PHD finger protein 14

Overview
NamePHD finger protein 14
Smed IDSMED30034392
Length (bp)7835
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PHD finger protein 14 (SMED30034392) t-SNE clustered cells

Violin plots show distribution of expression levels for PHD finger protein 14 (SMED30034392) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PHD finger protein 14 (SMED30034392) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PHD finger protein 14 (SMED30034392) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034392

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30034392SMESG000070592.1 SMESG000070587.1 SMESG000049670.1 SMESG000049566.1 SmedASXL_017850SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30034392SMESG000070592.1 SMESG000070587.1 SMESG000049670.1 SMESG000049566.1 SmedASXL_017850SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30034392SMESG000070592.1 SMESG000070587.1 dd_Smed_v4_7294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30034392SMESG000070592.1 SMESG000070587.1 dd_Smed_v4_7294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034392SMESG000070592.1 SMESG000070587.1 dd_Smed_v4_7294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30034392SMESG000070592.1 SMESG000070587.1 dd_Smed_v4_7294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PHD finger protein 14 vs. Ensembl Human
Match: PHF14 (PHD finger protein 14 [Source:HGNC Symbol;Acc:HGNC:22203])

HSP 1 Score: 317.39 bits (812), Expect = 5.418e-93
Identity = 181/505 (35.84%), Postives = 271/505 (53.66%), Query Frame = 1
Query: 5512 KFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXX-XTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVL---NSQTSNDLKT-ISSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEK-EFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLDVNRPRQLRRS 7005
            K ++++IC +CL D+S   +E+++CD CGI VHE CY +         S+   ST PWFCDAC   VS P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC  C +P FARTG+CISCDAG+C+  FHV CAQKEGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L+E     +    +R+  + Q + +         P  +VP+ K+   L ++  A+    +KA  + +  D+    NS TS+ +        P    DF+ Y+ +R  ++ +    + + +N + +L+  ++    ++NK     E  +    KL  E   + + ++ ++   +       N+ A  + P               + KE     T T P +V+  C +CK   DQH+L+ CD C    H+GCLDPPLTRMPRKTK   WQCS C  A + D  A       P   +RS
Sbjct:   30 KMDHILICCVCLGDNSEDADEIIQCDNCGITVHEGCYGVDGESDSIMSSASENSTEPWFCDACKCGVS-PSCELCPNQDGIFKETDAGRWVHIVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSFCEDPRFARTGVCISCDAGMCRAYFHVTCAQKEGLLSEAAAEEDIADPFFAYCKQHADRLDRKWKRKNYLALQSYCKMSLQEREKQLSPEAQARINARLQQYRAKAELARSTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDNSDTSSSVDGRRKHKQPALTADFVNYYFERNMRMIQIQENMAEQKNIKDKLENEQEKLHVEYNKLCESLEELQNLNGKLRSEGQGI-WALLGRITGQK------LNIPAILRAPKERKP----------SKKEGGTQKTSTLP-AVLYSCGICKKNHDQHLLLLCDTCKLHYHLGCLDPPLTRMPRKTKNSYWQCSECDQAGSSDMEADMAMETLPDGTKRS 515          
BLAST of PHD finger protein 14 vs. Ensembl Human
Match: PHF14 (PHD finger protein 14 [Source:HGNC Symbol;Acc:HGNC:22203])

HSP 1 Score: 321.627 bits (823), Expect = 1.607e-91
Identity = 185/528 (35.04%), Postives = 282/528 (53.41%), Query Frame = 1
Query: 5443 TKKRESETILDNLNDYRTIANKTKFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVL---NSQTSNDLKT-ISSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEK-EFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLDVNRPRQLRRS 7005
            +K  E   IL+   ++ +     K ++++IC +CL D+S   +E+++CD CGI VHE CY +          +S++ST PWFCDAC   VS P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC  C +P FARTG+CISCDAG+C+  FHV CAQKEGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L+E     +    +R+  + Q + +         P  +VP+ K+   L ++  A+    +KA  + +  D+    NS TS+ +        P    DF+ Y+ +R  ++ +    + + +N + +L+  ++    ++NK     E  +    KL  E   + + ++ ++   +       N+ A  + P               + KE     T T P +V+  C +CK   DQH+L+ CD C    H+GCLDPPLTRMPRKTK   WQCS C  A + D  A       P   +RS
Sbjct:  296 SKSNEDSLILEKSQNWSS----QKMDHILICCVCLGDNSEDADEIIQCDNCGITVHEGCYGVDGESDSIMSSASENSTEPWFCDACKCGVS-PSCELCPNQDGIFKETDAGRWVHIVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSFCEDPRFARTGVCISCDAGMCRAYFHVTCAQKEGLLSEAAAEEDIADPFFAYCKQHADRLDRKWKRKNYLALQSYCKMSLQEREKQLSPEAQARINARLQQYRAKAELARSTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDNSDTSSSVDGRRKHKQPALTADFVNYYFERNMRMIQIQENMAEQKNIKDKLENEQEKLHVEYNKLCESLEELQNLNGKLRSEGQGI-WALLGRITGQKL------NIPAILRAPKERKP----------SKKEGGTQKTSTLP-AVLYSCGICKKNHDQHLLLLCDTCKLHYHLGCLDPPLTRMPRKTKNSYWQCSECDQAGSSDMEADMAMETLPDGTKRS 800          
BLAST of PHD finger protein 14 vs. Ensembl Human
Match: PHF14 (PHD finger protein 14 [Source:HGNC Symbol;Acc:HGNC:22203])

HSP 1 Score: 321.242 bits (822), Expect = 6.291e-91
Identity = 185/528 (35.04%), Postives = 282/528 (53.41%), Query Frame = 1
Query: 5443 TKKRESETILDNLNDYRTIANKTKFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVL---NSQTSNDLKT-ISSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEK-EFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLDVNRPRQLRRS 7005
            +K  E   IL+   ++ +     K ++++IC +CL D+S   +E+++CD CGI VHE CY +          +S++ST PWFCDAC   VS P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC  C +P FARTG+CISCDAG+C+  FHV CAQKEGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L+E     +    +R+  + Q + +         P  +VP+ K+   L ++  A+    +KA  + +  D+    NS TS+ +        P    DF+ Y+ +R  ++ +    + + +N + +L+  ++    ++NK     E  +    KL  E   + + ++ ++   +       N+ A  + P               + KE     T T P +V+  C +CK   DQH+L+ CD C    H+GCLDPPLTRMPRKTK   WQCS C  A + D  A       P   +RS
Sbjct:  296 SKSNEDSLILEKSQNWSS----QKMDHILICCVCLGDNSEDADEIIQCDNCGITVHEGCYGVDGESDSIMSSASENSTEPWFCDACKCGVS-PSCELCPNQDGIFKETDAGRWVHIVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSFCEDPRFARTGVCISCDAGMCRAYFHVTCAQKEGLLSEAAAEEDIADPFFAYCKQHADRLDRKWKRKNYLALQSYCKMSLQEREKQLSPEAQARINARLQQYRAKAELARSTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDNSDTSSSVDGRRKHKQPALTADFVNYYFERNMRMIQIQENMAEQKNIKDKLENEQEKLHVEYNKLCESLEELQNLNGKLRSEGQGI-WALLGRITGQKL------NIPAILRAPKERKP----------SKKEGGTQKTSTLP-AVLYSCGICKKNHDQHLLLLCDTCKLHYHLGCLDPPLTRMPRKTKNSYWQCSECDQAGSSDMEADMAMETLPDGTKRS 800          

HSP 2 Score: 63.1586 bits (152), Expect = 7.625e-9
Identity = 30/74 (40.54%), Postives = 40/74 (54.05%), Query Frame = 1
Query: 6742 SATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLC-SCATTDDEH 6960
            S    K K + +  EC  CK   D   L+ CD C    H GCLDPPL + P++T  YGW C  C S ++ +DE+
Sbjct:  856 SVLQKKPKAEDLRTECATCKGTGDNENLVRCDECRLCYHFGCLDPPLKKSPKQTG-YGWICQECDSSSSKEDEN 928          
BLAST of PHD finger protein 14 vs. Ensembl Human
Match: MLLT10 (MLLT10 histone lysine methyltransferase DOT1L cofactor [Source:HGNC Symbol;Acc:HGNC:16063])

HSP 1 Score: 128.642 bits (322), Expect = 7.662e-29
Identity = 71/201 (35.32%), Postives = 97/201 (48.26%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSN--VSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC---ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKN 6099
            E +  C +C  +  +++N LV CDG  C + VH+ CY I              T PWFC  C S    +  RCELCP ++G  KRT+N  W H++CALY P V F +  T+  I L  +P  D   + C +C        A TG C++C+   C+  FHV CAQ  GLL E       +  Y   C+ H  K    +R  N
Sbjct:   20 EMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQVP----------TGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVSTMEPIVLQSVP-HDRYNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSN 209          
BLAST of PHD finger protein 14 vs. Ensembl Human
Match: MLLT10 (MLLT10 histone lysine methyltransferase DOT1L cofactor [Source:HGNC Symbol;Acc:HGNC:16063])

HSP 1 Score: 128.642 bits (322), Expect = 8.681e-29
Identity = 71/201 (35.32%), Postives = 97/201 (48.26%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSN--VSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC---ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKN 6099
            E +  C +C  +  +++N LV CDG  C + VH+ CY I              T PWFC  C S    +  RCELCP ++G  KRT+N  W H++CALY P V F +  T+  I L  +P  D   + C +C        A TG C++C+   C+  FHV CAQ  GLL E       +  Y   C+ H  K    +R  N
Sbjct:   20 EMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQVP----------TGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVSTMEPIVLQSVP-HDRYNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSN 209          
BLAST of PHD finger protein 14 vs. Ensembl Celegans
Match: phf-14 (PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q9GRZ5])

HSP 1 Score: 165.236 bits (417), Expect = 6.718e-42
Identity = 134/495 (27.07%), Postives = 225/495 (45.45%), Query Frame = 1
Query: 5521 NVMICMMCLLDSSF-SDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSNVS-NPRCELCPVEEGVFKRTE-NNRWVHLLCALYTPGVAFNDTETLSEITLSELPL-KDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLL---SEPNNEENSDDPYFANCRQHTDKETVK---RRRKNWNAA------VNRQKLRLEEWHNNNHYNDSRL-IRKRQFFSSMHSKFLELVPTPFVP---KTKVACFLETNPIAVFLFKKKATNLRLPQDVLNSQTSNDLKTISSGIPV-FGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEKEFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETSATNTK---TKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLC 6933
            + +IC +C+   +  +  + ++C  CGI VHE CY                   W+C+ CL  ++  P CE CP   G FKR +   RW H +CALYT GV +  T T   ++   L     +  R C  C +   AR GI   C++G+CK   HV CAQK GLL   ++ N+ E +   YF  C++HT+++ +K   R+  +W  +      VNR +LR  E   N       L ++ R+    +  +  +  P   +    K K A  L ++      F+ KA    L +        N      S +P+ F  ++I +   R+ +I        + E  R+  ++  +  ++Q      +K+S++K     +E+ +   ++I+Q +     +E ++ LL +         G  +  L+S  +   S + +      P  +   C +C+  ++QH    CD CHK  HIGCL PPLTR+P++   +GW C  C
Sbjct:  104 DAVICGVCINQRNIVAAGDFLQCQKCGINVHESCYGTLPGGSDDAS--------WYCEPCLYGLTLPPHCEFCPSRFGAFKRADIRGRWAHAICALYTHGVNYAQTHTRCGVSWEHLDNNAHFGRRTCTACTDKIEARFGIASRCESGMCKEYLHVTCAQKLGLLVDETDDNDTEIAVMRYFF-CKKHTNRDNLKPYQRKFDDWEKSEARRITVNR-RLRSGELEKNEQKEHKELRVKMREEIDKVIEEECKNKPKGDISAGEKPKQARLLNSSAEFFDRFETKAEEAGLSRKEFRDPFFNIKLNSGSHVPIGFSKEYIDFMQIRDSQIIPE-----EEEKLRKSRELLAETKANQ------EKKSSQKHL---VERFSANEELIEQKLTS---IEKLHQLLTEL--------GGDSGLLLSDFNNRQSCSRSSPAIIAPKKMNYTCVVCRKSTEQHKQTQCDECHKSYHIGCLSPPLTRLPKRNN-FGWICHEC 562          
BLAST of PHD finger protein 14 vs. Ensembl Celegans
Match: zfp-1 (Uncharacterized protein F54F2.2, isoform a [Source:UniProtKB/Swiss-Prot;Acc:P34447])

HSP 1 Score: 115.161 bits (287), Expect = 3.364e-25
Identity = 60/177 (33.90%), Postives = 93/177 (52.54%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACL-SNVSNPR--------CELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC--ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSE 6009
            E V  C +C  ++ ++DN L+ CDG  C + VH+ CY I +               WFC  C  ++   P         C+LCP + G  K+T+ N W H++CALY P V F +  ++  + L+++P   ++ + C +C    P  A+ G C+SC+   CK  FHV CAQ++GLL E
Sbjct:    3 EMVGGCCVCADENGWTDNPLIYCDGENCEVAVHQGCYGIQEVPEGE----------WFCAKCTKASAMMPGSINEATFCCQLCPFDYGALKKTDRNGWAHVICALYIPEVRFGNVHSMEPVILNDVPTDKFN-KLCYICNEERPNDAKKGACMSCNKSTCKRSFHVTCAQRKGLLCE 168          
BLAST of PHD finger protein 14 vs. Ensembl Celegans
Match: zfp-1 (Uncharacterized protein F54F2.2, isoform a [Source:UniProtKB/Swiss-Prot;Acc:P34447])

HSP 1 Score: 115.161 bits (287), Expect = 3.364e-25
Identity = 60/177 (33.90%), Postives = 93/177 (52.54%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACL-SNVSNPR--------CELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC--ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSE 6009
            E V  C +C  ++ ++DN L+ CDG  C + VH+ CY I +               WFC  C  ++   P         C+LCP + G  K+T+ N W H++CALY P V F +  ++  + L+++P   ++ + C +C    P  A+ G C+SC+   CK  FHV CAQ++GLL E
Sbjct:    3 EMVGGCCVCADENGWTDNPLIYCDGENCEVAVHQGCYGIQEVPEGE----------WFCAKCTKASAMMPGSINEATFCCQLCPFDYGALKKTDRNGWAHVICALYIPEVRFGNVHSMEPVILNDVPTDKFN-KLCYICNEERPNDAKKGACMSCNKSTCKRSFHVTCAQRKGLLCE 168          
BLAST of PHD finger protein 14 vs. Ensembl Celegans
Match: lin-49 (pep chromosome:WBcel235:IV:8620683:8626149:1 gene:WBGene00003034.1 transcript:F42A9.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-49)

HSP 1 Score: 107.842 bits (268), Expect = 6.949e-23
Identity = 60/186 (32.26%), Postives = 82/186 (44.09%), Query Frame = 1
Query: 5530 ICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACL-------SNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHT 6066
            +C +CL   + + N++V CD C + VH+DCY I                P+  + CL       S      C LCP   G FK+ +  RWVH+LC ++     F +T  +  +   E  L D  A  C LC N   AR G CI C    C   FHV CA+  GL+   N  E+     F  C +H 
Sbjct:  197 VCNICLDGDTSNCNQIVYCDRCNLSVHQDCYGI----------------PFIPEGCLECRRCGISPAGRVNCVLCPSTTGAFKQVDQKRWVHVLCVIWVDETHFGNTIFMENVQNVEKALHDRRALSCLLCKNRQNARMGACIQCSETKCTASFHVTCARDSGLVMRINETEDGQVNRFVWCPKHA 366          
BLAST of PHD finger protein 14 vs. Ensembl Celegans
Match: phf-15 (PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q9N3F6])

HSP 1 Score: 73.9442 bits (180), Expect = 1.226e-12
Identity = 49/188 (26.06%), Postives = 80/188 (42.55%), Query Frame = 1
Query: 5533 CMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLS-NVSNPRCELCPVEEGVFKRT-ENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGL---LSEPNNEENSDDPYFANCRQHTDKETV 6081
            C +C +      +E+V CD C   VH  C  I +    ++        PW C  C       P C LCP   G    + +  +W H  CAL+ P + F + E  + +T  E   ++  ++ C +C      R G C++C    C+  +HV CA + G+   + E  N+   +      C +HT  + V
Sbjct:  240 CDVCRISDCDVADEMVFCDMCNTCVHMVCAGIEELPDPAE--------PWKCAKCAHMGTPCPPCVLCPALGGSMTYSADKTQWAHHSCALFIPEIIFENEELRAPMTSFERVAEERWSQMCSVCDT----RQGACVTCSWVDCEETYHVCCALRAGMTVRIQEVPNDPEHNVTRVTYCHKHTHPQDV 415          
BLAST of PHD finger protein 14 vs. Ensembl Fly
Match: CG15439 (gene:FBgn0031606 transcript:FBtr0077455)

HSP 1 Score: 314.309 bits (804), Expect = 1.653e-88
Identity = 180/540 (33.33%), Postives = 282/540 (52.22%), Query Frame = 1
Query: 5530 ICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNA--------AVNRQKLRLEEWHNNNHYNDSRLIRKRQFFSSMH--SKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVLNSQTSN-----DLKTISSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAE----------KEFKLGLEQVALKFDIIK-QLVKH------------------------RELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLDVNRPRQLR 6999
            +C +CL + S   NE+VECD CG+ VHE CY +SD+V +S  +S  ST PWFC+AC + VS P CELCP + G++K T+  +WVHL+CALY PGVAF + E LS +TL E+    W A+ C LC N  FARTG+CI CDAG+CK  FHV CAQ  G L E ++E+++ DP++A+C+ H++KE +K+RR+N++         A  ++ L  E      H N ++   +R+     H  ++  EL PTP+VP  K++  L T+  A      KA  + +    L  + ++     D++      P F  +F  Y++DR  ++D+  ++  +L +    L   +     Q++  + ++++ +          K     L Q+A    +    L+ H                          L   +   L     P  GS  + +  L + A +   +T++ +   +    C +CK   DQH+L+ CD C+   H+GCL+PPLTR P+K+K YGWQCS C C  ++   A     + PR+ R
Sbjct:  120 MCCVCLGERSDDVNEIVECDSCGVSVHEGCYGVSDNVSISSTNSTCSTEPWFCEACRAGVSEPDCELCPNKGGIYKETDVGKWVHLICALYVPGVAFGEVEQLSSVTLFEMQYSKWGAKVCSLCENALFARTGVCIGCDAGMCKTYFHVTCAQVAGFLIEAHHEDDAADPFYAHCKVHSEKEMIKKRRRNYHTLRLNMMQRAREKEALAAEHETPAPHPNPAQARIQRKLLKIQHKYTRHKELKPTPWVPTQKMSRLLTTSASACRRLLAKAEIMSVDVQHLEQREAHINALTDIRKKWHIAPAFSVEFTAYYMDRIVRMDDFRQQQRELISHNAILSKDQDVLRAQYDTALEERKAVKATKDSLLTSIKSLHTALGQIAPNMTLPSVDLIAHPLPEAPPKTSTPTPPQRPISVPTAAALKMGVGFPLGHLGPP--GSKMDSSRMLSTHAKQGKHSTSSASVEAAPSVSCGICKRSKDQHLLVKCDTCNLHYHLGCLNPPLTRPPKKSKQYGWQCSEC-CDKSEGSDAVTEISSGPRKSR 656          

HSP 2 Score: 53.5286 bits (127), Expect = 3.642e-6
Identity = 22/60 (36.67%), Postives = 33/60 (55.00%), Query Frame = 1
Query: 6754 TKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLC 6933
            +  KP+  I+ C +C      + ++ CD CH+  H  CLDPPL + P K + Y W C+ C
Sbjct:  940 SNAKPNVEIS-CCVCSQTGKSNQVVTCDECHRHYHFACLDPPLKKSP-KIRGYSWHCADC 997          
BLAST of PHD finger protein 14 vs. Ensembl Fly
Match: Alh (gene:FBgn0261238 transcript:FBtr0334672)

