Malate dehydrogenase

Overview
NameMalate dehydrogenase
Smed IDSMED30034381
Length (bp)1624
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Malate dehydrogenase (SMED30034381) t-SNE clustered cells

Violin plots show distribution of expression levels for Malate dehydrogenase (SMED30034381) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Malate dehydrogenase (SMED30034381) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Malate dehydrogenase (SMED30034381) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034381

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30034381SMESG000056995.1 dd_Smed_v4_467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30034381SMESG000056995.1 dd_Smed_v4_467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034381SMESG000056995.1 dd_Smed_v4_467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30034381SMESG000056995.1 dd_Smed_v4_467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034381SMESG000056995.1 dd_Smed_v4_467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034381SMESG000056995.1 dd_Smed_v4_467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034381SMESG000056995.1 dd_Smed_v4_467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034381SMESG000056995.1 dd_Smed_v4_467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034381SMESG000056995.1 dd_Smed_v4_467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034381SMESG000056995.1 dd_Smed_v4_467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30034381SMESG000056995.1 OX_Smed_1.0.23400ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30034381SMESG000056995.1 dd_Smed_v6_467_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034381SMESG000056995.1 dd_Smed_v6_467_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30034381SMESG000056995.1 dd_Smed_v6_467_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30034381SMESG000056995.1 dd_Smed_v6_467_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034381SMESG000056995.1 dd_Smed_v4_467_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Malate dehydrogenase vs. Ensembl Human
Match: MDH1 (malate dehydrogenase 1 [Source:HGNC Symbol;Acc:HGNC:6970])

HSP 1 Score: 407.142 bits (1045), Expect = 3.157e-139
Identity = 216/333 (64.86%), Postives = 257/333 (77.18%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            M+ PI V++TGAAGQI Y L++S+ +G+VFG  QPI L LLDI  M+  L G++MEL+DCA P L  VIATD    AF D+D A++VG+MPR+EGMERKDLLKANV IFK QG ALDKYAKKS KV VVGNPANTNCL  SK APSIPKENFS LTRLDHNRA+AQIA K GV  + VK  +IWGNHS+TQYPDVNH  V    GKEV + +A+KDD+WLK +F+ TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   E+VSM V SDG SYGVP D+++SFPV I +  W  V+GL I+DFSR+K+DLT KEL EE++ A  F S
Sbjct:    1 MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQ-GKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLS 332          
BLAST of Malate dehydrogenase vs. Ensembl Human
Match: MDH1 (malate dehydrogenase 1 [Source:HGNC Symbol;Acc:HGNC:6970])

HSP 1 Score: 407.142 bits (1045), Expect = 3.157e-139
Identity = 216/333 (64.86%), Postives = 257/333 (77.18%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            M+ PI V++TGAAGQI Y L++S+ +G+VFG  QPI L LLDI  M+  L G++MEL+DCA P L  VIATD    AF D+D A++VG+MPR+EGMERKDLLKANV IFK QG ALDKYAKKS KV VVGNPANTNCL  SK APSIPKENFS LTRLDHNRA+AQIA K GV  + VK  +IWGNHS+TQYPDVNH  V    GKEV + +A+KDD+WLK +F+ TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   E+VSM V SDG SYGVP D+++SFPV I +  W  V+GL I+DFSR+K+DLT KEL EE++ A  F S
Sbjct:    1 MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQ-GKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLS 332          
BLAST of Malate dehydrogenase vs. Ensembl Human
Match: MDH1 (malate dehydrogenase 1 [Source:HGNC Symbol;Acc:HGNC:6970])

HSP 1 Score: 407.527 bits (1046), Expect = 4.705e-139
Identity = 221/344 (64.24%), Postives = 262/344 (76.16%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS*KLMALL*NDV 1181
            M+ PI V++TGAAGQI Y L++S+ +G+VFG  QPI L LLDI  M+  L G++MEL+DCA P L  VIATD    AF D+D A++VG+MPR+EGMERKDLLKANV IFK QG ALDKYAKKS KV VVGNPANTNCL  SK APSIPKENFS LTRLDHNRA+AQIA K GV  + VK  +IWGNHS+TQYPDVNH  V    GKEV + +A+KDD+WLK +F+ TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   E+VSM V SDG SYGVP D+++SFPV I +  W  V+GL I+DFSR+K+DLT KEL EE++ A  F S    A L NDV
Sbjct:    1 MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQ-GKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLS---SAXLDNDV 340          
BLAST of Malate dehydrogenase vs. Ensembl Human
Match: MDH1 (malate dehydrogenase 1 [Source:HGNC Symbol;Acc:HGNC:6970])

