCTTTCTT
TGACTCTGAAACAAACAGCATTAAATCGCAGAACCGAAGTCAGGTTGATG
TTAGTTATCAGGCTCAAGAATCATTATTGAATAATCTACCGAGTGAACTC
ACTAGTCATTCTATCAGTTGCCAATCCACGTCCGGGAAACTTATTTTTGA
ACAGACAATGTCAATAGTCAATTTCAAGAATCATTTTATAAGAAAAAAAT
ATCTTACACTGGTCAATAATCGCGATTCTAATGCTGTGATTTCAGGAAAT
AAATTATGATTTTATATGAATTTTATTTAATAAATTTTTTGGTTTTTTAA
AAAAAAA
back to top

protein sequence of SMED30034394-orf-1

>SMED30034394-orf-1 ID=SMED30034394-orf-1|Name=SMED30034394-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=633bp
MSVLSDSEYLLNYVRNSFIYGDDTGICELIIEKDFPSKFSIQDVLNGEFN
YKITDTSSPHFRSSSPEIPLTSNTAVARKLSSETVIKEVELKDASIPADH
RYINFSEWPRVLTENDINDLFGVSNVPKQVKSQTSVLSKLLESTSKEEIV
SVNIFSNYARFSALRYTKGKNPNNNEIITNQLFVGENDSNKPMREFRIYF
WDYEEQRNRSNPIIVLPVLETKVSDLIGLACWKYVEENRSPPLNNASIVS
KLKLYMFEDIEDLDLGFGSLNSSDPIYKYQFSHLAILECQRDGRSKFVSV
SSMISDSSFVTQSHMEKMGLRQKSITETDSFTDRRSLSNSSDITDGSILV
QILLAHGVSKFRFPPETSVGQIIQHTVNKRHLQQHGENYRYKLELESEPN
KELDIDTNLSQFENFSFVLVRDMSRRKPAIPDLINEECSLSLSKMMECLD
KKTYNVFLKKPLKQWESLLTISQDSIEIDSQAPKLPFRFKPKIIRIPILF
LADCVINYHDLNLQDLNKVTIKFVHLKSKSPLAKSLKSSFGNEYSFFDSE
TNSIKSQNRSQVDVSYQAQESLLNNLPSELTSHSISCQSTSGKLIFEQTM
SIVNFKNHFIRKKYLTLVNNRDSNAVISGNKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005886plasma membrane
GO:0016020membrane
GO:0031410cytoplasmic vesicle
GO:0031932TORC2 complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR031567CRIM_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR031567Sin1, middle CRIM domainPFAMPF16978CRIMcoord: 134..291
e-value: 3.2E-17
score: 63.0
NoneNo IPR availablePANTHERPTHR13335MITOGEN-ACTIVATED PROTEIN KINASE ASSOCIATED PROTEINcoord: 114..505