HSP 1 Score: 128.257 bits (321), Expect = 7.344e-29
Identity = 71/192 (36.98%), Postives = 95/192 (49.48%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSN--VSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC---ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDK 6072
            E V  C +C  +  + +N LV CDG  C + VH+ CY I              T PW+C  C S    S  RCELCP  +G  K+T+N+ W H++CALY P V F +  T+  I LS +P + +S + C +C     P  A  G C+ C+   CK  FHV CAQ  GLL E       +  Y   C+ H  K
Sbjct:   56 EMVGGCCVCSDERGWPENPLVYCDGQNCTVAVHQACYGIVTVP----------TGPWYCRKCESQERTSRVRCELCPSRDGALKKTDNSGWAHVVCALYIPEVRFGNVTTMEPIILSLIPQERYS-KTCYICQEIGKPNRANVGACMQCNKSNCKQQFHVTCAQSLGLLCEEAGNYLDNVKYCGYCQHHYSK 236          
BLAST of PHD finger protein 14 vs. Ensembl Fly
Match: Alh (gene:FBgn0261238 transcript:FBtr0334673)

HSP 1 Score: 127.872 bits (320), Expect = 7.635e-29
Identity = 71/192 (36.98%), Postives = 95/192 (49.48%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSN--VSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC---ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDK 6072
            E V  C +C  +  + +N LV CDG  C + VH+ CY I              T PW+C  C S    S  RCELCP  +G  K+T+N+ W H++CALY P V F +  T+  I LS +P + +S + C +C     P  A  G C+ C+   CK  FHV CAQ  GLL E       +  Y   C+ H  K
Sbjct:    3 EMVGGCCVCSDERGWPENPLVYCDGQNCTVAVHQACYGIVTVP----------TGPWYCRKCESQERTSRVRCELCPSRDGALKKTDNSGWAHVVCALYIPEVRFGNVTTMEPIILSLIPQERYS-KTCYICQEIGKPNRANVGACMQCNKSNCKQQFHVTCAQSLGLLCEEAGNYLDNVKYCGYCQHHYSK 183          
BLAST of PHD finger protein 14 vs. Ensembl Fly
Match: Alh (gene:FBgn0261238 transcript:FBtr0081612)

HSP 1 Score: 127.872 bits (320), Expect = 7.887e-29
Identity = 71/192 (36.98%), Postives = 95/192 (49.48%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSN--VSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC---ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDK 6072
            E V  C +C  +  + +N LV CDG  C + VH+ CY I              T PW+C  C S    S  RCELCP  +G  K+T+N+ W H++CALY P V F +  T+  I LS +P + +S + C +C     P  A  G C+ C+   CK  FHV CAQ  GLL E       +  Y   C+ H  K
Sbjct:   56 EMVGGCCVCSDERGWPENPLVYCDGQNCTVAVHQACYGIVTVP----------TGPWYCRKCESQERTSRVRCELCPSRDGALKKTDNSGWAHVVCALYIPEVRFGNVTTMEPIILSLIPQERYS-KTCYICQEIGKPNRANVGACMQCNKSNCKQQFHVTCAQSLGLLCEEAGNYLDNVKYCGYCQHHYSK 236          
BLAST of PHD finger protein 14 vs. Ensembl Fly
Match: Alh (gene:FBgn0261238 transcript:FBtr0081613)

HSP 1 Score: 127.872 bits (320), Expect = 8.994e-29
Identity = 71/192 (36.98%), Postives = 95/192 (49.48%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSN--VSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC---ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDK 6072
            E V  C +C  +  + +N LV CDG  C + VH+ CY I              T PW+C  C S    S  RCELCP  +G  K+T+N+ W H++CALY P V F +  T+  I LS +P + +S + C +C     P  A  G C+ C+   CK  FHV CAQ  GLL E       +  Y   C+ H  K
Sbjct:    3 EMVGGCCVCSDERGWPENPLVYCDGQNCTVAVHQACYGIVTVP----------TGPWYCRKCESQERTSRVRCELCPSRDGALKKTDNSGWAHVVCALYIPEVRFGNVTTMEPIILSLIPQERYS-KTCYICQEIGKPNRANVGACMQCNKSNCKQQFHVTCAQSLGLLCEEAGNYLDNVKYCGYCQHHYSK 183          
BLAST of PHD finger protein 14 vs. Ensembl Zebrafish
Match: phf14 (PHD finger protein 14 [Source:ZFIN;Acc:ZDB-GENE-030131-1796])

HSP 1 Score: 319.316 bits (817), Expect = 2.674e-91
Identity = 172/492 (34.96%), Postives = 274/492 (55.69%), Query Frame = 1
Query: 5512 KFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVLNSQTSNDLKTISSGI--------PVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEK-EFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDD 6954
            + E+++IC +CL D+S   +E+++CD CG+ VHE CY +          +S++ST PWFCDAC + VS P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC LC +  FARTG+CISCDAG+C++ FHV CAQ+EGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L+E          +R+  + Q + +         P  +VP+ K+   L ++  A+    +KA  + +  D+    TS+    IS+ +        P    DF+ Y+L+R  ++ +    IV+ +N + +L+  ++    +++K     E  +    +L  E  ++ + ++  +V  +       N+ A  + P               + KE  +    +   +++  C +CK   DQH+L+ CD C    H+GCLDPPLTRMP+KTK   WQCS C  A++D+
Sbjct:  281 RMEHILICCVCLGDNSEDADEIIQCDNCGVTVHEGCYGVDGESDSIMSSASENSTEPWFCDACKNGVS-PSCELCPSQDGIFKETDAGRWVHVVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSLCEDTRFARTGVCISCDAGMCRSFFHVTCAQREGLLSEAAAEEDIADPFFAYCKQHADRFDRKWKRKNYLALQSYCKVSLQEREKQLTPEAQARITTRLQQYRAKAELSRNTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDTSD----ISASVDGRRKHKQPALTADFVNYYLERNMRMIQIQDNIVEQKNLKDKLESEQEKLHMEYDKLCESLEDLQNVNGQLRTEGQSI-WSMMGGIVGQK------LNVPAVLKAPKERKP----------SKKEGGSPGKSSSLPAMLYSCGICKKNQDQHLLLLCDTCKLHYHLGCLDPPLTRMPKKTKNSYWQCSECDQASSDE 750          
BLAST of PHD finger protein 14 vs. Ensembl Zebrafish
Match: phf14 (PHD finger protein 14 [Source:ZFIN;Acc:ZDB-GENE-030131-1796])

HSP 1 Score: 317.775 bits (813), Expect = 3.255e-90
Identity = 172/492 (34.96%), Postives = 274/492 (55.69%), Query Frame = 1
Query: 5512 KFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVLNSQTSNDLKTISSGI--------PVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEK-EFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDD 6954
            + E+++IC +CL D+S   +E+++CD CG+ VHE CY +          +S++ST PWFCDAC + VS P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC LC +  FARTG+CISCDAG+C++ FHV CAQ+EGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L+E          +R+  + Q + +         P  +VP+ K+   L ++  A+    +KA  + +  D+    TS+    IS+ +        P    DF+ Y+L+R  ++ +    IV+ +N + +L+  ++    +++K     E  +    +L  E  ++ + ++  +V  +       N+ A  + P               + KE  +    +   +++  C +CK   DQH+L+ CD C    H+GCLDPPLTRMP+KTK   WQCS C  A++D+
Sbjct:  281 RMEHILICCVCLGDNSEDADEIIQCDNCGVTVHEGCYGVDGESDSIMSSASENSTEPWFCDACKNGVS-PSCELCPSQDGIFKETDAGRWVHVVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSLCEDTRFARTGVCISCDAGMCRSFFHVTCAQREGLLSEAAAEEDIADPFFAYCKQHADRFDRKWKRKNYLALQSYCKVSLQEREKQLTPEAQARITTRLQQYRAKAELSRNTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDTSD----ISASVDGRRKHKQPALTADFVNYYLERNMRMIQIQDNIVEQKNLKDKLESEQEKLHMEYDKLCESLEDLQNVNGQLRTEGQSI-WSMMGGIVGQK------LNVPAVLKAPKERKP----------SKKEGGSPGKSSSLPAMLYSCGICKKNQDQHLLLLCDTCKLHYHLGCLDPPLTRMPKKTKNSYWQCSECDQASSDE 750          

HSP 2 Score: 62.003 bits (149), Expect = 1.077e-8
Identity = 28/69 (40.58%), Postives = 35/69 (50.72%), Query Frame = 1
Query: 6742 SATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATT 6948
            S    K K D    EC  CK   D   L+ CD C    H GCLDPPL + P++T  YGW C  C  +++
Sbjct:  823 STLQKKPKADDTRTECTTCKGPGDNENLVRCDECRLCYHFGCLDPPLKKSPKQTG-YGWICQECDTSSS 890          
BLAST of PHD finger protein 14 vs. Ensembl Zebrafish
Match: phf14 (PHD finger protein 14 [Source:ZFIN;Acc:ZDB-GENE-030131-1796])

HSP 1 Score: 298.516 bits (763), Expect = 6.756e-84
Identity = 170/505 (33.66%), Postives = 270/505 (53.47%), Query Frame = 1
Query: 5473 DNLNDYRTIANKTKFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVLNSQTSNDLKTISSGI--------PVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEK-EFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDD 6954
            D+L +     +  + E+++IC +CL D+S   +E+++CD CG+ VHE CY +          +S++ST PWFCDAC + VS P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L                EC LC +  FARTG+CISCDAG+C++ FHV CAQ+EGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L+E          +R+  + Q + +         P  +VP+ K+   L ++  A+    +KA  + +  D+    TS+    IS+ +        P    DF+ Y+L+R  ++ +    IV+ +N + +L+  ++    +++K     E  +    +L  E  ++ + ++  +V  +       N+ A  + P               + KE  +    +   +++  C +CK   DQH+L+ CD C    H+GCLDPPLTRMP+KTK   WQCS C  A++D+
Sbjct:  268 DSLLERPQTWSSQRMEHILICCVCLGDNSEDADEIIQCDNCGVTVHEGCYGVDGESDSIMSSASENSTEPWFCDACKNGVS-PSCELCPSQDGIFKETDAGRWVHVVCALYVPGVAFGDIDKLRP--------------ECSLCEDTRFARTGVCISCDAGMCRSFFHVTCAQREGLLSEAAAEEDIADPFFAYCKQHADRFDRKWKRKNYLALQSYCKVSLQEREKQLTPEAQARITTRLQQYRAKAELSRNTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDTSD----ISASVDGRRKHKQPALTADFVNYYLERNMRMIQIQDNIVEQKNLKDKLESEQEKLHMEYDKLCESLEDLQNVNGQLRTEGQSI-WSMMGGIVGQK------LNVPAVLKAPKERKP----------SKKEGGSPGKSSSLPAMLYSCGICKKNQDQHLLLLCDTCKLHYHLGCLDPPLTRMPKKTKNSYWQCSECDQASSDE 736          

HSP 2 Score: 62.003 bits (149), Expect = 1.108e-8
Identity = 28/69 (40.58%), Postives = 35/69 (50.72%), Query Frame = 1
Query: 6742 SATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATT 6948
            S    K K D    EC  CK   D   L+ CD C    H GCLDPPL + P++T  YGW C  C  +++
Sbjct:  809 STLQKKPKADDTRTECTTCKGPGDNENLVRCDECRLCYHFGCLDPPLKKSPKQTG-YGWICQECDTSSS 876          
BLAST of PHD finger protein 14 vs. Ensembl Zebrafish
Match: mllt10 (MLLT10 histone lysine methyltransferase DOT1L cofactor [Source:ZFIN;Acc:ZDB-GENE-041114-176])

HSP 1 Score: 127.102 bits (318), Expect = 9.632e-31
Identity = 70/201 (34.83%), Postives = 102/201 (50.75%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSN--VSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC---ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKN 6099
            E +  C +C  +  +++N LV CDG  C + VH+ CY I              T PWFC  C S    +  RCELCP ++G  KRT+N  W H++CALY P V F +  T+  I L  +P + ++ + C +C        A TG C++C+   C+  FHV CAQ  GLL E    +  +  Y   C+ H +K   K R ++
Sbjct:   21 EMIGGCCVCSDERGWAENPLVYCDGHGCNVAVHQACYGIVQVP----------TGPWFCRKCESQERAARVRCELCPQKDGALKRTDNGGWAHVVCALYIPEVEFANVSTMEPIVLQSVPHERYN-KTCYICEEQGRESKAATGACMTCNKHGCRQAFHVTCAQLAGLLCEEQGSDADNVKYCGYCKYHYNKLKHKERDRH 210          
BLAST of PHD finger protein 14 vs. Ensembl Zebrafish
Match: mllt10 (MLLT10 histone lysine methyltransferase DOT1L cofactor [Source:ZFIN;Acc:ZDB-GENE-041114-176])

HSP 1 Score: 127.102 bits (318), Expect = 9.632e-31
Identity = 70/201 (34.83%), Postives = 102/201 (50.75%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSN--VSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC---ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKN 6099
            E +  C +C  +  +++N LV CDG  C + VH+ CY I              T PWFC  C S    +  RCELCP ++G  KRT+N  W H++CALY P V F +  T+  I L  +P + ++ + C +C        A TG C++C+   C+  FHV CAQ  GLL E    +  +  Y   C+ H +K   K R ++
Sbjct:   21 EMIGGCCVCSDERGWAENPLVYCDGHGCNVAVHQACYGIVQVP----------TGPWFCRKCESQERAARVRCELCPQKDGALKRTDNGGWAHVVCALYIPEVEFANVSTMEPIVLQSVPHERYN-KTCYICEEQGRESKAATGACMTCNKHGCRQAFHVTCAQLAGLLCEEQGSDADNVKYCGYCKYHYNKLKHKERDRH 210          
BLAST of PHD finger protein 14 vs. Ensembl Xenopus
Match: phf14 (PHD finger protein 14 [Source:NCBI gene;Acc:100216242])

HSP 1 Score: 314.694 bits (805), Expect = 1.384e-89
Identity = 176/494 (35.63%), Postives = 270/494 (54.66%), Query Frame = 1
Query: 5512 KFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVL---NSQTSNDLKTI-SSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEKEFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETS---ATNTKTKP-DSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHA 6963
            K ++++IC +CL D+S   +E+++CD CGI VHE CY +          +S++ST PWFCDAC   VS P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC  C +P FARTG+CISCDAG+C++ FHV CAQKEGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L+E          +R+  + Q +           P  +VP+ K+   L ++  A+    +KA  + +  D+    NS TS+ +        P    DF+ Y+L+R  ++ +    + + +N + +L+  ++    ++NK     +  +              ++   L    + + ++ + +A       G   N    L S  +++ S       KT P  +V+  C +CK  +DQH+L+ CD C    H+GCLDPPLTRMP+KTK   WQCS C  A + D  A
Sbjct:  264 KVDHILICCVCLGDNSEDADEIIQCDNCGITVHEGCYGVDGESDSIMSSASENSTEPWFCDACKCGVS-PSCELCPNQDGIFKETDAGRWVHIVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSFCEDPRFARTGVCISCDAGMCRSYFHVTCAQKEGLLSEAAAEEDIADPFFAYCKQHADRFDRKWKRKNYLALQSYCKMSLKEREKQLAPEAQARISTRLQQYRVKSELARSTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDNSDTSSSVDGRRKHKQPALSADFVNYYLERNMRMMQLQENMTEQKNIKDKLENEQEKLHIEYNKLCETLDDLQ--------------NMNSSLRNEGQTLWIMMSKIA-------GQKTNIPAILRSPKERKPSKREGGTQKTSPLPAVLYSCGICKRSNDQHLLLLCDTCKLHYHLGCLDPPLTRMPKKTKNSYWQCSECDQAGSSDIEA 735          
BLAST of PHD finger protein 14 vs. Ensembl Xenopus
Match: phf14 (PHD finger protein 14 [Source:NCBI gene;Acc:100216242])

HSP 1 Score: 312.383 bits (799), Expect = 1.074e-88
Identity = 179/508 (35.24%), Postives = 274/508 (53.94%), Query Frame = 1
Query: 5512 KFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVL---NSQTSNDLKTI-SSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEKEFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETS---ATNTKTKP-DSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLDVNRPRQLRRS 7005
            K ++++IC +CL D+S   +E+++CD CGI VHE CY +          +S++ST PWFCDAC   VS P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC  C +P FARTG+CISCDAG+C++ FHV CAQKEGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L+E          +R+  + Q +           P  +VP+ K+   L ++  A+    +KA  + +  D+    NS TS+ +        P    DF+ Y+L+R  ++ +    + + +N + +L+  ++    ++NK     +  +              ++   L    + + ++ + +A       G   N    L S  +++ S       KT P  +V+  C +CK  +DQH+L+ CD C    H+GCLDPPLTRMP+KTK   WQCS C  A + D  A       P   +RS
Sbjct:  244 KVDHILICCVCLGDNSEDADEIIQCDNCGITVHEGCYGVDGESDSIMSSASENSTEPWFCDACKCGVS-PSCELCPNQDGIFKETDAGRWVHIVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSFCEDPRFARTGVCISCDAGMCRSYFHVTCAQKEGLLSEAAAEEDIADPFFAYCKQHADRFDRKWKRKNYLALQSYCKMSLKEREKQLAPEAQARISTRLQQYRVKSELARSTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDNSDTSSSVDGRRKHKQPALSADFVNYYLERNMRMMQLQENMTEQKNIKDKLENEQEKLHIEYNKLCETLDDLQ--------------NMNSSLRNEGQTLWIMMSKIA-------GQKTNIPAILRSPKERKPSKREGGTQKTSPLPAVLYSCGICKRSNDQHLLLLCDTCKLHYHLGCLDPPLTRMPKKTKNSYWQCSECDQAGSSDIEADFAMETLPDGTKRS 729          

HSP 2 Score: 63.929 bits (154), Expect = 4.430e-9
Identity = 28/63 (44.44%), Postives = 35/63 (55.56%), Query Frame = 1
Query: 6745 ATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLC 6933
            A + K K D +  EC +CK   D   L+ CD C    H GCLDPPL + P++T  YGW C  C
Sbjct:  789 ALHKKPKSDDLRTECAVCKGTGDNENLVRCDECTLCYHFGCLDPPLKKSPKQTG-YGWICQEC 850          
BLAST of PHD finger protein 14 vs. Ensembl Xenopus
Match: phf14 (PHD finger protein 14 [Source:NCBI gene;Acc:100216242])

HSP 1 Score: 312.768 bits (800), Expect = 1.244e-88
Identity = 179/508 (35.24%), Postives = 274/508 (53.94%), Query Frame = 1
Query: 5512 KFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVL---NSQTSNDLKTI-SSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEKEFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETS---ATNTKTKP-DSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLDVNRPRQLRRS 7005
            K ++++IC +CL D+S   +E+++CD CGI VHE CY +          +S++ST PWFCDAC   VS P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC  C +P FARTG+CISCDAG+C++ FHV CAQKEGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L+E          +R+  + Q +           P  +VP+ K+   L ++  A+    +KA  + +  D+    NS TS+ +        P    DF+ Y+L+R  ++ +    + + +N + +L+  ++    ++NK     +  +              ++   L    + + ++ + +A       G   N    L S  +++ S       KT P  +V+  C +CK  +DQH+L+ CD C    H+GCLDPPLTRMP+KTK   WQCS C  A + D  A       P   +RS
Sbjct:  264 KVDHILICCVCLGDNSEDADEIIQCDNCGITVHEGCYGVDGESDSIMSSASENSTEPWFCDACKCGVS-PSCELCPNQDGIFKETDAGRWVHIVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSFCEDPRFARTGVCISCDAGMCRSYFHVTCAQKEGLLSEAAAEEDIADPFFAYCKQHADRFDRKWKRKNYLALQSYCKMSLKEREKQLAPEAQARISTRLQQYRVKSELARSTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDNSDTSSSVDGRRKHKQPALSADFVNYYLERNMRMMQLQENMTEQKNIKDKLENEQEKLHIEYNKLCETLDDLQ--------------NMNSSLRNEGQTLWIMMSKIA-------GQKTNIPAILRSPKERKPSKREGGTQKTSPLPAVLYSCGICKRSNDQHLLLLCDTCKLHYHLGCLDPPLTRMPKKTKNSYWQCSECDQAGSSDIEADFAMETLPDGTKRS 749          