HSP 1 Score: 278.485 bits (711), Expect = 1.367e-90
Identity = 136/199 (68.34%), Postives = 157/199 (78.89%), Query Frame = 3
Query:  162 TPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLV 758
            + PI V++TGAAGQI Y L++S+ +G+VFG  QPI L LLDI  M+  L G++MEL+DCA P L  VIATD    AF D+D A++VG+MPR+EGMERKDLLKANV IFK QG ALDKYAKKS KV VVGNPANTNCL  SK APSIPKENFS LTRLDHNRA+AQIA K GV  + VK  +IWGNHS+TQYPDVNH  V
Sbjct:   20 SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV 218          
BLAST of Malate dehydrogenase vs. Ensembl Human
Match: MDH1 (malate dehydrogenase 1 [Source:HGNC Symbol;Acc:HGNC:6970])

HSP 1 Score: 245.358 bits (625), Expect = 5.969e-78
Identity = 136/208 (65.38%), Postives = 160/208 (76.92%), Query Frame = 3
Query:  534 VCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            V VVGNPANTNCL  SK APSIPKENFS LTRLDHNRA+AQIA K GV  + VK  +IWGNHS+TQYPDVNH  V    GKEV + +A+KDD+WLK +F+ TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   E+VSM V SDG SYGVP D+++SFPV I +  W  V+GL I+DFSR+K+DLT KEL EE++ A  F S
Sbjct:    2 VIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVK-LQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLS 208          
BLAST of Malate dehydrogenase vs. Ensembl Celegans
Match: mdh-1 (Malate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:Q8IA49])

HSP 1 Score: 369.392 bits (947), Expect = 9.072e-125
Identity = 195/332 (58.73%), Postives = 241/332 (72.59%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPS-IPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDGSYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFC 1145
            M+ P+ V++TGAAGQIGY +V  +A G VFG  QP+ L LLD+P     L+G++ EL+DCA PTL SV+A  D K AFT +D+A +VGAMPR+EGMERKDLL ANV IFK QG+AL +YAK + KV VVGNPANTN  + +KYA   IP +NFSA+TRLDHNRA AQ+A K G    +VK  +IWGNHS TQ+PDV H  V+  +G E     AV D+ +L+  FI TVQ RG  +I  RKLSSA+SAAKA  DH  DW  GTK  ++VSMAV SDGSYG+P+ +IFSFPVTI+ G+W IVQGL+ DDF++ K+  T KEL EERD AL  C
Sbjct:    1 MSAPLRVLVTGAAGQIGYSIVIRIADGTVFGKEQPVELVLLDVPQCSNILEGVVFELQDCALPTLFSVVAVTDEKSAFTGIDYAFLVGAMPRREGMERKDLLAANVKIFKSQGKALAEYAKPTTKVIVVGNPANTNAFIAAKYAAGKIPAKNFSAMTRLDHNRALAQLALKTGTTIGNVKNVIIWGNHSGTQFPDVTHATVN-KNGTETDAYAAVGDNAFLQGPFIATVQKRGGVIIEKRKLSSAMSAAKAACDHIHDWHFGTKAGQFVSMAVPSDGSYGIPQGLIFSFPVTIEGGEWKIVQGLSFDDFAKGKIAATTKELEEERDDALKAC 331          
BLAST of Malate dehydrogenase vs. Ensembl Celegans
Match: mdh-1 (Malate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:Q8IA49])

HSP 1 Score: 286.574 bits (732), Expect = 2.184e-93
Identity = 153/264 (57.95%), Postives = 188/264 (71.21%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPS-IPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK 947
            M+ P+ V++TGAAGQIGY +V  +A G VFG  QP+ L LLD+P     L+G++ EL+DCA PTL SV+A  D K AFT +D+A +VGAMPR+EGMERKDLL ANV IFK QG+AL +YAK + KV VVGNPANTN  + +KYA   IP +NFSA+TRLDHNRA AQ+A K G    +VK  +IWGNHS TQ+PDV H  V+  +G E     AV D+ +L+  FI TVQ RG  +I  RKLSSA+SAAKA  DH  DW  GTK
Sbjct:    1 MSAPLRVLVTGAAGQIGYSIVIRIADGTVFGKEQPVELVLLDVPQCSNILEGVVFELQDCALPTLFSVVAVTDEKSAFTGIDYAFLVGAMPRREGMERKDLLAANVKIFKSQGKALAEYAKPTTKVIVVGNPANTNAFIAAKYAAGKIPAKNFSAMTRLDHNRALAQLALKTGTTIGNVKNVIIWGNHSGTQFPDVTHATVN-KNGTETDAYAAVGDNAFLQGPFIATVQKRGGVIIEKRKLSSAMSAAKAACDHIHDWHFGTK 263          
BLAST of Malate dehydrogenase vs. Ensembl Celegans
Match: mdh-1 (Malate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:Q8IA49])