HSP 2 Score: 63.929 bits (154), Expect = 3.884e-9
Identity = 28/63 (44.44%), Postives = 35/63 (55.56%), Query Frame = 1
Query: 6745 ATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLC 6933
            A + K K D +  EC +CK   D   L+ CD C    H GCLDPPL + P++T  YGW C  C
Sbjct:  809 ALHKKPKSDDLRTECAVCKGTGDNENLVRCDECTLCYHFGCLDPPLKKSPKQTG-YGWICQEC 870          
BLAST of PHD finger protein 14 vs. Ensembl Xenopus
Match: phf14 (PHD finger protein 14 [Source:NCBI gene;Acc:100216242])

HSP 1 Score: 312.768 bits (800), Expect = 2.119e-88
Identity = 176/494 (35.63%), Postives = 270/494 (54.66%), Query Frame = 1
Query: 5512 KFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVL---NSQTSNDLKTI-SSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEKEFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETS---ATNTKTKP-DSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHA 6963
            K ++++IC +CL D+S   +E+++CD CGI VHE CY +          +S++ST PWFCDAC   VS P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC  C +P FARTG+CISCDAG+C++ FHV CAQKEGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L+E          +R+  + Q +           P  +VP+ K+   L ++  A+    +KA  + +  D+    NS TS+ +        P    DF+ Y+L+R  ++ +    + + +N + +L+  ++    ++NK     +  +              ++   L    + + ++ + +A       G   N    L S  +++ S       KT P  +V+  C +CK  +DQH+L+ CD C    H+GCLDPPLTRMP+KTK   WQCS C  A + D  A
Sbjct:  264 KVDHILICCVCLGDNSEDADEIIQCDNCGITVHEGCYGVDGESDSIMSSASENSTEPWFCDACKCGVS-PSCELCPNQDGIFKETDAGRWVHIVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSFCEDPRFARTGVCISCDAGMCRSYFHVTCAQKEGLLSEAAAEEDIADPFFAYCKQHADRFDRKWKRKNYLALQSYCKMSLKEREKQLAPEAQARISTRLQQYRVKSELARSTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDNSDTSSSVDGRRKHKQPALSADFVNYYLERNMRMMQLQENMTEQKNIKDKLENEQEKLHIEYNKLCETLDDLQ--------------NMNSSLRNEGQTLWIMMSKIA-------GQKTNIPAILRSPKERKPSKREGGTQKTSPLPAVLYSCGICKRSNDQHLLLLCDTCKLHYHLGCLDPPLTRMPKKTKNSYWQCSECDQAGSSDIEA 735          

HSP 2 Score: 68.9366 bits (167), Expect = 1.315e-10
Identity = 35/98 (35.71%), Postives = 47/98 (47.96%), Query Frame = 1
Query: 6745 ATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLC-----------SCATTDDEHAKNLDVNRPRQLRRS 7005
            A + K K D +  EC +CK   D   L+ CD C    H GCLDPPL + P++T  YGW C  C           +  +++    +   VNRPRQ   S
Sbjct:  809 ALHKKPKSDDLRTECAVCKGTGDNENLVRCDECTLCYHFGCLDPPLKKSPKQTG-YGWICQECDSTSSKEVYQNAAGSSESAATRKTKVNRPRQSHHS 905          
BLAST of PHD finger protein 14 vs. Ensembl Xenopus
Match: phf14 (PHD finger protein 14 [Source:NCBI gene;Acc:100216242])

HSP 1 Score: 310.842 bits (795), Expect = 2.157e-88
Identity = 179/508 (35.24%), Postives = 274/508 (53.94%), Query Frame = 1
Query: 5512 KFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVL---NSQTSNDLKTI-SSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEKEFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETS---ATNTKTKP-DSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLDVNRPRQLRRS 7005
            K ++++IC +CL D+S   +E+++CD CGI VHE CY +          +S++ST PWFCDAC   VS P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC  C +P FARTG+CISCDAG+C++ FHV CAQKEGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L+E          +R+  + Q +           P  +VP+ K+   L ++  A+    +KA  + +  D+    NS TS+ +        P    DF+ Y+L+R  ++ +    + + +N + +L+  ++    ++NK     +  +              ++   L    + + ++ + +A       G   N    L S  +++ S       KT P  +V+  C +CK  +DQH+L+ CD C    H+GCLDPPLTRMP+KTK   WQCS C  A + D  A       P   +RS
Sbjct:  220 KVDHILICCVCLGDNSEDADEIIQCDNCGITVHEGCYGVDGESDSIMSSASENSTEPWFCDACKCGVS-PSCELCPNQDGIFKETDAGRWVHIVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSFCEDPRFARTGVCISCDAGMCRSYFHVTCAQKEGLLSEAAAEEDIADPFFAYCKQHADRFDRKWKRKNYLALQSYCKMSLKEREKQLAPEAQARISTRLQQYRVKSELARSTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDNSDTSSSVDGRRKHKQPALSADFVNYYLERNMRMMQLQENMTEQKNIKDKLENEQEKLHIEYNKLCETLDDLQ--------------NMNSSLRNEGQTLWIMMSKIA-------GQKTNIPAILRSPKERKPSKREGGTQKTSPLPAVLYSCGICKRSNDQHLLLLCDTCKLHYHLGCLDPPLTRMPKKTKNSYWQCSECDQAGSSDIEADFAMETLPDGTKRS 705          

HSP 2 Score: 63.1586 bits (152), Expect = 5.928e-9
Identity = 28/63 (44.44%), Postives = 35/63 (55.56%), Query Frame = 1
Query: 6745 ATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLC 6933
            A + K K D +  EC +CK   D   L+ CD C    H GCLDPPL + P++T  YGW C  C
Sbjct:  760 ALHKKPKSDDLRTECAVCKGTGDNENLVRCDECTLCYHFGCLDPPLKKSPKQTG-YGWICQEC 821          
BLAST of PHD finger protein 14 vs. Ensembl Mouse
Match: Phf14 (PHD finger protein 14 [Source:MGI Symbol;Acc:MGI:1923539])

HSP 1 Score: 321.627 bits (823), Expect = 8.614e-92
Identity = 186/528 (35.23%), Postives = 284/528 (53.79%), Query Frame = 1
Query: 5443 TKKRESETILDNLNDYRTIANKTKFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVL---NSQTSNDLKTI-SSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEK-EFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLDVNRPRQLRRS 7005
            +K  E   IL+   ++ +     K ++++IC +CL D+S   +E+++CD CGI VHE CY +          +S++ST PWFCDAC   VS P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC  C +P FARTG+CISCDAG+C+  FHV CAQKEGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L+E     +    +R+  + Q + +         P  +VP+ K+   L ++  A+    +KA  + +  D+    NS TS+ +        P    DF+ Y+ +R  ++ +    + + +N + +L+  ++    ++NK     E  +    KL  E   + + ++ ++   +       N+ A  + P          S   G  ++TSA  T      V+  C +CK   DQH+L+ CD C    H+GCLDPPLTRMPRKTK   WQCS C  A + D  A+      P   +RS
Sbjct:  289 SKSNEDSLILEKSQNWSS----QKMDHILICCVCLGDNSEDADEIIQCDNCGITVHEGCYGVDGESDSIMSSASENSTEPWFCDACKCGVS-PSCELCPNQDGIFKETDAGRWVHIVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSFCEDPRFARTGVCISCDAGMCRAYFHVTCAQKEGLLSEAAAEEDIADPFFAYCKQHADRLDRKWKRKNYLALQSYCKMSLQEREKQLSPEAQARINARLQQYRAKAELARSTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDNSDTSSSVDGRRKHKQPALTADFVNYYFERNMRMIQIQENMAEQKNIKDKLENEQEKLHVEYNKLCESLEELQNLNGKLRSEGQGI-WALLGRITGQKL------NVPAILRAPKERKP-----SKKEGGTQKTSALPT------VLYSCGICKKNHDQHLLLLCDTCKLHYHLGCLDPPLTRMPRKTKNSYWQCSECDQAGSSDMEAEMAMETLPDGTKRS 793          
BLAST of PHD finger protein 14 vs. Ensembl Mouse
Match: Phf14 (PHD finger protein 14 [Source:MGI Symbol;Acc:MGI:1923539])

HSP 1 Score: 321.242 bits (822), Expect = 1.073e-91
Identity = 186/528 (35.23%), Postives = 284/528 (53.79%), Query Frame = 1
Query: 5443 TKKRESETILDNLNDYRTIANKTKFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVL---NSQTSNDLKTI-SSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEK-EFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLDVNRPRQLRRS 7005
            +K  E   IL+   ++ +     K ++++IC +CL D+S   +E+++CD CGI VHE CY +          +S++ST PWFCDAC   VS P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC  C +P FARTG+CISCDAG+C+  FHV CAQKEGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L+E     +    +R+  + Q + +         P  +VP+ K+   L ++  A+    +KA  + +  D+    NS TS+ +        P    DF+ Y+ +R  ++ +    + + +N + +L+  ++    ++NK     E  +    KL  E   + + ++ ++   +       N+ A  + P          S   G  ++TSA  T      V+  C +CK   DQH+L+ CD C    H+GCLDPPLTRMPRKTK   WQCS C  A + D  A+      P   +RS
Sbjct:  289 SKSNEDSLILEKSQNWSS----QKMDHILICCVCLGDNSEDADEIIQCDNCGITVHEGCYGVDGESDSIMSSASENSTEPWFCDACKCGVS-PSCELCPNQDGIFKETDAGRWVHIVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSFCEDPRFARTGVCISCDAGMCRAYFHVTCAQKEGLLSEAAAEEDIADPFFAYCKQHADRLDRKWKRKNYLALQSYCKMSLQEREKQLSPEAQARINARLQQYRAKAELARSTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDNSDTSSSVDGRRKHKQPALTADFVNYYFERNMRMIQIQENMAEQKNIKDKLENEQEKLHVEYNKLCESLEELQNLNGKLRSEGQGI-WALLGRITGQKL------NVPAILRAPKERKP-----SKKEGGTQKTSALPT------VLYSCGICKKNHDQHLLLLCDTCKLHYHLGCLDPPLTRMPRKTKNSYWQCSECDQAGSSDMEAEMAMETLPDGTKRS 793          
BLAST of PHD finger protein 14 vs. Ensembl Mouse
Match: Phf14 (PHD finger protein 14 [Source:MGI Symbol;Acc:MGI:1923539])

HSP 1 Score: 320.857 bits (821), Expect = 4.527e-91
Identity = 186/528 (35.23%), Postives = 284/528 (53.79%), Query Frame = 1
Query: 5443 TKKRESETILDNLNDYRTIANKTKFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVL---NSQTSNDLKTI-SSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEK-EFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLDVNRPRQLRRS 7005
            +K  E   IL+   ++ +     K ++++IC +CL D+S   +E+++CD CGI VHE CY +          +S++ST PWFCDAC   VS P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC  C +P FARTG+CISCDAG+C+  FHV CAQKEGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L+E     +    +R+  + Q + +         P  +VP+ K+   L ++  A+    +KA  + +  D+    NS TS+ +        P    DF+ Y+ +R  ++ +    + + +N + +L+  ++    ++NK     E  +    KL  E   + + ++ ++   +       N+ A  + P          S   G  ++TSA  T      V+  C +CK   DQH+L+ CD C    H+GCLDPPLTRMPRKTK   WQCS C  A + D  A+      P   +RS
Sbjct:  289 SKSNEDSLILEKSQNWSS----QKMDHILICCVCLGDNSEDADEIIQCDNCGITVHEGCYGVDGESDSIMSSASENSTEPWFCDACKCGVS-PSCELCPNQDGIFKETDAGRWVHIVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSFCEDPRFARTGVCISCDAGMCRAYFHVTCAQKEGLLSEAAAEEDIADPFFAYCKQHADRLDRKWKRKNYLALQSYCKMSLQEREKQLSPEAQARINARLQQYRAKAELARSTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDNSDTSSSVDGRRKHKQPALTADFVNYYFERNMRMIQIQENMAEQKNIKDKLENEQEKLHVEYNKLCESLEELQNLNGKLRSEGQGI-WALLGRITGQK------LNVPAILRAPKERKP-----SKKEGGTQKTSALPT------VLYSCGICKKNHDQHLLLLCDTCKLHYHLGCLDPPLTRMPRKTKNSYWQCSECDQAGSSDMEAEMAMETLPDGTKRS 793          

HSP 2 Score: 62.7734 bits (151), Expect = 6.558e-9
Identity = 30/74 (40.54%), Postives = 40/74 (54.05%), Query Frame = 1
Query: 6742 SATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLC-SCATTDDEH 6960
            S    K K + +  EC  CK   D   L+ CD C    H GCLDPPL + P++T  YGW C  C S ++ +DE+
Sbjct:  849 SVLQKKPKAEDLRTECSTCKGTGDNENLVRCDECRLCYHFGCLDPPLKKSPKQTG-YGWICQECDSSSSKEDEN 921          
BLAST of PHD finger protein 14 vs. Ensembl Mouse
Match: Phf14 (PHD finger protein 14 [Source:MGI Symbol;Acc:MGI:1923539])

HSP 1 Score: 230.72 bits (587), Expect = 7.439e-68
Identity = 107/211 (50.71%), Postives = 144/211 (68.25%), Query Frame = 1
Query: 5512 KFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXX-XTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEE 6141
            K ++++IC +CL D+S   +E+++CD CGI VHE CY +         S+   ST PWFCDAC   VS P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC  C +P FARTG+CISCDAG+C+  FHV CAQKEGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L+E
Sbjct:   34 KMDHILICCVCLGDNSEDADEIIQCDNCGITVHEGCYGVDGESDSIMSSASENSTEPWFCDACKCGVS-PSCELCPNQDGIFKETDAGRWVHIVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSFCEDPRFARTGVCISCDAGMCRAYFHVTCAQKEGLLSEAAAEEDIADPFFAYCKQHADRLDRKWKRKNYLALQSYCKMSLQE 243          
BLAST of PHD finger protein 14 vs. Ensembl Mouse
Match: Mllt10 (myeloid/lymphoid or mixed-lineage leukemia; translocated to, 10 [Source:MGI Symbol;Acc:MGI:1329038])

HSP 1 Score: 128.257 bits (321), Expect = 7.307e-29
Identity = 71/201 (35.32%), Postives = 97/201 (48.26%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSN--VSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC---ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKN 6099
            E +  C +C  +  +++N LV CDG  C + VH+ CY I              T PWFC  C S    +  RCELCP ++G  KRT+N  W H++CALY P V F +  T+  I L  +P  D   + C +C        A TG C++C+   C+  FHV CAQ  GLL E       +  Y   C+ H  K    +R  N
Sbjct:   20 EMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQVP----------TGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVSTMEPIVLQSVP-HDRYNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSN 209          
BLAST of PHD finger protein 14 vs. UniProt/SwissProt
Match: sp|Q9D4H9|PHF14_MOUSE (PHD finger protein 14 OS=Mus musculus OX=10090 GN=Phf14 PE=1 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 7.502e-91
Identity = 186/528 (35.23%), Postives = 284/528 (53.79%), Query Frame = 1
Query: 5443 TKKRESETILDNLNDYRTIANKTKFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVL---NSQTSNDLKTI-SSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEK-EFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLDVNRPRQLRRS 7005
            +K  E   IL+   ++ +     K ++++IC +CL D+S   +E+++CD CGI VHE CY +          +S++ST PWFCDAC   VS P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC  C +P FARTG+CISCDAG+C+  FHV CAQKEGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L+E     +    +R+  + Q + +         P  +VP+ K+   L ++  A+    +KA  + +  D+    NS TS+ +        P    DF+ Y+ +R  ++ +    + + +N + +L+  ++    ++NK     E  +    KL  E   + + ++ ++   +       N+ A  + P          S   G  ++TSA  T      V+  C +CK   DQH+L+ CD C    H+GCLDPPLTRMPRKTK   WQCS C  A + D  A+      P   +RS
Sbjct:  289 SKSNEDSLILEKSQNWSS----QKMDHILICCVCLGDNSEDADEIIQCDNCGITVHEGCYGVDGESDSIMSSASENSTEPWFCDACKCGVS-PSCELCPNQDGIFKETDAGRWVHIVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSFCEDPRFARTGVCISCDAGMCRAYFHVTCAQKEGLLSEAAAEEDIADPFFAYCKQHADRLDRKWKRKNYLALQSYCKMSLQEREKQLSPEAQARINARLQQYRAKAELARSTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDNSDTSSSVDGRRKHKQPALTADFVNYYFERNMRMIQIQENMAEQKNIKDKLENEQEKLHVEYNKLCESLEELQNLNGKLRSEGQGI-WALLGRITGQKL------NVPAILRAPKERKP-----SKKEGGTQKTSALPT------VLYSCGICKKNHDQHLLLLCDTCKLHYHLGCLDPPLTRMPRKTKNSYWQCSECDQAGSSDMEAEMAMETLPDGTKRS 793          
BLAST of PHD finger protein 14 vs. UniProt/SwissProt
Match: sp|O94880|PHF14_HUMAN (PHD finger protein 14 OS=Homo sapiens OX=9606 GN=PHF14 PE=1 SV=2)

HSP 1 Score: 321.627 bits (823), Expect = 7.717e-91
Identity = 185/528 (35.04%), Postives = 282/528 (53.41%), Query Frame = 1
Query: 5443 TKKRESETILDNLNDYRTIANKTKFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVL---NSQTSNDLKT-ISSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEK-EFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLDVNRPRQLRRS 7005
            +K  E   IL+   ++ +     K ++++IC +CL D+S   +E+++CD CGI VHE CY +          +S++ST PWFCDAC   VS P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC  C +P FARTG+CISCDAG+C+  FHV CAQKEGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L+E     +    +R+  + Q + +         P  +VP+ K+   L ++  A+    +KA  + +  D+    NS TS+ +        P    DF+ Y+ +R  ++ +    + + +N + +L+  ++    ++NK     E  +    KL  E   + + ++ ++   +       N+ A  + P               + KE     T T P +V+  C +CK   DQH+L+ CD C    H+GCLDPPLTRMPRKTK   WQCS C  A + D  A       P   +RS
Sbjct:  296 SKSNEDSLILEKSQNWSS----QKMDHILICCVCLGDNSEDADEIIQCDNCGITVHEGCYGVDGESDSIMSSASENSTEPWFCDACKCGVS-PSCELCPNQDGIFKETDAGRWVHIVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSFCEDPRFARTGVCISCDAGMCRAYFHVTCAQKEGLLSEAAAEEDIADPFFAYCKQHADRLDRKWKRKNYLALQSYCKMSLQEREKQLSPEAQARINARLQQYRAKAELARSTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDNSDTSSSVDGRRKHKQPALTADFVNYYFERNMRMIQIQENMAEQKNIKDKLENEQEKLHVEYNKLCESLEELQNLNGKLRSEGQGI-WALLGRITGQKL------NIPAILRAPKERKP----------SKKEGGTQKTSTLP-AVLYSCGICKKNHDQHLLLLCDTCKLHYHLGCLDPPLTRMPRKTKNSYWQCSECDQAGSSDMEADMAMETLPDGTKRS 800          
BLAST of PHD finger protein 14 vs. UniProt/SwissProt
Match: sp|P55197|AF10_HUMAN (Protein AF-10 OS=Homo sapiens OX=9606 GN=MLLT10 PE=1 SV=2)

HSP 1 Score: 128.642 bits (322), Expect = 4.169e-28
Identity = 71/201 (35.32%), Postives = 97/201 (48.26%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSN--VSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC---ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKN 6099
            E +  C +C  +  +++N LV CDG  C + VH+ CY I              T PWFC  C S    +  RCELCP ++G  KRT+N  W H++CALY P V F +  T+  I L  +P  D   + C +C        A TG C++C+   C+  FHV CAQ  GLL E       +  Y   C+ H  K    +R  N
Sbjct:   20 EMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQVP----------TGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVSTMEPIVLQSVP-HDRYNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSN 209          
BLAST of PHD finger protein 14 vs. UniProt/SwissProt
Match: sp|O54826|AF10_MOUSE (Protein AF-10 OS=Mus musculus OX=10090 GN=Mllt10 PE=1 SV=2)

HSP 1 Score: 128.257 bits (321), Expect = 5.111e-28
Identity = 71/201 (35.32%), Postives = 97/201 (48.26%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSN--VSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC---ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKN 6099
            E +  C +C  +  +++N LV CDG  C + VH+ CY I              T PWFC  C S    +  RCELCP ++G  KRT+N  W H++CALY P V F +  T+  I L  +P  D   + C +C        A TG C++C+   C+  FHV CAQ  GLL E       +  Y   C+ H  K    +R  N
Sbjct:   20 EMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQVP----------TGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVSTMEPIVLQSVP-HDRYNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSN 209          
BLAST of PHD finger protein 14 vs. UniProt/SwissProt
Match: sp|P55198|AF17_HUMAN (Protein AF-17 OS=Homo sapiens OX=9606 GN=MLLT6 PE=1 SV=3)

HSP 1 Score: 122.865 bits (307), Expect = 2.712e-26
Identity = 71/197 (36.04%), Postives = 96/197 (48.73%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSN--VSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC---ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKR 6087
            E V  C +C  +  +++N LV CDG  C + VH+ CY I              T PWFC  C S    +  RCELCP ++G  KRT+N  W H++CALY P V F +  T+  I L  +P  D   + C +C        A +G C++C+   C+  FHV CAQ  GLL E    E  +  Y   C+ H  K    R
Sbjct:    3 EMVGGCCVCSDERGWAENPLVYCDGHACSVAVHQACYGIVQVP----------TGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVLTMEPIVLQYVP-HDRFNKTCYICEEQGRESKAASGACMTCNRHGCRQAFHVTCAQMAGLLCEEEVLEVDNVKYCGYCKYHFSKMKTSR 188          
BLAST of PHD finger protein 14 vs. TrEMBL
Match: A0A0V0J661 (PHD finger protein 14 (Fragment) OS=Schistocephalus solidus OX=70667 GN=PHF14 PE=4 SV=1)

HSP 1 Score: 452.21 bits (1162), Expect = 7.476e-132
Identity = 233/571 (40.81%), Postives = 330/571 (57.79%), Query Frame = 1
Query: 5527 MICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRL---EEWHNNNHYNDS------------------RLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVLNSQTSNDL-KTISSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEKEFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIP----------TNGSTGNGNES---------------------------------------------LVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLDVNRPRQLRRSN 7008
            +ICM+CL D S  ++E++ECD C I VHEDC+K+ D VF+S  +S S T PWFC+ CL+ V NP CELCP   G+FKRT+NNRWVHLLCALYTPGVAFN +E+L+E+TL+ELP K+WS++EC LC + FFA TG+CISCDAGLCKN FHV CAQK+GLL EP  EEN  DP+FA CRQHTDK   K RR+N+   VNR K+ L   +E H  N Y+++                  RL RK ++F S++ + L+    P+   TKV  +LE +P+A+ LF  KA  L LP D   S    +  K+++ G PVF PDF++Y LDREK+I+E  + +  LE+ +RELQ+S+ N SH +N    +      + K          + + ++ ++   +  ++ LLA  + P          + G T  G +S                                             L  G +     TN     +++I+EC +C  + DQH+++ C+ C K  HI CLDPPL+R+P++++L+ WQCS C+ A   +     +DV+ PRQLRR++
Sbjct:  156 LICMLCLGDQSNPNDEIIECDACKIAVHEDCHKVYDDVFLSSSASSSDTDPWFCEPCLAGVENPHCELCPNLGGIFKRTDNNRWVHLLCALYTPGVAFNYSESLTEVTLTELPAKEWSSKECCLCEDKFFAWTGVCISCDAGLCKNYFHVTCAQKQGLLVEPAFEENPSDPFFAQCRQHTDKTVAKGRRRNYLTTVNRCKVLLQMAQEQHRGNVYDNTEEFGASTTELSLFALLNERLKRKLEYFRSLYQRMLDRREKPYTRPTKVPLYLENSPVAMRLFAAKALALGLPLDFTGSSAMTEASKSVAPGCPVFLPDFVSYVLDREKRIEELIKLLSTLESTQRELQLSDANVSHNYNSLSTRLAELSTKLKTNRSVAESFLNGLSKICQNVSPIGGLSTLLANQEPPSVSSGAAGPNSAGGTAAGPKSRGDTNVGVGGRGRRSAAHQSLPVAGRCSSGPLRRCTRASESSVDALGEGLESANGVTNAANATENIIHECSICNGLRDQHLMVICETCKKAFHIACLDPPLSRVPKQSRLFSWQCSTCTKAVVGNSEVVTVDVDAPRQLRRTS 726          
BLAST of PHD finger protein 14 vs. TrEMBL
Match: A0A0X3NZ71 (PHD finger protein 14 (Fragment) OS=Schistocephalus solidus OX=70667 GN=PHF14 PE=4 SV=1)

HSP 1 Score: 452.21 bits (1162), Expect = 7.550e-132
Identity = 233/571 (40.81%), Postives = 330/571 (57.79%), Query Frame = 1
Query: 5527 MICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRL---EEWHNNNHYNDS------------------RLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVLNSQTSNDL-KTISSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEKEFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIP----------TNGSTGNGNES---------------------------------------------LVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLDVNRPRQLRRSN 7008
            +ICM+CL D S  ++E++ECD C I VHEDC+K+ D VF+S  +S S T PWFC+ CL+ V NP CELCP   G+FKRT+NNRWVHLLCALYTPGVAFN +E+L+E+TL+ELP K+WS++EC LC + FFA TG+CISCDAGLCKN FHV CAQK+GLL EP  EEN  DP+FA CRQHTDK   K RR+N+   VNR K+ L   +E H  N Y+++                  RL RK ++F S++ + L+    P+   TKV  +LE +P+A+ LF  KA  L LP D   S    +  K+++ G PVF PDF++Y LDREK+I+E  + +  LE+ +RELQ+S+ N SH +N    +      + K          + + ++ ++   +  ++ LLA  + P          + G T  G +S                                             L  G +     TN     +++I+EC +C  + DQH+++ C+ C K  HI CLDPPL+R+P++++L+ WQCS C+ A   +     +DV+ PRQLRR++
Sbjct:  156 LICMLCLGDQSNPNDEIIECDACKIAVHEDCHKVYDDVFLSSSASSSDTDPWFCEPCLAGVENPHCELCPNLGGIFKRTDNNRWVHLLCALYTPGVAFNYSESLTEVTLTELPAKEWSSKECCLCEDKFFAWTGVCISCDAGLCKNYFHVTCAQKQGLLVEPAFEENPSDPFFAQCRQHTDKTVAKGRRRNYLTTVNRCKVLLQMAQEQHRGNVYDNTEEFGASTTELSLFALLNERLKRKLEYFRSLYQRMLDRREKPYTRPTKVPLYLENSPVAMRLFAAKALALGLPLDFTGSSAMTEASKSVAPGCPVFLPDFVSYVLDREKRIEELIKLLSTLESTQRELQLSDANVSHNYNSLSTRLAELSTKLKTNRSVAESFLNGLSKICQNVSPIGGLSTLLANQEPPSVSSGAAGPNSAGGTAAGPKSRGDTNVGVGGRGRRSAAHQSLPVAGRCSSGPLRRCTRASESSVDALGEGLESANGVTNAANATENIIHECSICNGLRDQHLMVICETCKKAFHIACLDPPLSRVPKQSRLFSWQCSTCTKAVVGNSEVVTVDVDAPRQLRRTS 726          
BLAST of PHD finger protein 14 vs. TrEMBL
Match: A0A4Z2CVV1 (PHD finger protein isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_007186 PE=4 SV=1)

HSP 1 Score: 442.195 bits (1136), Expect = 1.520e-131
Identity = 243/572 (42.48%), Postives = 330/572 (57.69%), Query Frame = 1
Query: 5527 MICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNNNHYN---------------------DSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVLNSQTSN--DLKTISSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKE---SAEKEFKLGLEQVA-----------LKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGN--GNESLVSGAD----------------------------KETSATNTKTKPDSV-------INECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLDVNRPRQLRRSNDLRS 7020
            MICM+CL DS   ++EL+ECDGCGIVVHEDCYK+  S+F+S  +S SST  WFC+ CL+ +++P CELCPV +GVFK+T+NNRWVHLLCALYTPGVAFND + L ++TL+ELP + WS  EC LC + FFA TG+CISCDAGLC+  FHV CAQK GLLSEP  EE+S DP+FA+CRQHTDK   + RR+N+  A+    LRL +W +N                         D R+ RK + +  ++   L     P+VP  K   FLET+P+A+ +F  KA  L LP + L+S  SN    K  +   PVF PDFI+YFL+RE+KI E S+ I  L+N +RELQIS+ + SH +N   A+ E       + ++ L  +               ++   L + R L E  N  L+    P + S     G+ ++++ +                             K  +++  +  P SV       I EC +C  + DQH++  CD C K  H+ CLDPPL RMP++ KLYGWQCS C+   +    A+ +DVN PRQLRRS  + S
Sbjct:    1 MICMLCLGDSIDPNDELIECDGCGIVVHEDCYKLVGSIFLSSGASSSSTDAWFCEPCLAGITSPVCELCPVLDGVFKKTDNNRWVHLLCALYTPGVAFNDPDNLMDVTLTELPQRQWSLHECSLCEDRFFAWTGVCISCDAGLCRTFFHVTCAQKHGLLSEPTIEESSADPFFAHCRQHTDKTVARHRRRNFLTAM----LRLRKWRSNRQLVSNCLDEKKLSSTSSLGKESTIDPRIQRKLEHYRELYMDLLRHREKPYVPLVKTPMFLETSPVAMRMFVLKAKALNLPIE-LSSHMSNTDSSKGPTPSYPVFTPDFISYFLERERKITEVSKHISTLQNTQRELQISDASASHSYNSVSAELEKLIDIRGDLRMKLLHIVNCLCSFIPDLKCSSELETILAEPRRLPETSNFDLSSSSNPVDFSNPAKFGSSAVIAASKRRSHHSSPSHKSRKVFKSEAVDQNVRLLKSPASSQLEKCPRSVAFESENVILECMVCHGLQDQHLITSCDTCGKSFHLACLDPPLLRMPKRCKLYGWQCSFCTKEVSSVPGAETIDVNAPRQLRRSTGMLS 567          
BLAST of PHD finger protein 14 vs. TrEMBL
Match: A0A0X3Q0D2 (PHD finger protein 14 (Fragment) OS=Schistocephalus solidus OX=70667 GN=PHF14 PE=4 SV=1)

HSP 1 Score: 452.595 bits (1163), Expect = 2.165e-131
Identity = 233/571 (40.81%), Postives = 330/571 (57.79%), Query Frame = 1
Query: 5527 MICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRL---EEWHNNNHYNDS------------------RLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVLNSQTSNDL-KTISSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEKEFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIP----------TNGSTGNGNES---------------------------------------------LVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLDVNRPRQLRRSN 7008
            +ICM+CL D S  ++E++ECD C I VHEDC+K+ D VF+S  +S S T PWFC+ CL+ V NP CELCP   G+FKRT+NNRWVHLLCALYTPGVAFN +E+L+E+TL+ELP K+WS++EC LC + FFA TG+CISCDAGLCKN FHV CAQK+GLL EP  EEN  DP+FA CRQHTDK   K RR+N+   VNR K+ L   +E H  N Y+++                  RL RK ++F S++ + L+    P+   TKV  +LE +P+A+ LF  KA  L LP D   S    +  K+++ G PVF PDF++Y LDREK+I+E  + +  LE+ +RELQ+S+ N SH +N    +      + K          + + ++ ++   +  ++ LLA  + P          + G T  G +S                                             L  G +     TN     +++I+EC +C  + DQH+++ C+ C K  HI CLDPPL+R+P++++L+ WQCS C+ A   +     +DV+ PRQLRR++
Sbjct:  156 LICMLCLGDQSNPNDEIIECDACKIAVHEDCHKVYDDVFLSSSASSSDTDPWFCEPCLAGVENPHCELCPNLGGIFKRTDNNRWVHLLCALYTPGVAFNYSESLTEVTLTELPAKEWSSKECCLCEDKFFAWTGVCISCDAGLCKNYFHVTCAQKQGLLVEPAFEENPSDPFFAQCRQHTDKTVAKGRRRNYLTTVNRCKVLLQMAQEQHRGNVYDNTEEFGASTTELSLFALLNERLKRKLEYFRSLYQRMLDRREKPYTRPTKVPLYLENSPVAMRLFAAKALALGLPLDFTGSSAMTEASKSVAPGCPVFLPDFVSYVLDREKRIEELIKLLSTLESTQRELQLSDANVSHNYNSLSTRLAELSTKLKTNRSVAESFLNGLSKICQNVSPIGGLSTLLANQEPPSVSSGAAGPNSAGGTAAGPKSRGDTNVGVGGRGRRSAAHQSLPVAGRCSSGPLRRCTRASESSVDALGEGLESANGVTNAANATENIIHECSICNGLRDQHLMVICETCKKAFHIACLDPPLSRVPKQSRLFSWQCSTCTKAVVGNSEVVTVDVDAPRQLRRTS 726          
BLAST of PHD finger protein 14 vs. TrEMBL
Match: A0A0X3PH67 (PHD finger protein 14 (Fragment) OS=Schistocephalus solidus OX=70667 GN=PHF14 PE=4 SV=1)

HSP 1 Score: 451.825 bits (1161), Expect = 3.520e-131
Identity = 233/571 (40.81%), Postives = 330/571 (57.79%), Query Frame = 1
Query: 5527 MICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRL---EEWHNNNHYNDS------------------RLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVLNSQTSNDL-KTISSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEKEFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIP----------TNGSTGNGNES---------------------------------------------LVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLDVNRPRQLRRSN 7008
            +ICM+CL D S  ++E++ECD C I VHEDC+K+ D VF+S  +S S T PWFC+ CL+ V NP CELCP   G+FKRT+NNRWVHLLCALYTPGVAFN +E+L+E+TL+ELP K+WS++EC LC + FFA TG+CISCDAGLCKN FHV CAQK+GLL EP  EEN  DP+FA CRQHTDK   K RR+N+   VNR K+ L   +E H  N Y+++                  RL RK ++F S++ + L+    P+   TKV  +LE +P+A+ LF  KA  L LP D   S    +  K+++ G PVF PDF++Y LDREK+I+E  + +  LE+ +RELQ+S+ N SH +N    +      + K          + + ++ ++   +  ++ LLA  + P          + G T  G +S                                             L  G +     TN     +++I+EC +C  + DQH+++ C+ C K  HI CLDPPL+R+P++++L+ WQCS C+ A   +     +DV+ PRQLRR++
Sbjct:  156 LICMLCLGDQSNPNDEIIECDACKIAVHEDCHKVYDDVFLSSSASSSDTDPWFCEPCLAGVENPHCELCPNLGGIFKRTDNNRWVHLLCALYTPGVAFNYSESLTEVTLTELPAKEWSSKECCLCEDKFFAWTGVCISCDAGLCKNYFHVTCAQKQGLLVEPAFEENPSDPFFAQCRQHTDKTVAKGRRRNYLTTVNRCKVLLQMAQEQHRGNVYDNTEEFGASTTELSLFALLNERLKRKLEYFRSLYQRMLDRREKPYTRPTKVPLYLENSPVAMRLFAAKALALGLPLDFTGSSAMTEASKSVAPGCPVFLPDFVSYVLDREKRIEELIKLLSTLESTQRELQLSDANVSHNYNSLSTRLAELSTKLKTNRSVAESFLNGLSKICQNVSPIGGLSTLLANQEPPSVSSGAAGPNSAGGTAAGPKSRGDTNVGVGGRGRRSAAHQSLPVAGRCSSGPLRRCTRASESSVDALGEGLESANGVTNAANATENIIHECSICNGLRDQHLMVICETCKKAFHIACLDPPLSRVPKQSRLFSWQCSTCTKAVVGNSEVVTVDVDAPRQLRRTS 726          
BLAST of PHD finger protein 14 vs. Ensembl Cavefish
Match: phf14 (PHD finger protein 14 [Source:NCBI gene;Acc:103029168])

HSP 1 Score: 318.546 bits (815), Expect = 5.646e-91
Identity = 172/492 (34.96%), Postives = 270/492 (54.88%), Query Frame = 1
Query: 5512 KFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVLNSQTSNDLKTISS----GIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEKEFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGAD-----KETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDD 6954
            + E+++IC +CL D+S   +E+++CD CG+ VHE CY +          +S++ST PWFCDAC + V+ P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC LC +  FARTG+CISCDAG+C++ FHV CAQ+EGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L E          +R+  + Q + +         P  +VP+ K+   L ++  A+    +KA  + +  D+    TS+   +I        P    DF+ Y+L+R  ++ +    I + +N + +L+  ++    ++NK               LE +     +++   + + +  V+  +L        G   NG   L +  +     KE  +    +   +V+  C +CK   DQH+L+ CD C    H+GCLDPPLTRMP+KTK   WQCS C  A++D+
Sbjct:  289 RMEHILICCVCLGDNSEDADEIIQCDNCGVTVHEGCYGVDGESDSIMSSASENSTEPWFCDACKNGVT-PSCELCPNQDGIFKETDAGRWVHVVCALYVPGVAFGDIDKLRPVTLTEMNYTKYGAKECSLCEDARFARTGVCISCDAGMCRSYFHVTCAQREGLLSEAAAEEDIADPFFAYCKQHADRFDRKWKRKNYLALQSYCKVSLHERERQLTPEAQARITTRLQQYRTKAELSRNTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDTSDTSASIDGRRKHKQPALTADFVNYYLERNMRMIQIQDNISEQKNLKDKLESEQEKLHVEYNKLCES-----------LEDLQNVNGLLR--TEGQAMWSVMGGIL--------GQKLNGPAILKAPKERKPSKKEGGSPGKSSSLPAVLYSCGICKKNQDQHLLLLCDTCKLHYHLGCLDPPLTRMPKKTKNSYWQCSECDQASSDE 758          
BLAST of PHD finger protein 14 vs. Ensembl Cavefish
Match: phf14 (PHD finger protein 14 [Source:NCBI gene;Acc:103029168])