HSP 1 Score: 176.407 bits (446), Expect = 2.604e-52
Identity = 102/177 (57.63%), Postives = 125/177 (70.62%), Query Frame = 3
Query:  621 LTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDGSYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFC 1145
            +TRLDHNRA AQ+A K G    +VK  +IWGNHS TQ+PDV H  V+  +G E     AV D+ +L+  FI TVQ RG  +I  RKLSSA+SAAKA  DH  DW  GTK  ++VSMAV SDGSYG+P+ +IFSFPVTI+ G+W IVQGL+ DDF++ K+  T KEL EERD AL  C
Sbjct:    1 MTRLDHNRALAQLALKTGTTIGNVKNVIIWGNHSGTQFPDVTHATVN-KNGTETDAYAAVGDNAFLQGPFIATVQKRGGVIIEKRKLSSAMSAAKAACDHIHDWHFGTKAGQFVSMAVPSDGSYGIPQGLIFSFPVTIEGGEWKIVQGLSFDDFAKGKIAATTKELEEERDDALKAC 176          
BLAST of Malate dehydrogenase vs. Ensembl Celegans
Match: ldh-1 (L-lactate dehydrogenase [Source:UniProtKB/Swiss-Prot;Acc:Q27888])

HSP 1 Score: 49.2914 bits (116), Expect = 3.895e-6
Identity = 74/297 (24.92%), Postives = 127/297 (42.76%), Query Frame = 3
Query:  255 HQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKEN-FSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQ---YPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTKEWVSMAVYSDGSYGVPKDVIFSFPVTI-DHGKWHIV-QGLTIDDFSRQKLDLTGKELIEERD 1127
             Q +   L  + V+   LKG +M+L+     T H  +  D            ++     ++EG  R  L++ NV IFK     L KY+  +  + VV NP +    V  K +  +P+E  F + T LD  R +  ++ K  +        +I G H ++    +  VN   V  H+ K   I +   ++ W      K V +  A  I   K  ++ +   +VA   +  F  ++   +++    G +G+  DV  S PV +   G  H+V Q LT  +   QKL  + K L+E ++
Sbjct:   41 QQNLANELCLVDVVADKLKGEMMDLQHGLAFTRHCTVKADTDYSITAGSKLCVVTAGARQREGETRLSLVQRNVEIFKGIIPQLVKYSPDTC-ILVVSNPVDVLTYVTWKLS-GLPRERVFGSGTNLDSARFRFLLSEKLNIAPSSCHGWII-GEHGDSSVAVWSGVNVAGVTLHEIKP-DIGEKTDNEHWEAEIHKKVVDS--AYEIIKLKGYTSWAIGLSVAKIAQGIFSNSRNVFALSTNVKGFHGINDDVYLSLPVVLGSAGLTHVVKQQLT--EAEVQKLHNSAKALLEVQN 329          
BLAST of Malate dehydrogenase vs. Ensembl Celegans
Match: ldh-1 (L-lactate dehydrogenase [Source:UniProtKB/Swiss-Prot;Acc:Q27888])

HSP 1 Score: 49.2914 bits (116), Expect = 4.042e-6
Identity = 74/297 (24.92%), Postives = 127/297 (42.76%), Query Frame = 3
Query:  255 HQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKEN-FSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQ---YPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTKEWVSMAVYSDGSYGVPKDVIFSFPVTI-DHGKWHIV-QGLTIDDFSRQKLDLTGKELIEERD 1127
             Q +   L  + V+   LKG +M+L+     T H  +  D            ++     ++EG  R  L++ NV IFK     L KY+  +  + VV NP +    V  K +  +P+E  F + T LD  R +  ++ K  +        +I G H ++    +  VN   V  H+ K   I +   ++ W      K V +  A  I   K  ++ +   +VA   +  F  ++   +++    G +G+  DV  S PV +   G  H+V Q LT  +   QKL  + K L+E ++
Sbjct:   44 QQNLANELCLVDVVADKLKGEMMDLQHGLAFTRHCTVKADTDYSITAGSKLCVVTAGARQREGETRLSLVQRNVEIFKGIIPQLVKYSPDTC-ILVVSNPVDVLTYVTWKLS-GLPRERVFGSGTNLDSARFRFLLSEKLNIAPSSCHGWII-GEHGDSSVAVWSGVNVAGVTLHEIKP-DIGEKTDNEHWEAEIHKKVVDS--AYEIIKLKGYTSWAIGLSVAKIAQGIFSNSRNVFALSTNVKGFHGINDDVYLSLPVVLGSAGLTHVVKQQLT--EAEVQKLHNSAKALLEVQN 332          
BLAST of Malate dehydrogenase vs. Ensembl Fly
Match: Mdh1 (gene:FBgn0262782 transcript:FBtr0345435)