HSP 1 Score: 317.005 bits (811), Expect = 3.331e-90
Identity = 172/492 (34.96%), Postives = 270/492 (54.88%), Query Frame = 1
Query: 5512 KFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVLNSQTSNDLKTISS----GIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEKEFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGAD-----KETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDD 6954
            + E+++IC +CL D+S   +E+++CD CG+ VHE CY +          +S++ST PWFCDAC + V+ P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC LC +  FARTG+CISCDAG+C++ FHV CAQ+EGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L E          +R+  + Q + +         P  +VP+ K+   L ++  A+    +KA  + +  D+    TS+   +I        P    DF+ Y+L+R  ++ +    I + +N + +L+  ++    ++NK               LE +     +++   + + +  V+  +L        G   NG   L +  +     KE  +    +   +V+  C +CK   DQH+L+ CD C    H+GCLDPPLTRMP+KTK   WQCS C  A++D+
Sbjct:  259 RMEHILICCVCLGDNSEDADEIIQCDNCGVTVHEGCYGVDGESDSIMSSASENSTEPWFCDACKNGVT-PSCELCPNQDGIFKETDAGRWVHVVCALYVPGVAFGDIDKLRPVTLTEMNYTKYGAKECSLCEDARFARTGVCISCDAGMCRSYFHVTCAQREGLLSEAAAEEDIADPFFAYCKQHADRFDRKWKRKNYLALQSYCKVSLHERERQLTPEAQARITTRLQQYRTKAELSRNTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDTSDTSASIDGRRKHKQPALTADFVNYYLERNMRMIQIQDNISEQKNLKDKLESEQEKLHVEYNKLCES-----------LEDLQNVNGLLR--TEGQAMWSVMGGIL--------GQKLNGPAILKAPKERKPSKKEGGSPGKSSSLPAVLYSCGICKKNQDQHLLLLCDTCKLHYHLGCLDPPLTRMPKKTKNSYWQCSECDQASSDE 728          

HSP 2 Score: 64.6994 bits (156), Expect = 1.515e-9
Identity = 32/82 (39.02%), Postives = 40/82 (48.78%), Query Frame = 1
Query: 6742 SATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLDVNRP 6987
            SA   K K D    EC  CK   D   L+ CD C    H GCLDPPL + P++T  YGW C  C  +++    A+     RP
Sbjct:  801 SALQKKPKADDTRTECTTCKGPGDNENLVRCDECRLCYHFGCLDPPLKKSPKQTG-YGWICQECDTSSSKVSAAEPAVETRP 881          
BLAST of PHD finger protein 14 vs. Ensembl Cavefish
Match: phf14 (PHD finger protein 14 [Source:NCBI gene;Acc:103029168])

HSP 1 Score: 317.005 bits (811), Expect = 6.387e-90
Identity = 172/492 (34.96%), Postives = 270/492 (54.88%), Query Frame = 1
Query: 5512 KFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVLNSQTSNDLKTISS----GIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEKEFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGAD-----KETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDD 6954
            + E+++IC +CL D+S   +E+++CD CG+ VHE CY +          +S++ST PWFCDAC + V+ P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC LC +  FARTG+CISCDAG+C++ FHV CAQ+EGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L E          +R+  + Q + +         P  +VP+ K+   L ++  A+    +KA  + +  D+    TS+   +I        P    DF+ Y+L+R  ++ +    I + +N + +L+  ++    ++NK               LE +     +++   + + +  V+  +L        G   NG   L +  +     KE  +    +   +V+  C +CK   DQH+L+ CD C    H+GCLDPPLTRMP+KTK   WQCS C  A++D+
Sbjct:  289 RMEHILICCVCLGDNSEDADEIIQCDNCGVTVHEGCYGVDGESDSIMSSASENSTEPWFCDACKNGVT-PSCELCPNQDGIFKETDAGRWVHVVCALYVPGVAFGDIDKLRPVTLTEMNYTKYGAKECSLCEDARFARTGVCISCDAGMCRSYFHVTCAQREGLLSEAAAEEDIADPFFAYCKQHADRFDRKWKRKNYLALQSYCKVSLHERERQLTPEAQARITTRLQQYRTKAELSRNTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDTSDTSASIDGRRKHKQPALTADFVNYYLERNMRMIQIQDNISEQKNLKDKLESEQEKLHVEYNKLCES-----------LEDLQNVNGLLR--TEGQAMWSVMGGIL--------GQKLNGPAILKAPKERKPSKKEGGSPGKSSSLPAVLYSCGICKKNQDQHLLLLCDTCKLHYHLGCLDPPLTRMPKKTKNSYWQCSECDQASSDE 758          

HSP 2 Score: 63.929 bits (154), Expect = 2.370e-9
Identity = 29/69 (42.03%), Postives = 36/69 (52.17%), Query Frame = 1
Query: 6742 SATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATT 6948
            SA   K K D    EC  CK   D   L+ CD C    H GCLDPPL + P++T  YGW C  C  +++
Sbjct:  831 SALQKKPKADDTRTECTTCKGPGDNENLVRCDECRLCYHFGCLDPPLKKSPKQTG-YGWICQECDTSSS 898          
BLAST of PHD finger protein 14 vs. Ensembl Cavefish
Match: mllt10 (MLLT10 histone lysine methyltransferase DOT1L cofactor [Source:NCBI gene;Acc:103024061])

HSP 1 Score: 130.568 bits (327), Expect = 1.229e-29
Identity = 82/257 (31.91%), Postives = 120/257 (46.69%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSN--VSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC---ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNNNHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVAC 6267
            E +  C +C  +  +++N LV CDG  C + VH+ CY I              T PWFC  C S    +  RCELCP ++G  KRT+N  W H++CALY P V F +  T+  I L  +P + ++ + C +C        A TG C++C+   C+  FHV CAQ  GLL E    +  +  Y   C+ H  K    RR K   +             + +H  + +  ++R      H K +EL  TP VP   V+ 
Sbjct:   13 EMIGGCCVCSDERGWAENPLVYCDGHGCNVAVHQACYGIVQVP----------TGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVEFANVATMEPIVLQSVPHERYN-KTCYICEEQGRESKAATGACMACNKHGCRQAFHVTCAQFAGLLCEEQGSDADNVKYCGYCKYHYSK---LRRSKGRGSRAQSLSDSSSHSLDKHHDKEKKKHKERDRHKPKHKKSMELS-TPLVPPLMVSA 254          
BLAST of PHD finger protein 14 vs. Ensembl Cavefish
Match: mllt10 (MLLT10 histone lysine methyltransferase DOT1L cofactor [Source:NCBI gene;Acc:103024061])

HSP 1 Score: 130.568 bits (327), Expect = 1.293e-29
Identity = 82/257 (31.91%), Postives = 120/257 (46.69%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSN--VSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC---ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNNNHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVAC 6267
            E +  C +C  +  +++N LV CDG  C + VH+ CY I              T PWFC  C S    +  RCELCP ++G  KRT+N  W H++CALY P V F +  T+  I L  +P + ++ + C +C        A TG C++C+   C+  FHV CAQ  GLL E    +  +  Y   C+ H  K    RR K   +             + +H  + +  ++R      H K +EL  TP VP   V+ 
Sbjct:   13 EMIGGCCVCSDERGWAENPLVYCDGHGCNVAVHQACYGIVQVP----------TGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVEFANVATMEPIVLQSVPHERYN-KTCYICEEQGRESKAATGACMACNKHGCRQAFHVTCAQFAGLLCEEQGSDADNVKYCGYCKYHYSK---LRRSKGRGSRAQSLSDSSSHSLDKHHDKEKKKHKERDRHKPKHKKSMELS-TPLVPPLMVSA 254          
BLAST of PHD finger protein 14 vs. Ensembl Sea Lamprey
Match: phf14 (PHD finger protein 14 [Source:ZFIN;Acc:ZDB-GENE-030131-1796])

HSP 1 Score: 310.071 bits (793), Expect = 1.173e-88
Identity = 173/484 (35.74%), Postives = 266/484 (54.96%), Query Frame = 1
Query: 5512 KFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXX-XXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNA--AVNRQKLRLEEWHNNNHYND--SRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVLNSQT----SNDLKTISSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEK-EFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLC 6933
            K + V+IC +CL ++S   NE+V+CD CG+ VHE CY +          +SD+ST PWFCD C + V  P CELCP  +G+FK T+  RWVH++CALY  GVAF D E L  +TL+E+    + A+EC LC    F+RTG+CI+CDAG+C++ FHV+CAQ+EGLLSE   EE   DP+FA+C+QH D+   K +RKN+ A  + +RQ   + E     H  D  +R+  K Q + +         P+P+VP+ K+A  L ++  AV     KA    +  D++ + T    + D +      P    DF+TY+L+R  ++ +    I      + ELQ  E+     +   +   ++ +    KL  E   L +  + Q+   +    ++  +L +             +S +  + +E S +  +     +++ C +C+  SDQH+L  CD C ++ H+GCLDPPLTRMPR++K   WQCS C
Sbjct:  275 KMQEVLICSVCLGENSEDSNEIVQCDNCGVTVHEACYGVDGESESVISSTSDNSTEPWFCDPCKAGVV-PSCELCPAIDGIFKETDAGRWVHVVCALYVSGVAFEDVERLRPVTLTEMSYSKYGAKECMLCEERLFSRTGVCINCDAGMCRSFFHVMCAQREGLLSEAAAEEEIADPFFAHCKQHADRMDRKWKRKNYLALQSFSRQ---IREEKGKAHPGDMQARIDAKLQLYRARFELAKGTRPSPWVPREKLARPLTSSASAVRALLLKAQLAGVSTDIMPADTTEPGTGDGRRKQIRHPTLTADFVTYYLERNMQMMQIQENICDQRKLKNELQKQEKALRSSYGGLMETLDTLKSLNNKLQREGHTL-WSTLGQITGQKLTQPLVLRVLRE------------QKSSLMKSGQEASVSLPQ-----ILHSCGICQESSDQHLLTQCDTCQRYYHLGCLDPPLTRMPRRSKNSYWQCSEC 736          
BLAST of PHD finger protein 14 vs. Ensembl Sea Lamprey
Match: mllt10 (MLLT10 histone lysine methyltransferase DOT1L cofactor [Source:ZFIN;Acc:ZDB-GENE-041114-176])

HSP 1 Score: 130.954 bits (328), Expect = 1.923e-30
Identity = 86/269 (31.97%), Postives = 123/269 (45.72%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSN--VSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC---ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNNNHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVAC-FLETNPIAVFL 6300
            E V  C +C  +  +++N LV CDG  C + VH+ CY I              T PWFC  C S    +  RCELCP ++G  KRT+N  W H++CALY P V F +  T+  I L  +P  D   + C LC        A TG C++C+   C+  FHV CAQ  GLL E       +  Y   C+ H  K  +++ R    +A +           + H  D +  R+++     H +  E  P+P +P   V      T+P   FL
Sbjct:    4 EMVGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVHVP----------TGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVSTMEPIVLQYVP-HDRYNKTCYLCEEQGRESKAATGACMTCNKHGCRQAFHVTCAQMAGLLCEEEGVGADNVKYCGYCKYHYSK--MQKGRPAGRSAFDAGLGEAPSHSQDKHERDKKKNREKE-KQKRHKRVGE--PSPLLPSLTVTTEKTYTSPSGAFL 256          
BLAST of PHD finger protein 14 vs. Ensembl Sea Lamprey
Match: KDM4C (lysine demethylase 4C [Source:HGNC Symbol;Acc:HGNC:17071])

HSP 1 Score: 91.6633 bits (226), Expect = 1.355e-18
Identity = 56/205 (27.32%), Postives = 83/205 (40.49%), Query Frame = 1
Query: 5575 LVECDGCGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPY--FANCRQH-TDKETVKRRRKNWNAAVNRQKLRLEEWHNNNHYNDSRLI 6180
            L+ C  C + VH  CY +                 W C  C +      C LC +  G  ++T +NRWVH++CA+      F +      + +S +P   W  + C  C        G C+ C  G C   FHV CA   G+L EP+     D PY  +  C +H T  +  K R    +  V +  +     H N+ Y  S +I
Sbjct:  474 LISCAKCCLQVHASCYGVGAQSLSDG---------WKCSRCAAEAWTVDCCLCNLRGGALQQTTDNRWVHVMCAVAVTEARFVNVMERRPVDISRIPPPRWKLK-CIFCRKQHRKVQGACVQCSYGRCPTPFHVTCAHAAGVLMEPD-----DWPYAVYITCSRHKTGAQGTKSRNALQDVTVGQTVISK---HKNSRYYHSNVI 660          
BLAST of PHD finger protein 14 vs. Ensembl Sea Lamprey
Match: KDM4C (lysine demethylase 4C [Source:HGNC Symbol;Acc:HGNC:17071])

HSP 1 Score: 78.5666 bits (192), Expect = 2.163e-15
Identity = 48/168 (28.57%), Postives = 72/168 (42.86%), Query Frame = 1
Query: 5686 CDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPY--FANCRQH-TDKETVKRRRKNWNAAVNRQKLRLEEWHNNNHYNDSRLI 6180
            C  C +      C LC +  G  ++T +NRWVH++CA+      F +      + +S +P   W  + C  C        G C+ C  G C   FHV CA   G+L EP+     D PY  +  C +H T  +  K R    +  V +  +     H N+ Y  S +I
Sbjct:    2 CSRCAAEAWTVDCCLCNLRGGALQQTTDNRWVHVMCAVAVTEARFVNVMERRPVDISRIPPPRWKLK-CIFCRKQHRKVQGACVQCSYGRCPTPFHVTCAHAAGVLMEPD-----DWPYAVYITCSRHKTGAQGTKSRNALQDVTVGQTVISK---HKNSRYYHSNVI 160          
BLAST of PHD finger protein 14 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008687.1 (pep scaffold:Pmarinus_7.0:GL495059:436:1819:-1 gene:ENSPMAG00000007864.1 transcript:ENSPMAT00000008687.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 7.117e-14
Identity = 35/102 (34.31%), Postives = 51/102 (50.00%), Query Frame = 1
Query: 5512 KFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTE-NNRWVHLLCALYTPGV 5814
            +F+  ++C +C    +   NE+V CD C + VH+ CY I+     S          W C  C   V+ PRC+LCP  +G  K T    +W H+ CAL+ P V
Sbjct:   57 EFDADVVCDVCRSPHAEDGNEMVFCDKCDVCVHQACYGIACVPAGS----------WLCRVCDRGVAAPRCQLCPRRDGAMKPTRGGGKWAHVSCALWIPEV 148          
BLAST of PHD finger protein 14 vs. Ensembl Yeast
Match: NTO1 (Subunit of the NuA3 histone acetyltransferase complex; this complex acetylates histone H3; contains PHD finger domain that interacts with methylated histone H3 [Source:SGD;Acc:S000006235])

HSP 1 Score: 92.4337 bits (228), Expect = 4.526e-19
Identity = 50/158 (31.65%), Postives = 75/158 (47.47%), Query Frame = 1
Query: 5533 CMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSNVSN-PRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEI-TLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGL 6000
            C +CL   S + N +V CDGC I VH++CY I                 W C  C+ + +N   C +CP   G FK+T+   WVH +CAL+ P + F++   +  I  +  + +  W    C +C      + G CI C    C   +HV CA++ GL
Sbjct:  266 CAVCLGTDSDNLNTIVFCDGCDIAVHQECYGIIFIPEGK----------WLCRRCMISKNNFATCLMCPSHTGAFKQTDTGSWVHNICALWLPELYFSNLHYMEPIEGVQNVSVSRWKLN-CYICKK----KMGACIQCFQRNCFTAYHVTCARRAGL 408          
BLAST of PHD finger protein 14 vs. Ensembl Yeast
Match: SNT2 (Subunit of Snt2C complex, RING finger ubiquitin ligase (E3); physically associates with Ecm5p and Rpd3p; along with Ecm5p, recruits Rpd3p to small number of promoters; colocalizes with Ecm5p, independently of Rpd3p, to promoters of stress response genes upon oxidative stress; involved in ubiquitination, degradation of excess histones; interacts with Ubc4p; role in regulating genes encoding amine transporters; relocalizes from nucleus to cytoplasm upon DNA replication stress [Source:SGD;Acc:S000003099])

HSP 1 Score: 66.2402 bits (160), Expect = 7.457e-11
Identity = 45/174 (25.86%), Postives = 74/174 (42.53%), Query Frame = 1
Query: 5530 ICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSNVSNP------RCELCPVEEGVFKR---------------TENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQ 5988
             C +C    + +DN  V C  CG+ VH  CY I         +++  T+ W CD C SN  NP      +C +CP ++  + R               T    WVHL+C+L+   + + + +++     +   L   S   CG+C        G  + C+   C+  +H+ CAQ
Sbjct: 1040 FCSVCKEKFNDNDNYEVVCGNCGLTVHYFCYAI-KLPKDMKKNTNLKTFKWLCDPC-SNDLNPIISTTYQCSMCPTKDYDYDRYRSQSFKICPDALKCTSLGTWVHLVCSLFNEDIKYGNGQSMQPALNTTAVLIKHSRFTCGVCR----INGGGLVKCNK--CQYRYHITCAQ 1205          
BLAST of PHD finger protein 14 vs. Ensembl Yeast
Match: JHD2 (JmjC domain family histone demethylase; promotes global demethylation of H3K4 and repression of noncoding intergenic transcription during sporulation; removes methyl groups added by Set1p methyltransferase; negatively regulated by H3K14 acetylation; protein levels regulated by Not4p polyubiquitin-mediated degradation; regulates sporulation timing by extending period of active transcription in opposition to programmed global transcriptional quiescence; regulates rDNA silencing [Source:SGD;Acc:S000003880])

HSP 1 Score: 49.2914 bits (116), Expect = 8.799e-6
Identity = 48/195 (24.62%), Postives = 81/195 (41.54%), Query Frame = 1
Query: 6415 TYFLDREKKIDETSREIVQL-ENFRRELQ---ISEQNTSHQFNKTVAKKESAEKEFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCAT-----TDDEHAKNL 6972
             YF D   ++ + +R +    ++FRR+L+   IS+        +T++KK +      +GL +   +  I    +    L E ++  L   Q P      +  +    G D  + +   +   D+    C +C+  +D    I CD+C K  HI CL PPL R+P       W C+ C         T D H  +L
Sbjct:  119 VYFYDVFSELIKDNRTLTDTTQSFRRKLKFRDISQLRGDISLWRTISKKFNV----PIGLLKEIFEKYIASYYIFLHSLNENVHTALHADQYP-KSLLSDDEDDFDLGPDSNSGSDFEEDDDDA----CIVCRKTNDPKRTILCDSCDKPFHIYCLSPPLERVPSG----DWICNTCIVGNGYYGFTQDTHDYSL 300          
BLAST of PHD finger protein 14 vs. Ensembl Nematostella
Match: EDO43778 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXH9])

HSP 1 Score: 120.553 bits (301), Expect = 1.114e-30
Identity = 68/192 (35.42%), Postives = 100/192 (52.08%), Query Frame = 1
Query: 5533 CMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSN--VSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFF-ART--GICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDD-PYFANCRQHTDKETVK 6084
            C +C  +  + +N LV CDG  C + VH+ CY I                PWFC  C S   ++  +CELCP + G  KRT+N  W H++CALY P V F +  T+  I L+ +P + +  + C +C      +RT  G C++C+   CK  FHV CAQ  GLL E N+ ++     Y   C+ H +K+ +K
Sbjct:    9 CCVCSDERGWDENPLVYCDGHGCNVAVHQACYGIVQVPKG----------PWFCRKCESQERIARVKCELCPSKVGALKRTDNGGWAHVVCALYIPEVRFGNVSTMEPILLASVPHERY-LKTCYICEERGKESRTAHGGCMNCNKLGCKQTFHVTCAQSCGLLCEENDGQSGPTVKYVGYCQFHWNKKVLK 189          
BLAST of PHD finger protein 14 vs. Ensembl Nematostella
Match: EDO40569 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Q6])

HSP 1 Score: 100.138 bits (248), Expect = 5.928e-21
Identity = 97/398 (24.37%), Postives = 162/398 (40.70%), Query Frame = 1
Query: 5461 ETILDNLNDYRTIANKTK------FENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSNVSNP-RCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEI-TLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLS--EPNNEENSDDPYFAN--CRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNNNHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQD--VLNSQTSNDLKTISSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEKEFKLGLEQVALKFDII 6612
            ET++D L       ++T        +   +C +C      + N ++ CD C + VH++CY +                 W C  CL + S    C LCP + G FK+T++ RW H+ CAL+ P V F +T  L  I ++  +P   W    C +C      R G CI C    C   FHV CAQ+ GL    EP   EN       N  C  H+   + +   +  +     ++++ +        N   + + R+  S   +  + +V  PF+P  ++   +    +A     KKA  +   Q   +L  Q+ N       G+P+      T+ L ++   DE+S    ++   + +L    Q   H   +     E   K  KL  E V +K  ++
Sbjct:  230 ETLMDRLEKESYFESQTTCDPNQYIDEDAVCCICNDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQ----------WLCRRCLQSPSRVVDCVLCPNKTGAFKQTDDGRWGHVSCALWIPEVCFANTVFLEPIDSIDNIPSARWKL-TCYICKR----RQGACIQCFKTNCYTAFHVTCAQQAGLYMKIEPVKGENGHITVRKNAFCDIHSPNSSEENEGEERSEEEKTKEVKSKAAVKTGKTNKRSIKKFRKLLSEKKTMPVPVVNIPFIPAHRLGKIVSRVAMA-----KKAQFVHALQSYWMLKRQSRN-------GVPLLRRLQATH-LSQKGTGDESSERSERIRAMKEQLHFW-QRLRHDLERARLLVELIRKREKLKREHVKVKQHVV 598          
BLAST of PHD finger protein 14 vs. Ensembl Nematostella
Match: EDO49715 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFG5])

HSP 1 Score: 93.5893 bits (231), Expect = 1.863e-19
Identity = 52/164 (31.71%), Postives = 75/164 (45.73%), Query Frame = 1
Query: 5515 FENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNR-WVHLLCALYTPGVAFNDTETLSEIT-LSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGL 6000
            ++  + C +C    S   NE+V CD C I VH+ CY I      S          W C  C   V+ P C+LC    G  K+ +  + ++H+ CAL+ P V F + E +  I  + ++P   W+   C LC      + G CI C    C   FHV C  +EGL
Sbjct:  133 YDESVCCDVCQSPESEEGNEMVFCDSCDICVHQACYGIQSIPSGS----------WLCQPCRWGVAKPPCKLCSACGGAMKKAKGGKTYIHVSCALWVPEVGFGNVERMEPIIKVEKIPTSRWNL-VCYLCKE----KVGACIQCSVKSCVTAFHVTCGFQEGL 281          
BLAST of PHD finger protein 14 vs. Ensembl Nematostella
Match: EDO43792 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXL0])

HSP 1 Score: 72.7886 bits (177), Expect = 7.164e-14
Identity = 27/49 (55.10%), Postives = 35/49 (71.43%), Query Frame = 1
Query: 6787 CYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLC 6933
            C  CKS  +QH++ +CD CH F H+ C+DPPL+RMPRK+    WQCS C
Sbjct:    5 CATCKSTDNQHLMAECDTCHNFYHLACVDPPLSRMPRKSAKCLWQCSEC 53          

HSP 2 Score: 52.373 bits (124), Expect = 5.973e-7
Identity = 26/65 (40.00%), Postives = 34/65 (52.31%), Query Frame = 1
Query: 6784 ECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLDV 6978
            +C  C S  D   L+ CDNC    H GCLDPP+   P+K + Y W C+ C      DE  +N+ V
Sbjct:  154 QCSQCDSPGDNTTLVRCDNCKLCYHFGCLDPPVKSNPKK-RGYMWYCTEC------DESVRNVIV 211          
BLAST of PHD finger protein 14 vs. Ensembl Nematostella
Match: EDO31764 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX13])

HSP 1 Score: 51.9878 bits (123), Expect = 3.739e-8
Identity = 20/49 (40.82%), Postives = 29/49 (59.18%), Query Frame = 1
Query: 6787 CYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLC 6933
            C++C +   Q+ L+ CDNC +  H+ CLDP LT+ P+      W C LC
Sbjct:   34 CHLCDTGEVQNELLLCDNCDRGYHMSCLDPKLTKAPKG----AWHCVLC 78          
BLAST of PHD finger protein 14 vs. Ensembl Medaka
Match: phf14 (PHD finger protein 14 [Source:NCBI gene;Acc:101171846])

HSP 1 Score: 312.768 bits (800), Expect = 5.122e-89
Identity = 168/486 (34.57%), Postives = 274/486 (56.38%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVLNSQTSNDLKTISS----GIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEKEFKLGLEQVALKFDIIKQL-VKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDD 6954
            ++++IC +CL D+S   +E+++CD CG+ VHE CY +          +S++ST PWFCDAC + V+ P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC  C +  FARTG+CISCDAG+C++ FHV CAQ+EGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L+E          +R+  + Q + +         P  +VP+ K+   L ++  A+    +KA  + +  D+    TS+   ++        P    DF+ Y+L+R  ++ +    I + +N + +L+  ++    ++NK          E+   LE++    ++  +L  + + L  ++  +L + ++ T        E   S   KE  +    +   +++  C +CK   DQH+L+ CD C  + H+GCL+PPLTRMP+KTK   WQCS C  A++D+
Sbjct:  290 QHILICCVCLGDNSEDADEIIQCDNCGVTVHEGCYGVDGESDSIMSSASENSTEPWFCDACKNGVT-PSCELCPNQDGIFKETDAGRWVHVVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSFCEDARFARTGVCISCDAGMCRSYFHVTCAQREGLLSEAAAEEDIADPFFAYCKQHADRFDRKWKRKNYLALQSYCKVSLQEREKQLTPEAQARITTRLQQYRAKAELSRNTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDTSDTNASMDGRRKHKQPALTADFVNYYLERNMRMIQIQDNISEQKNLKDKLESEQEKLHVEYNKLC--------EY---LEEL---LNVNGELRSEGQALWTLLGGILGQ-KLNTPAILKAPKERKPS--KKEGGSPGKSSSLPAILYSCGICKKNQDQHLLVLCDTCKLYYHLGCLEPPLTRMPKKTKNSYWQCSECDQASSDE 757          
BLAST of PHD finger protein 14 vs. Ensembl Medaka
Match: phf14 (PHD finger protein 14 [Source:NCBI gene;Acc:101171846])

HSP 1 Score: 311.227 bits (796), Expect = 4.344e-88
Identity = 168/486 (34.57%), Postives = 274/486 (56.38%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXX-XXXXXXXXTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKNWNAAVNRQKLRLEEWHNN-NHYNDSRLIRKRQFFSSMHSKFLELVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVLNSQTSNDLKTISS----GIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQFNKTVAKKESAEKEFKLGLEQVALKFDIIKQL-VKHRELMEVINNLLAKFQIPTNGSTGNGNESLVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDD 6954
            ++++IC +CL D+S   +E+++CD CG+ VHE CY +          +S++ST PWFCDAC + V+ P CELCP ++G+FK T+  RWVH++CALY PGVAF D + L  +TL+E+    + A+EC  C +  FARTG+CISCDAG+C++ FHV CAQ+EGLLSE   EE+  DP+FA C+QH D+   K +RKN+ A  +  K+ L+E          +R+  + Q + +         P  +VP+ K+   L ++  A+    +KA  + +  D+    TS+   ++        P    DF+ Y+L+R  ++ +    I + +N + +L+  ++    ++NK          E+   LE++    ++  +L  + + L  ++  +L + ++ T        E   S   KE  +    +   +++  C +CK   DQH+L+ CD C  + H+GCL+PPLTRMP+KTK   WQCS C  A++D+
Sbjct:  290 QHILICCVCLGDNSEDADEIIQCDNCGVTVHEGCYGVDGESDSIMSSASENSTEPWFCDACKNGVT-PSCELCPNQDGIFKETDAGRWVHVVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKECSFCEDARFARTGVCISCDAGMCRSYFHVTCAQREGLLSEAAAEEDIADPFFAYCKQHADRFDRKWKRKNYLALQSYCKVSLQEREKQLTPEAQARITTRLQQYRAKAELSRNTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDTSDTNASMDGRRKHKQPALTADFVNYYLERNMRMIQIQDNISEQKNLKDKLESEQEKLHVEYNKLC--------EY---LEEL---LNVNGELRSEGQALWTLLGGILGQ-KLNTPAILKAPKERKPS--KKEGGSPGKSSSLPAILYSCGICKKNQDQHLLVLCDTCKLYYHLGCLEPPLTRMPKKTKNSYWQCSECDQASSDE 757          

HSP 2 Score: 63.929 bits (154), Expect = 2.218e-9
Identity = 31/80 (38.75%), Postives = 39/80 (48.75%), Query Frame = 1
Query: 6709 ESLVSGADKETSATNTKTKPDSVINECYMCKSVSDQHMLIDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATT 6948
            ESL     +  S    K K D    EC  CK   D   L+ CD C    H GCLDPPL + P++T  YGW C  C  +++
Sbjct:  821 ESLPRERRQRQSVVQKKPKADDTRTECATCKGPGDNENLVRCDECQLCYHFGCLDPPLKKSPKQTG-YGWICQECDTSSS 899          
BLAST of PHD finger protein 14 vs. Ensembl Medaka
Match: mllt10 (MLLT10 histone lysine methyltransferase DOT1L cofactor [Source:NCBI gene;Acc:101165015])

HSP 1 Score: 129.028 bits (323), Expect = 3.491e-29
Identity = 70/201 (34.83%), Postives = 101/201 (50.25%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSN--VSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC---ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKETVKRRRKN 6099
            E +  C +C  +  +++N LV CDG  C + VH+ CY I              T PWFC  C S    +  RCELCP ++G  KRT+N  W H++CALY P V F +  T+  I L  +P + ++ + C +C        A TG C++C+   C+  FHV CAQ  GLL E    +  +  Y   C+ H  K   K R ++
Sbjct:   21 EMIGGCCVCSDERGWAENPLVYCDGHGCNVAVHQACYGIVQVP----------TGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVEFANVSTMEPIVLQSVPHERYN-KTCYICEEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEQGNDADNVKYCGYCKYHHSKLKHKERDRH 210          
BLAST of PHD finger protein 14 vs. Ensembl Medaka
Match: mllt10 (MLLT10 histone lysine methyltransferase DOT1L cofactor [Source:NCBI gene;Acc:101165015])

HSP 1 Score: 127.872 bits (320), Expect = 7.612e-29
Identity = 68/192 (35.42%), Postives = 97/192 (50.52%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSN--VSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC---ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDK 6072
            E +  C +C  +  +++N LV CDG  C + VH+ CY I              T PWFC  C S    +  RCELCP ++G  KRT+N  W H++CALY P V F +  T+  I L  +P + ++ + C +C        A TG C++C+   C+  FHV CAQ  GLL E    +  +  Y   C+ H  K
Sbjct:   21 EMIGGCCVCSDERGWAENPLVYCDGHGCNVAVHQACYGIVQVP----------TGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVEFANVSTMEPIVLQSVPHERYN-KTCYICEEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEQGNDADNVKYCGYCKYHHSK 201          
BLAST of PHD finger protein 14 vs. Ensembl Medaka
Match: mllt10 (MLLT10 histone lysine methyltransferase DOT1L cofactor [Source:NCBI gene;Acc:101165015])

HSP 1 Score: 127.872 bits (320), Expect = 7.612e-29
Identity = 68/192 (35.42%), Postives = 97/192 (50.52%), Query Frame = 1
Query: 5518 ENVMICMMCLLDSSFSDNELVECDG--CGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSN--VSNPRCELCPVEEGVFKRTENNRWVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLC---ANPFFARTGICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDK 6072
            E +  C +C  +  +++N LV CDG  C + VH+ CY I              T PWFC  C S    +  RCELCP ++G  KRT+N  W H++CALY P V F +  T+  I L  +P + ++ + C +C        A TG C++C+   C+  FHV CAQ  GLL E    +  +  Y   C+ H  K
Sbjct:   21 EMIGGCCVCSDERGWAENPLVYCDGHGCNVAVHQACYGIVQVP----------TGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVEFANVSTMEPIVLQSVPHERYN-KTCYICEEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEQGNDADNVKYCGYCKYHHSK 201          
BLAST of PHD finger protein 14 vs. Planmine SMEST
Match: SMESG000070587.1 (SMESG000070587.1)

HSP 1 Score: 3158.62 bits (8188), Expect = 0.000e+0
Identity = 1634/1651 (98.97%), Postives = 1639/1651 (99.27%), Query Frame = 1
Query:   76 MSDNFFQNTFSNKPKTSDEKQANNPTEDLENPDDGRDNVIQHLIYHSFYPSTCMVPLEENLIIINETVPDLMKAKEHDPLIQETIKTFHLLVQEKDDEILNLRRQLNISEGLSNLVEFHSETIQTDLTLDDCSQMENQILVLSTDLPEKNEKIHQLQQELEKIKGNKLTSTDSKTTDLEEAYKGLTELELKNSELAEQNKILQYKLDDVNELKYEIEVAKIQAENDKQNLEEVLIEKDIEIEKCKLELSSIIQSDFCVETKSGNQPEAMPKEFNDPRENIDIVIEELKNKLFNSKLDSSLLPLISRTTSNDGRFRNLNDKEILSELIRICCDGKSTEIELKEILPIVKSISFQENGNPDIAQIETNIPQFQTACNKLNKEQLMRDAVNNGISLKMRTSLILMEISDLKKEYXXXXXXXXXXXXSFKLTQLGMLNRMSKKELIDGILEKRSTIFEISLHSFWGVISNSQFKESDACRSLKLTSADVSTISNTLFHNYKEDSEFSLFTSMLINIRSILLYGELPKGKKEKSIFYLEKLCSVNLIHDITNHILPKYPREIRGKLLESTVETTISDSYKFYEIISQEFLILAFNSKRPFESTDQIGTLNLSWSILNIFSMLNFEDDLFLLSVVIQKNEFPGQLLSLSNTTKKVEKTVIKFSLQKNKLEKLINTIVRIQVFLNNENEQSLMKSYNLKSXXXXXXXXXXXXXXXXXXXXXDTFQPVLDKIIVPRGSKYVSCVSKDKTNLDFWIKMVLDRYNKDQIKDLQSLSEEELRICFKRLLKCMELVSPNILLSFKEKSSMKNDVIKLIFTLRLALIEKLRGNLFGDRFRLKDINFGXXXXXXXXXXXXXXLVRYLNSSSLNSEVPDLDEIVKTLYEIDCEIFPGIIIQNLTTKDLTKYKSYELSDEIVILRLAIAGSMICSTQSWNDLKEIVESNVDRWGVLKRIENTLINSELISIDNDMIDWERNFLKKIIFICRGSTIINEDKLRDAYIEVRKIACRNNGEIFDMNENLKSFGKISNKQGKVKVLCDEVDSILKGYKRKFQNTEEMEKSVENYKKLELVLEDMELNFVEKNTNLRETWIYLFYDKVSDIERVLNKDTKDINELKTENLRNVIIKYLGHIKQWVSDSRNLQADLFSRLNSSIRKLNNSSPLKERKIKMSSVDLDLNSSNFDDEKRAFEKSFFELEERIKEIGNKSENKDKYSKLIETKIMDKNQEELKYLIVSLGNELSGNQNNEFELKETKLSLNEKSKEQLEDECRALTHKVLMKKLDEFLNDKSANNLSRQKLKDDHLLQFEDDINLKLTRYQDLCDSVDKLKIPQTYSKGRNSPLISQNEMMFSAPITQESNINQNFHQSHSSRQTNEEEDDIVDSYFYKRLNEIQNSIKSSDKTNTNLKVQMLPYKNNTESNVLVDGFDIEDEKTSRFYSMKLQDIQHERKEDELTTILIQMEKDRQEILDKNKNLQQQIFFCENIIETQQIKLEAMEKTDSTDKQKVKEYERDEKQDYDSKYKFEDMRLQKHEIKRLKATTIAAQNQLDRQNSNIITLSTMADNLQHENSNLLIKNKYLERSFQKLEEIFNDLVRQLESVKHNFPNNRNDIVYQSMKESIKDPELERRLRQSESDKIDLVRKMDIIEQQNELLKVHCEKLDIELT 5028
            MSD FFQNTFSNKPKTSDEKQANNPTEDLENPDDGRDNVIQHLIYHSFYPSTCMVPLEENLIIINETVPDLMKAKEHDPLIQETIKTFHLLVQEKDDEILNLRRQLNISEGLSNLVEFHSETIQTDLTLDDCSQMENQILVLSTDLPEKNEKIHQLQQELEKIKGNKLTSTDSKTTDLEEAYKGLTELELKNSELAEQNKILQYKLDDVNELKYEIEVAKIQAENDKQNLEEVLIEKDIEIEKCKLELSSIIQSDFCVETKSGNQPEAMPKEFNDPRENIDI IEELKNKLFNSKLDSSLLPLISRTTSNDGRFRNLNDKEILSELIRICCDGKSTEIELKEILPIVKSISFQENGNPDI QIETNIPQFQTACNKLNKEQLMRDAVNNGISLKMRTSLILMEISDLKKEY+KLENILNILNKSFKLTQLGMLNRMSKKELIDGILEKRSTIFEISLHSFWGVISNSQFKESDACRSLKLTSADVSTISNTLFHNYKEDSEFSLFTSMLIN+RSILLYGELPK KKEKSIFYLEKLCSVNLIHDITNHILPKYPREIRGKLLESTVETTISDSYKFYEIISQEFLILAFNSKRPFESTDQIGTLNLSWSILNIFSMLNFEDDLFLLSVVIQKNEFPGQLLSLSNTTKKVEKTVIKFSLQKNKLEKLINTIVRIQVFLNNENEQSLMKSYNLKSENELIKVLIKKKEEMIKILFKDTFQPVLDKIIVPRGSKYVSCVSKDKTNLDFWIKMVLDRYNKDQIKDLQSLSEEELRICFKRLLKCMELVSPNILLSFKEKSS KNDVIKLIFTLRLALIEKLRGNLFGDRFRLKDINFGESSYEINSEEEYESLVRYLNSSSLNSEVPDLDEIVKTLYEIDCEIFPGIIIQNLTTKDLTKYKSYELSDEIVILRLAIAGSMICSTQSWNDLKEIVESNVDRWGVLKRIENTLINSELISIDNDMIDWERNFLKKIIFICRGSTIINEDKLRDAYIEVRKIACRNNGEIFDMNENLKSF KISNKQGKVKVLCDEVDSILKGYKRKFQNTEEMEKSVENYKKLELVLEDMELNFVEKNTN RETWIYLFYDKVSDIERVLNKDTKD NELKTENLRNVIIKYLGHIKQWVSDSRNLQADLFSRLNSSIRKLNNSSPLKERKIKMSSVDLDLNSSNFDDEKRAFEKSFFELEERIKEIGNKSENKDKYSKLIETKIMDKNQEELKYLIVSLGNELSGNQNNEFELKETKLSLNEKSKEQLEDECRALTHKVLMKKLDEFLNDKSANNLSRQKLKDDHLLQFEDDINLKLTRYQDLCDSVDKLKIPQTYSKGRNSPLISQNEMMFSAPITQESNINQNFHQSHSSRQTNEEEDDIVDSYFYKRLNEIQNSIKSSDKTNTNLKVQMLPYKNNTESNVLVDGFDIEDEKTSRFYSMKLQDIQHERKEDELTTILIQMEKDRQEILDKNKNLQQQIF+CENIIETQQIKLE MEKTDS DKQKVKEYERDEKQDYDSKYKFEDMRLQKHEIKRLKATTIAAQNQLDRQNSNII LSTMADNLQHEN+NLLIKNKYLERSFQKLEEIFNDLVRQLESVKHNFPNNRNDIVYQSMKESIKDPELERRLRQSESDKIDLVRKMDIIEQQNELLKVHCEKLDIE +
Sbjct:    1 MSDKFFQNTFSNKPKTSDEKQANNPTEDLENPDDGRDNVIQHLIYHSFYPSTCMVPLEENLIIINETVPDLMKAKEHDPLIQETIKTFHLLVQEKDDEILNLRRQLNISEGLSNLVEFHSETIQTDLTLDDCSQMENQILVLSTDLPEKNEKIHQLQQELEKIKGNKLTSTDSKTTDLEEAYKGLTELELKNSELAEQNKILQYKLDDVNELKYEIEVAKIQAENDKQNLEEVLIEKDIEIEKCKLELSSIIQSDFCVETKSGNQPEAMPKEFNDPRENIDITIEELKNKLFNSKLDSSLLPLISRTTSNDGRFRNLNDKEILSELIRICCDGKSTEIELKEILPIVKSISFQENGNPDIGQIETNIPQFQTACNKLNKEQLMRDAVNNGISLKMRTSLILMEISDLKKEYMKLENILNILNKSFKLTQLGMLNRMSKKELIDGILEKRSTIFEISLHSFWGVISNSQFKESDACRSLKLTSADVSTISNTLFHNYKEDSEFSLFTSMLINVRSILLYGELPKVKKEKSIFYLEKLCSVNLIHDITNHILPKYPREIRGKLLESTVETTISDSYKFYEIISQEFLILAFNSKRPFESTDQIGTLNLSWSILNIFSMLNFEDDLFLLSVVIQKNEFPGQLLSLSNTTKKVEKTVIKFSLQKNKLEKLINTIVRIQVFLNNENEQSLMKSYNLKSENELIKVLIKKKEEMIKILFKDTFQPVLDKIIVPRGSKYVSCVSKDKTNLDFWIKMVLDRYNKDQIKDLQSLSEEELRICFKRLLKCMELVSPNILLSFKEKSSTKNDVIKLIFTLRLALIEKLRGNLFGDRFRLKDINFGESSYEINSEEEYESLVRYLNSSSLNSEVPDLDEIVKTLYEIDCEIFPGIIIQNLTTKDLTKYKSYELSDEIVILRLAIAGSMICSTQSWNDLKEIVESNVDRWGVLKRIENTLINSELISIDNDMIDWERNFLKKIIFICRGSTIINEDKLRDAYIEVRKIACRNNGEIFDMNENLKSFSKISNKQGKVKVLCDEVDSILKGYKRKFQNTEEMEKSVENYKKLELVLEDMELNFVEKNTNFRETWIYLFYDKVSDIERVLNKDTKDFNELKTENLRNVIIKYLGHIKQWVSDSRNLQADLFSRLNSSIRKLNNSSPLKERKIKMSSVDLDLNSSNFDDEKRAFEKSFFELEERIKEIGNKSENKDKYSKLIETKIMDKNQEELKYLIVSLGNELSGNQNNEFELKETKLSLNEKSKEQLEDECRALTHKVLMKKLDEFLNDKSANNLSRQKLKDDHLLQFEDDINLKLTRYQDLCDSVDKLKIPQTYSKGRNSPLISQNEMMFSAPITQESNINQNFHQSHSSRQTNEEEDDIVDSYFYKRLNEIQNSIKSSDKTNTNLKVQMLPYKNNTESNVLVDGFDIEDEKTSRFYSMKLQDIQHERKEDELTTILIQMEKDRQEILDKNKNLQQQIFYCENIIETQQIKLEGMEKTDSADKQKVKEYERDEKQDYDSKYKFEDMRLQKHEIKRLKATTIAAQNQLDRQNSNIIALSTMADNLQHENNNLLIKNKYLERSFQKLEEIFNDLVRQLESVKHNFPNNRNDIVYQSMKESIKDPELERRLRQSESDKIDLVRKMDIIEQQNELLKVHCEKLDIEAS 1651          
BLAST of PHD finger protein 14 vs. Planmine SMEST
Match: SMESG000049566.1 (SMESG000049566.1)

HSP 1 Score: 165.622 bits (418), Expect = 3.892e-46
Identity = 92/95 (96.84%), Postives = 93/95 (97.89%), Query Frame = 1
Query: 5434 EENTKKRESETILDNLNDYRTIANKTKFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSNVSNP 5718
            EENTKKRESETILDNLNDYRTIANKTKFENVMICMMCLLD SFSDNELVECDGCG VVHEDCYKISDSVF+SDDSSDSSTYPWFCDACLSNVSNP
Sbjct:   81 EENTKKRESETILDNLNDYRTIANKTKFENVMICMMCLLDPSFSDNELVECDGCGTVVHEDCYKISDSVFLSDDSSDSSTYPWFCDACLSNVSNP 175          
BLAST of PHD finger protein 14 vs. Planmine SMEST
Match: SMESG000049566.1 (SMESG000049566.1)

HSP 1 Score: 166.392 bits (420), Expect = 4.926e-46
Identity = 92/95 (96.84%), Postives = 93/95 (97.89%), Query Frame = 1
Query: 5434 EENTKKRESETILDNLNDYRTIANKTKFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSNVSNP 5718
            EENTKKRESETILDNLNDYRTIANKTKFENVMICMMCLLD SFSDNELVECDGCG VVHEDCYKISDSVF+SDDSSDSSTYPWFCDACLSNVSNP
Sbjct:  108 EENTKKRESETILDNLNDYRTIANKTKFENVMICMMCLLDPSFSDNELVECDGCGTVVHEDCYKISDSVFLSDDSSDSSTYPWFCDACLSNVSNP 202          
BLAST of PHD finger protein 14 vs. Planmine SMEST
Match: SMESG000049670.1 (SMESG000049670.1)

HSP 1 Score: 160.614 bits (405), Expect = 1.239e-44
Identity = 91/96 (94.79%), Postives = 93/96 (96.88%), Query Frame = 1
Query: 5434 EENTKKRESETILDNLNDYRTIANKTKFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSNVSNPR 5721
            EENTK+R+SETIL NLNDYRTIANKTKFENVMICMMCLLDSSFSDNELVECDGCG VVHEDCYKISDSVFMSDDSSDSSTYPWFCDACLSNVSNP 
Sbjct:   74 EENTKERKSETILYNLNDYRTIANKTKFENVMICMMCLLDSSFSDNELVECDGCGTVVHEDCYKISDSVFMSDDSSDSSTYPWFCDACLSNVSNPE 169          
BLAST of PHD finger protein 14 vs. Planmine SMEST
Match: SMESG000049670.1 (SMESG000049670.1)

HSP 1 Score: 160.999 bits (406), Expect = 2.977e-44
Identity = 91/95 (95.79%), Postives = 93/95 (97.89%), Query Frame = 1
Query: 5434 EENTKKRESETILDNLNDYRTIANKTKFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYKIXXXXXXXXXXXXXXTYPWFCDACLSNVSNP 5718
            EENTK+R+SETIL NLNDYRTIANKTKFENVMICMMCLLDSSFSDNELVECDGCG VVHEDCYKISDSVFMSDDSSDSSTYPWFCDACLSNVSNP
Sbjct:   74 EENTKERKSETILYNLNDYRTIANKTKFENVMICMMCLLDSSFSDNELVECDGCGTVVHEDCYKISDSVFMSDDSSDSSTYPWFCDACLSNVSNP 168          
The following BLAST results are available for this feature:
BLAST of PHD finger protein 14 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PHF145.418e-9335.84PHD finger protein 14 [Source:HGNC Symbol;Acc:HGNC... [more]
PHF141.607e-9135.04PHD finger protein 14 [Source:HGNC Symbol;Acc:HGNC... [more]
PHF146.291e-9135.04PHD finger protein 14 [Source:HGNC Symbol;Acc:HGNC... [more]
MLLT107.662e-2935.32MLLT10 histone lysine methyltransferase DOT1L cofa... [more]
MLLT108.681e-2935.32MLLT10 histone lysine methyltransferase DOT1L cofa... [more]
back to top
BLAST of PHD finger protein 14 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phf-146.718e-4227.07PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
zfp-13.364e-2533.90Uncharacterized protein F54F2.2, isoform a [Sourc... [more]
zfp-13.364e-2533.90Uncharacterized protein F54F2.2, isoform a [Sourc... [more]
lin-496.949e-2332.26pep chromosome:WBcel235:IV:8620683:8626149:1 gene:... [more]
phf-151.226e-1226.06PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
back to top
BLAST of PHD finger protein 14 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG154391.653e-8833.33gene:FBgn0031606 transcript:FBtr0077455[more]
Alh7.344e-2936.98gene:FBgn0261238 transcript:FBtr0334672[more]
Alh7.635e-2936.98gene:FBgn0261238 transcript:FBtr0334673[more]
Alh7.887e-2936.98gene:FBgn0261238 transcript:FBtr0081612[more]
Alh8.994e-2936.98gene:FBgn0261238 transcript:FBtr0081613[more]
back to top
BLAST of PHD finger protein 14 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phf142.674e-9134.96PHD finger protein 14 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
phf143.255e-9034.96PHD finger protein 14 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
phf146.756e-8433.66PHD finger protein 14 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
mllt109.632e-3134.83MLLT10 histone lysine methyltransferase DOT1L cofa... [more]
mllt109.632e-3134.83MLLT10 histone lysine methyltransferase DOT1L cofa... [more]
back to top
BLAST of PHD finger protein 14 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phf141.384e-8935.63PHD finger protein 14 [Source:NCBI gene;Acc:100216... [more]
phf141.074e-8835.24PHD finger protein 14 [Source:NCBI gene;Acc:100216... [more]
phf141.244e-8835.24PHD finger protein 14 [Source:NCBI gene;Acc:100216... [more]
phf142.119e-8835.63PHD finger protein 14 [Source:NCBI gene;Acc:100216... [more]
phf142.157e-8835.24PHD finger protein 14 [Source:NCBI gene;Acc:100216... [more]
back to top
BLAST of PHD finger protein 14 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Phf148.614e-9235.23PHD finger protein 14 [Source:MGI Symbol;Acc:MGI:1... [more]
Phf141.073e-9135.23PHD finger protein 14 [Source:MGI Symbol;Acc:MGI:1... [more]
Phf144.527e-9135.23PHD finger protein 14 [Source:MGI Symbol;Acc:MGI:1... [more]
Phf147.439e-6850.71PHD finger protein 14 [Source:MGI Symbol;Acc:MGI:1... [more]
Mllt107.307e-2935.32myeloid/lymphoid or mixed-lineage leukemia; transl... [more]
back to top
BLAST of PHD finger protein 14 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D4H9|PHF14_MOUSE7.502e-9135.23PHD finger protein 14 OS=Mus musculus OX=10090 GN=... [more]
sp|O94880|PHF14_HUMAN7.717e-9135.04PHD finger protein 14 OS=Homo sapiens OX=9606 GN=P... [more]
sp|P55197|AF10_HUMAN4.169e-2835.32Protein AF-10 OS=Homo sapiens OX=9606 GN=MLLT10 PE... [more]
sp|O54826|AF10_MOUSE5.111e-2835.32Protein AF-10 OS=Mus musculus OX=10090 GN=Mllt10 P... [more]
sp|P55198|AF17_HUMAN2.712e-2636.04Protein AF-17 OS=Homo sapiens OX=9606 GN=MLLT6 PE=... [more]
back to top
BLAST of PHD finger protein 14 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0J6617.476e-13240.81PHD finger protein 14 (Fragment) OS=Schistocephalu... [more]
A0A0X3NZ717.550e-13240.81PHD finger protein 14 (Fragment) OS=Schistocephalu... [more]
A0A4Z2CVV11.520e-13142.48PHD finger protein isoform 2 OS=Schistosoma japoni... [more]
A0A0X3Q0D22.165e-13140.81PHD finger protein 14 (Fragment) OS=Schistocephalu... [more]
A0A0X3PH673.520e-13140.81PHD finger protein 14 (Fragment) OS=Schistocephalu... [more]
back to top
BLAST of PHD finger protein 14 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phf145.646e-9134.96PHD finger protein 14 [Source:NCBI gene;Acc:103029... [more]
phf143.331e-9034.96PHD finger protein 14 [Source:NCBI gene;Acc:103029... [more]
phf146.387e-9034.96PHD finger protein 14 [Source:NCBI gene;Acc:103029... [more]
mllt101.229e-2931.91MLLT10 histone lysine methyltransferase DOT1L cofa... [more]
mllt101.293e-2931.91MLLT10 histone lysine methyltransferase DOT1L cofa... [more]
back to top
BLAST of PHD finger protein 14 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phf141.173e-8835.74PHD finger protein 14 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
mllt101.923e-3031.97MLLT10 histone lysine methyltransferase DOT1L cofa... [more]
KDM4C1.355e-1827.32lysine demethylase 4C [Source:HGNC Symbol;Acc:HGNC... [more]
KDM4C2.163e-1528.57lysine demethylase 4C [Source:HGNC Symbol;Acc:HGNC... [more]
ENSPMAT00000008687.17.117e-1434.31pep scaffold:Pmarinus_7.0:GL495059:436:1819:-1 gen... [more]
back to top
BLAST of PHD finger protein 14 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
NTO14.526e-1931.65Subunit of the NuA3 histone acetyltransferase comp... [more]
SNT27.457e-1125.86Subunit of Snt2C complex, RING finger ubiquitin li... [more]
JHD28.799e-624.62JmjC domain family histone demethylase; promotes g... [more]
back to top
BLAST of PHD finger protein 14 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO437781.114e-3035.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405695.928e-2124.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497151.863e-1931.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437927.164e-1455.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317643.739e-840.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PHD finger protein 14 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phf145.122e-8934.57PHD finger protein 14 [Source:NCBI gene;Acc:101171... [more]
phf144.344e-8834.57PHD finger protein 14 [Source:NCBI gene;Acc:101171... [more]
mllt103.491e-2934.83MLLT10 histone lysine methyltransferase DOT1L cofa... [more]
mllt107.612e-2935.42MLLT10 histone lysine methyltransferase DOT1L cofa... [more]
mllt107.612e-2935.42MLLT10 histone lysine methyltransferase DOT1L cofa... [more]
back to top
BLAST of PHD finger protein 14 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070587.10.000e+098.97SMESG000070587.1[more]
SMESG000049566.13.892e-4696.84SMESG000049566.1[more]
SMESG000049566.14.926e-4696.84SMESG000049566.1[more]
SMESG000049670.11.239e-4494.79SMESG000049670.1[more]
SMESG000049670.12.977e-4495.79SMESG000049670.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034392 ID=SMED30034392|Name=PHD finger protein 14|organism=Schmidtea mediterranea sexual|type=transcript|length=7835bp
AAATGCCTTCCAAATCAAATAAATATATATATTAATCCACACTAATGGGA
AATAGATTTTAACTGTCACAATTCAATGAGCGATAATTTTTTCCAGAACA
CATTTTCCAACAAACCGAAAACATCTGATGAAAAGCAAGCGAATAATCCA
ACTGAAGACCTTGAAAATCCAGATGATGGAAGGGACAATGTTATTCAACA
CTTAATATATCATTCATTTTATCCATCAACTTGTATGGTTCCTTTGGAAG
AGAATTTAATCATCATCAATGAAACCGTTCCAGACCTCATGAAAGCTAAA
GAACACGATCCACTTATCCAGGAAACCATTAAAACATTTCACTTATTAGT
CCAAGAGAAAGACGATGAAATTCTTAATCTTCGTCGACAACTGAACATTT
CTGAGGGGCTTTCGAATCTAGTTGAGTTTCATTCTGAAACGATCCAAACG
GATTTAACTTTGGATGATTGCAGTCAAATGGAAAACCAGATTTTAGTACT
TTCAACTGATCTCCCGGAAAAAAATGAGAAAATTCATCAACTCCAACAAG
AATTAGAAAAAATTAAAGGTAATAAGTTAACATCAACCGACTCCAAAACC
ACAGATCTCGAGGAGGCTTATAAAGGTCTGACCGAGCTTGAATTGAAAAA
TTCTGAACTTGCTGAACAAAATAAAATTCTCCAATACAAATTAGACGATG
TCAATGAATTGAAATATGAGATTGAAGTTGCCAAAATTCAGGCTGAAAAC
GATAAACAAAATTTGGAAGAAGTTTTAATTGAAAAAGATATAGAGATTGA
GAAATGCAAACTGGAATTAAGTTCAATAATTCAGAGCGATTTCTGTGTTG
AAACAAAATCCGGAAATCAACCGGAAGCTATGCCTAAAGAATTCAATGAT
CCAAGAGAAAACATTGACATAGTTATTGAAGAATTGAAAAACAAATTATT
CAATTCCAAACTCGATTCAAGTCTTTTGCCACTAATTTCGCGAACTACCT
CAAATGATGGACGGTTTCGGAATTTAAACGACAAAGAAATTCTTTCGGAA
CTAATACGAATTTGTTGTGATGGAAAATCAACGGAAATCGAACTCAAAGA
AATTCTCCCCATTGTTAAGTCAATTTCGTTCCAGGAAAATGGTAATCCTG
ACATTGCACAAATTGAAACCAATATTCCTCAATTCCAGACCGCCTGTAAC
AAACTAAACAAAGAGCAACTGATGCGAGACGCAGTGAATAATGGAATTTC
TCTAAAAATGAGAACGAGTCTCATTTTAATGGAAATAAGTGATTTAAAAA
AAGAGTACTTGAAACTAGAAAACATTTTAAATATTTTAAATAAATCCTTC
AAACTAACTCAGTTGGGAATGTTGAATCGAATGTCTAAGAAAGAACTCAT
TGATGGGATTTTAGAAAAACGATCAACAATTTTTGAAATTTCATTGCATA
GTTTTTGGGGGGTTATTTCTAACAGTCAATTCAAAGAAAGTGATGCATGT
AGATCATTGAAATTGACAAGTGCTGACGTAAGCACCATTTCTAATACTTT
ATTTCATAATTACAAAGAGGATTCGGAATTTTCATTGTTTACGTCAATGT
TGATAAATATTAGAAGCATTCTTCTTTATGGAGAACTACCTAAAGGGAAG
AAGGAGAAATCCATTTTCTACTTAGAAAAATTATGTAGTGTCAATTTAAT
ACATGACATTACTAATCACATTCTTCCTAAATATCCTCGAGAGATCAGAG
GGAAATTATTAGAGAGCACCGTCGAAACCACAATTAGCGATTCGTATAAA
TTTTATGAAATTATTTCTCAAGAATTTCTTATCTTAGCCTTTAATTCCAA
AAGACCATTTGAATCAACTGACCAAATTGGAACTCTTAACTTGTCTTGGA
GTATTCTTAATATTTTTTCGATGTTAAATTTCGAAGACGACCTATTTCTC
TTATCAGTGGTTATTCAAAAAAATGAATTTCCCGGACAGTTATTATCTCT
GTCAAACACCACGAAAAAGGTTGAAAAAACTGTAATAAAATTTTCACTTC
AAAAAAACAAATTAGAAAAATTAATAAATACAATTGTTCGAATTCAAGTA
TTTCTTAATAATGAAAATGAGCAATCACTGATGAAATCTTACAACTTAAA
ATCAGAAAATGAGTTGATAAAAGTCTTAATAAAGAAAAAAGAAGAAATGA
TCAAAATTCTTTTTAAAGATACATTTCAACCGGTTTTGGATAAGATCATT
GTTCCGAGGGGTTCGAAGTATGTTTCCTGTGTTTCAAAAGATAAAACTAA
TCTTGATTTTTGGATCAAAATGGTTTTAGATAGATATAATAAGGACCAAA
TAAAGGATTTACAAAGCCTTTCGGAGGAAGAATTACGGATTTGTTTTAAA
CGATTATTGAAATGCATGGAATTAGTTTCCCCAAACATTTTATTATCATT
TAAAGAAAAGTCATCAATGAAAAATGATGTTATAAAATTAATATTTACTC
TCCGACTTGCCTTAATAGAAAAACTACGTGGAAACTTATTTGGTGATCGG
TTCAGATTAAAAGATATTAATTTTGGTGAAAGTTCGTATGAGATAAATTC
TGAAGAAGAATACGAATCACTGGTAAGATATTTAAACTCTTCAAGTCTTA
ATTCAGAAGTGCCAGACCTGGATGAGATTGTCAAAACTCTATATGAAATC
GACTGTGAAATATTTCCTGGAATTATTATTCAAAATTTAACGACAAAAGA
TTTGACAAAATATAAATCCTATGAATTGTCCGATGAAATAGTGATACTGA
GATTAGCAATTGCTGGCAGTATGATATGTAGCACTCAGTCTTGGAATGAT
CTTAAGGAAATAGTAGAATCCAATGTCGACAGATGGGGAGTTTTGAAAAG
AATAGAAAACACTTTAATTAATTCTGAGTTAATAAGTATTGACAACGATA
TGATAGACTGGGAAAGAAATTTTCTGAAAAAAATAATTTTTATTTGTAGA
GGTTCAACGATCATAAATGAGGACAAACTCAGAGATGCGTATATTGAAGT
TAGAAAAATTGCCTGCAGAAACAATGGGGAAATCTTTGATATGAACGAGA
ATTTGAAATCTTTCGGCAAGATATCAAACAAACAAGGCAAAGTAAAGGTT
TTATGCGATGAAGTGGATAGTATTTTAAAAGGTTATAAAAGAAAATTTCA
AAATACCGAGGAAATGGAAAAATCTGTGGAAAATTATAAAAAGTTAGAAT
TAGTTCTAGAAGACATGGAATTAAACTTCGTAGAGAAAAATACAAATCTC
AGAGAAACTTGGATTTATTTATTTTATGATAAAGTCAGTGACATTGAAAG
GGTATTGAATAAGGATACGAAAGATATTAATGAATTGAAAACTGAAAATT
TAAGAAATGTTATAATTAAATATTTAGGTCACATTAAACAATGGGTTTCC
GATTCACGGAATTTACAAGCCGATTTATTCAGTCGCTTAAACTCCTCAAT
AAGAAAACTAAATAATTCATCTCCATTAAAAGAAAGAAAAATAAAAATGT
CTTCCGTTGACTTAGATTTAAATTCCAGTAATTTCGACGATGAGAAAAGG
GCTTTCGAAAAATCATTTTTTGAACTTGAAGAAAGAATCAAAGAAATCGG
AAACAAAAGCGAAAATAAAGACAAATATAGCAAGTTAATTGAAACAAAAA
TAATGGATAAAAACCAAGAGGAATTGAAATATTTGATAGTTTCTTTGGGA
AATGAACTTTCTGGAAACCAAAACAATGAATTCGAATTAAAGGAGACCAA
GTTATCGCTGAATGAAAAGTCTAAAGAGCAGCTGGAAGACGAATGTCGTG
CGTTGACGCATAAAGTATTGATGAAGAAATTGGACGAATTTCTAAATGAT
AAATCTGCTAACAATCTGTCTCGTCAAAAGCTTAAAGATGATCATTTGTT
ACAGTTTGAAGATGATATTAACCTAAAGTTAACTCGATATCAAGATCTAT
GTGATTCAGTAGACAAACTGAAAATTCCTCAAACCTATTCTAAAGGTAGA
AATTCACCATTAATCAGTCAGAATGAAATGATGTTTTCAGCACCCATAAC
CCAAGAATCCAACATCAATCAGAATTTCCATCAGTCTCATTCTTCAAGAC
AAACAAATGAAGAAGAAGACGATATTGTCGACTCCTATTTTTATAAAAGA
TTAAATGAAATTCAAAATAGTATAAAATCGTCAGATAAAACAAATACAAA
CTTGAAGGTTCAAATGCTTCCCTACAAAAACAATACAGAGTCGAATGTTC
TCGTAGATGGCTTTGATATAGAAGATGAGAAAACATCAAGATTCTACAGC
ATGAAGTTACAAGACATTCAACATGAAAGAAAAGAAGATGAATTGACTAC
AATTTTGATTCAAATGGAAAAAGACCGTCAGGAAATTCTTGATAAAAACA
AAAATCTTCAACAGCAGATTTTTTTTTGTGAAAACATAATAGAAACTCAA
CAAATCAAACTAGAAGCGATGGAAAAAACTGACTCAACGGATAAACAAAA
AGTAAAAGAATATGAGCGTGACGAAAAACAAGACTACGATTCTAAGTATA
AATTTGAAGACATGAGATTACAAAAACATGAAATCAAACGTTTAAAGGCT
ACCACGATCGCAGCACAGAATCAGTTAGATAGACAAAACTCAAACATTAT
TACATTATCAACAATGGCTGATAATTTGCAACACGAAAACAGTAATCTTC
TAATAAAAAATAAGTATTTAGAAAGAAGTTTCCAAAAATTAGAGGAAATT
TTTAATGACCTTGTTCGTCAATTGGAATCTGTTAAGCACAATTTCCCCAA
TAATCGAAACGATATTGTTTATCAGAGCATGAAAGAGTCAATCAAAGATC
CTGAGCTTGAAAGACGACTCAGACAAAGTGAAAGCGATAAAATTGACTTA
GTTAGAAAGATGGATATAATCGAACAACAAAATGAACTGCTTAAAGTTCA
TTGTGAAAAACTGGATATTGAATTAACGAATTCAAATAAAAATTTGGCAG
AATTCCAATCGCTTTCAGACAAGTATAGACAACAGGCAGGTCAATTGGCA
AATATTCTGGATAAAATGACAATGGAAAATGACAGGAACCAACCAGTTTC
ATTTAGTCCGATTACCAAAAATAAAGATGAAGAAATAAAATTATATTTAA
ATGCAATCACTAAACGAGATCCATCTAAACGACAAATTAAACCTGTTGAT
AAAGATGCATTTCAATTATTTGATGATATAGAATCAGGATCCGATGAAGA
TTTTGTTGTTGGATCTGATGATTTTTCTGATGACCAACAAATTGAAGAAA
GCGAAGAAGAAAATGAAAATTCTAAAGCAGATGATGGAAATGACTCAGAT
GATACATCTGATACAAACGTGTCGGATAAAGTAGAAGAAAATACCAAGAA
AAGAGAAAGTGAAACTATATTGGATAATTTGAATGATTATCGGACAATTG
CTAATAAAACAAAATTCGAAAACGTGATGATATGCATGATGTGTTTATTG
GACTCTAGTTTCTCCGACAATGAATTAGTCGAATGTGATGGATGTGGAAT
TGTTGTTCATGAAGATTGCTATAAGATATCCGACAGCGTGTTTATGTCAG
ACGACTCGAGTGATTCCAGCACTTATCCTTGGTTTTGTGATGCATGCTTA
TCAAATGTTTCCAATCCGAGATGTGAATTGTGTCCTGTCGAAGAGGGAGT
GTTCAAACGGACCGAGAATAATCGCTGGGTACATTTGTTATGTGCTCTCT
ACACGCCTGGGGTTGCATTTAATGACACTGAAACTTTATCCGAAATCACT
TTATCTGAACTGCCTTTGAAAGATTGGTCAGCACGTGAATGCGGTCTGTG
TGCGAATCCTTTCTTTGCTCGGACCGGCATTTGTATTAGTTGCGACGCTG
GATTGTGCAAAAATGTTTTCCACGTTCTTTGCGCACAGAAAGAGGGATTA
TTATCAGAACCGAATAATGAAGAAAATTCCGACGACCCCTATTTTGCCAA
TTGTAGGCAACACACGGATAAAGAGACCGTAAAACGCCGTAGGAAAAATT
GGAATGCTGCAGTTAATCGTCAGAAACTGCGACTGGAAGAATGGCATAAT
AACAATCATTACAACGACTCGAGATTGATCAGAAAGCGCCAGTTCTTTTC
CTCAATGCATTCTAAATTTCTTGAATTAGTTCCAACGCCTTTCGTTCCTA
AAACAAAAGTCGCCTGCTTTTTGGAAACAAATCCGATTGCCGTATTTCTG
TTCAAGAAGAAAGCGACAAATTTGCGATTACCACAGGACGTGCTGAACTC
CCAAACGAGCAACGACTTGAAAACCATCTCCTCGGGAATACCGGTTTTTG
GGCCCGATTTTATCACCTATTTCCTCGATAGGGAAAAGAAAATCGACGAG
ACAAGCCGGGAAATTGTTCAGTTGGAGAACTTTCGTAGGGAATTACAAAT
TTCTGAGCAGAATACTTCCCATCAATTCAATAAGACCGTGGCTAAGAAGG
AATCGGCAGAAAAGGAATTCAAGTTGGGCCTGGAGCAAGTCGCGTTGAAA
TTCGATATAATTAAACAGTTAGTAAAGCACCGGGAATTGATGGAGGTGAT
CAATAATCTGTTGGCCAAGTTCCAAATCCCAACCAATGGCAGCACTGGAA
ATGGCAACGAATCTCTGGTTTCTGGAGCCGATAAAGAAACAAGCGCTACA
AATACCAAGACAAAGCCGGACTCAGTCATTAATGAGTGCTACATGTGCAA
GAGTGTCAGTGACCAGCACATGCTCATTGATTGCGACAATTGCCACAAAT
TCATTCACATTGGATGTCTCGACCCCCCTCTCACACGAATGCCAAGGAAA
ACGAAACTTTACGGATGGCAATGCTCCCTCTGCTCATGTGCGACAACCGA
TGATGAGCACGCAAAGAATCTAGATGTCAATCGGCCTCGGCAGCTGAGGC
GGTCAAATGATTTACGCAGCAAATACAGTCGACACGAAGAGATTTCGTCC
ACCGAGAAATTCAGTCGGAAAATCCTAAAGCGAACCAAACAGCGATCGAT
AATCAATCAAACGGTGAGGCCCAAACCGAGACCTGTTAGTCCGACACCGC
CGGAAAAGGTGAAAACTCCTACAAAACTGGAAGAAGTTCTCCTTGAGCCG
CCGGTGATTTCCCATTCTCCCGTCAACTCCACCAACGAGACTCCTCCTGA
CTGTTCAAATGTTCCCGAATCAGAAGCGGCAACCGACAACTCCAACACAT
CGAAACCTCCTCATATGACGGGTCAGCGCAAATCAGACCGCTCACGGAAA
CGGCCACTGACATTGCTCGACGAGTACGAAACGACTGTCAAGAGGAAGCG
GCCAAATTTGCAAAATGTGATAAAATCGATGCAAATCAGGAGGAAATCAG
CTCCAATAAAGGCTGACGTTATGAGATCTCGGCTGCCAAAGGTCGCAAAG
GTGTCCAAATCGTTCTCCAGCCAATCAAATGAAACCGCGGAGCCAAAATC
ACAGAAACAATCTCAGCCAATCACATTCTATCCGTCCTCAGAGCCGCCCA
GCGTGTCGAGCAAGCAGTCCAGTGAATCGGAGCACGTCCAAATCGGGGTA
GTTGCTAAGAAACCGATCTCGTTATCAAGGGACAGCAATTCGGGCACTCA
GAAGGGATTCGAGAAGAAATCAATTTTAATAAAATGCCACGACGAGAATG
ACGATGATGATGAGAGATTGACTGCCACCGAAACCTTGGCGAGATTCAGT
GGCACAGGCTGATGTTGCCTGTTGTTTTGATGTGA
back to top

protein sequence of SMED30034392-orf-1

>SMED30034392-orf-1 ID=SMED30034392-orf-1|Name=SMED30034392-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2579bp
MSDNFFQNTFSNKPKTSDEKQANNPTEDLENPDDGRDNVIQHLIYHSFYP
STCMVPLEENLIIINETVPDLMKAKEHDPLIQETIKTFHLLVQEKDDEIL
NLRRQLNISEGLSNLVEFHSETIQTDLTLDDCSQMENQILVLSTDLPEKN
EKIHQLQQELEKIKGNKLTSTDSKTTDLEEAYKGLTELELKNSELAEQNK
ILQYKLDDVNELKYEIEVAKIQAENDKQNLEEVLIEKDIEIEKCKLELSS
IIQSDFCVETKSGNQPEAMPKEFNDPRENIDIVIEELKNKLFNSKLDSSL
LPLISRTTSNDGRFRNLNDKEILSELIRICCDGKSTEIELKEILPIVKSI
SFQENGNPDIAQIETNIPQFQTACNKLNKEQLMRDAVNNGISLKMRTSLI
LMEISDLKKEYLKLENILNILNKSFKLTQLGMLNRMSKKELIDGILEKRS
TIFEISLHSFWGVISNSQFKESDACRSLKLTSADVSTISNTLFHNYKEDS
EFSLFTSMLINIRSILLYGELPKGKKEKSIFYLEKLCSVNLIHDITNHIL
PKYPREIRGKLLESTVETTISDSYKFYEIISQEFLILAFNSKRPFESTDQ
IGTLNLSWSILNIFSMLNFEDDLFLLSVVIQKNEFPGQLLSLSNTTKKVE
KTVIKFSLQKNKLEKLINTIVRIQVFLNNENEQSLMKSYNLKSENELIKV
LIKKKEEMIKILFKDTFQPVLDKIIVPRGSKYVSCVSKDKTNLDFWIKMV
LDRYNKDQIKDLQSLSEEELRICFKRLLKCMELVSPNILLSFKEKSSMKN
DVIKLIFTLRLALIEKLRGNLFGDRFRLKDINFGESSYEINSEEEYESLV
RYLNSSSLNSEVPDLDEIVKTLYEIDCEIFPGIIIQNLTTKDLTKYKSYE
LSDEIVILRLAIAGSMICSTQSWNDLKEIVESNVDRWGVLKRIENTLINS
ELISIDNDMIDWERNFLKKIIFICRGSTIINEDKLRDAYIEVRKIACRNN
GEIFDMNENLKSFGKISNKQGKVKVLCDEVDSILKGYKRKFQNTEEMEKS
VENYKKLELVLEDMELNFVEKNTNLRETWIYLFYDKVSDIERVLNKDTKD
INELKTENLRNVIIKYLGHIKQWVSDSRNLQADLFSRLNSSIRKLNNSSP
LKERKIKMSSVDLDLNSSNFDDEKRAFEKSFFELEERIKEIGNKSENKDK
YSKLIETKIMDKNQEELKYLIVSLGNELSGNQNNEFELKETKLSLNEKSK
EQLEDECRALTHKVLMKKLDEFLNDKSANNLSRQKLKDDHLLQFEDDINL
KLTRYQDLCDSVDKLKIPQTYSKGRNSPLISQNEMMFSAPITQESNINQN
FHQSHSSRQTNEEEDDIVDSYFYKRLNEIQNSIKSSDKTNTNLKVQMLPY
KNNTESNVLVDGFDIEDEKTSRFYSMKLQDIQHERKEDELTTILIQMEKD
RQEILDKNKNLQQQIFFCENIIETQQIKLEAMEKTDSTDKQKVKEYERDE
KQDYDSKYKFEDMRLQKHEIKRLKATTIAAQNQLDRQNSNIITLSTMADN
LQHENSNLLIKNKYLERSFQKLEEIFNDLVRQLESVKHNFPNNRNDIVYQ
SMKESIKDPELERRLRQSESDKIDLVRKMDIIEQQNELLKVHCEKLDIEL
TNSNKNLAEFQSLSDKYRQQAGQLANILDKMTMENDRNQPVSFSPITKNK
DEEIKLYLNAITKRDPSKRQIKPVDKDAFQLFDDIESGSDEDFVVGSDDF
SDDQQIEESEEENENSKADDGNDSDDTSDTNVSDKVEENTKKRESETILD
NLNDYRTIANKTKFENVMICMMCLLDSSFSDNELVECDGCGIVVHEDCYK
ISDSVFMSDDSSDSSTYPWFCDACLSNVSNPRCELCPVEEGVFKRTENNR
WVHLLCALYTPGVAFNDTETLSEITLSELPLKDWSARECGLCANPFFART
GICISCDAGLCKNVFHVLCAQKEGLLSEPNNEENSDDPYFANCRQHTDKE
TVKRRRKNWNAAVNRQKLRLEEWHNNNHYNDSRLIRKRQFFSSMHSKFLE
LVPTPFVPKTKVACFLETNPIAVFLFKKKATNLRLPQDVLNSQTSNDLKT
ISSGIPVFGPDFITYFLDREKKIDETSREIVQLENFRRELQISEQNTSHQ
FNKTVAKKESAEKEFKLGLEQVALKFDIIKQLVKHRELMEVINNLLAKFQ
IPTNGSTGNGNESLVSGADKETSATNTKTKPDSVINECYMCKSVSDQHML
IDCDNCHKFIHIGCLDPPLTRMPRKTKLYGWQCSLCSCATTDDEHAKNLD
VNRPRQLRRSNDLRSKYSRHEEISSTEKFSRKILKRTKQRSIINQTVRPK
PRPVSPTPPEKVKTPTKLEEVLLEPPVISHSPVNSTNETPPDCSNVPESE
AATDNSNTSKPPHMTGQRKSDRSRKRPLTLLDEYETTVKRKRPNLQNVIK
SMQIRRKSAPIKADVMRSRLPKVAKVSKSFSSQSNETAEPKSQKQSQPIT
FYPSSEPPSVSSKQSSESEHVQIGVVAKKPISLSRDSNSGTQKGFEKKSI
LIKCHDENDDDDERLTATETLARFSGTG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR034732EPHD
IPR001965Znf_PHD
IPR019787Znf_PHD-finger
IPR013083Znf_RING/FYVE/PHD
IPR019786Zinc_finger_PHD-type_CS
IPR011011Znf_FYVE_PHD
IPR006588Peptide_N_glycanase_PAW_dom
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006516glycoprotein catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 536..586
e-value: 3.2E-4
score: 30.0
coord: 237..296
e-value: 5.5E-4
score: 29.2
coord: 118..174
e-value: 3.0E-7
score: 40.1
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 180..298
e-value: 5.0E-16
score: 60.9
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 99..179
e-value: 4.7E-12
score: 47.3
NoneNo IPR availablePFAMPF13832zf-HC5HC2H_2coord: 181..295
e-value: 1.4E-26
score: 92.8
NoneNo IPR availableGENE3DG3DSA:2.30.30.1150coord: 440..588
e-value: 2.8E-13
score: 52.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 634..735
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 69..93
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 678..713
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 775..848
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 775..820
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 507..526
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 38..93
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 714..735
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 38..68
NoneNo IPR availablePANTHERPTHR13793:SF127PHD FINGER PROTEIN 14coord: 12..816
NoneNo IPR availablePANTHERPTHR13793PHD FINGER PROTEINScoord: 12..816
NoneNo IPR availableCDDcd15561PHD1_PHF14coord: 118..173
e-value: 9.42745E-19
score: 78.6335
NoneNo IPR availableCDDcd15674ePHD_PHF14coord: 182..295
e-value: 5.14247E-62
score: 202.998
NoneNo IPR availableCDDcd15562PHD2_PHF14coord: 536..585
e-value: 4.73059E-26
score: 99.0174
NoneNo IPR availableCOILSCoilCoilcoord: 209..247
NoneNo IPR availableCOILSCoilCoilcoord: 1047..1067
NoneNo IPR availableCOILSCoilCoilcoord: 146..166
NoneNo IPR availableCOILSCoilCoilcoord: 404..424
NoneNo IPR availableCOILSCoilCoilcoord: 1520..1540
NoneNo IPR availableCOILSCoilCoilcoord: 1548..1589
NoneNo IPR availableCOILSCoilCoilcoord: 178..205
NoneNo IPR availableCOILSCoilCoilcoord: 1444..1464
NoneNo IPR availableCOILSCoilCoilcoord: 1243..1263
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..34
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 20..34
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..19
IPR019787Zinc finger, PHD-fingerPFAMPF00628PHDcoord: 118..174
e-value: 6.7E-8
score: 32.3
coord: 537..587
e-value: 1.7E-7
score: 31.0
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 534..588
score: 9.205
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 116..176
score: 9.241
IPR019786Zinc finger, PHD-type, conserved sitePROSITEPS01359ZF_PHD_1coord: 119..173
IPR034732Extended PHD (ePHD) domainPROSITEPS51805EPHDcoord: 179..296
score: 21.684
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 535..588
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 112..184