HSP 1 Score: 389.808 bits (1000), Expect = 1.213e-132
Identity = 206/329 (62.61%), Postives = 247/329 (75.08%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDGSYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALA 1139
            M  PI VV+TGAAGQI Y L++ +A G VFG  QPI LHLLDIP MV  L+G++MEL DCA P L  V+ T D    F DV  A +VGAMPRKEGMERKDLL ANV IF+ QG+ALDK+AKK  KV VVGNPANTN LV S YAPSIP+ENFSA+TRLD NRA +QIAAK GVP   VK  +IWGNHS+TQYPD     V  + G   S+ DA+ D+ +L+  F++TVQ RGAAVIAARK+SSA+SAAKA  DH  DW++GT   ++VSM V+SDGSY  PKDVIFSFPV I + +W IV GLT+ DF++ KL +TGKEL EE+D+AL+
Sbjct:    1 MAEPIRVVVTGAAGQIAYSLLYMIARGEVFGKDQPIVLHLLDIPPMVGVLEGVVMELADCALPLLVEVVPTTDPAVGFKDVSAAFLVGAMPRKEGMERKDLLSANVKIFRTQGQALDKFAKKDVKVLVVGNPANTNALVCSSYAPSIPRENFSAMTRLDQNRATSQIAAKLGVPISAVKNIIIWGNHSSTQYPDAGQAKVTAN-GTVKSVVDAINDNGYLQGSFVETVQKRGAAVIAARKMSSAMSAAKAACDHMHDWWNGTAPGQFVSMGVFSDGSYDSPKDVIFSFPVEIKNKQWKIVSGLTLSDFAKTKLSVTGKELQEEKDEALS 328          
BLAST of Malate dehydrogenase vs. Ensembl Fly
Match: Mdh1 (gene:FBgn0262782 transcript:FBtr0080050)

HSP 1 Score: 389.808 bits (1000), Expect = 1.213e-132
Identity = 206/329 (62.61%), Postives = 247/329 (75.08%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDGSYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALA 1139
            M  PI VV+TGAAGQI Y L++ +A G VFG  QPI LHLLDIP MV  L+G++MEL DCA P L  V+ T D    F DV  A +VGAMPRKEGMERKDLL ANV IF+ QG+ALDK+AKK  KV VVGNPANTN LV S YAPSIP+ENFSA+TRLD NRA +QIAAK GVP   VK  +IWGNHS+TQYPD     V  + G   S+ DA+ D+ +L+  F++TVQ RGAAVIAARK+SSA+SAAKA  DH  DW++GT   ++VSM V+SDGSY  PKDVIFSFPV I + +W IV GLT+ DF++ KL +TGKEL EE+D+AL+
Sbjct:    1 MAEPIRVVVTGAAGQIAYSLLYMIARGEVFGKDQPIVLHLLDIPPMVGVLEGVVMELADCALPLLVEVVPTTDPAVGFKDVSAAFLVGAMPRKEGMERKDLLSANVKIFRTQGQALDKFAKKDVKVLVVGNPANTNALVCSSYAPSIPRENFSAMTRLDQNRATSQIAAKLGVPISAVKNIIIWGNHSSTQYPDAGQAKVTAN-GTVKSVVDAINDNGYLQGSFVETVQKRGAAVIAARKMSSAMSAAKAACDHMHDWWNGTAPGQFVSMGVFSDGSYDSPKDVIFSFPVEIKNKQWKIVSGLTLSDFAKTKLSVTGKELQEEKDEALS 328          
BLAST of Malate dehydrogenase vs. Ensembl Zebrafish
Match: mdh1aa (malate dehydrogenase 1Aa, NAD (soluble) [Source:ZFIN;Acc:ZDB-GENE-040204-1])

HSP 1 Score: 417.927 bits (1073), Expect = 1.062e-143
Identity = 216/333 (64.86%), Postives = 260/333 (78.08%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            M  PI V++TGAAGQI Y L++S+A G+VFG  QPI L LLDI  M+P L G++MEL+DCA P L  VI TD ++  F D+D A++VG+MPRKEGMERKDLLKANV IFK QGEAL+KYAKK+ KV VVGNPANTNCL+ SK APSIPKENFS LTRLDHNRA++Q+A + GVP D VK   IWGNHS+TQYPDV+H +V   +GKE++  DAV D++WLK DFI TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   EWVSM +YS G SYGVP D+++SFPV I +  W +V GL+I+DFSR K+D T  EL+EERD AL F S
Sbjct:    1 MAEPIRVLVTGAAGQIAYSLLYSIAKGDVFGKDQPIILVLLDITPMLPVLDGVVMELQDCALPLLREVIPTDKVEVGFKDLDAAILVGSMPRKEGMERKDLLKANVAIFKTQGEALEKYAKKTVKVLVVGNPANTNCLIASKSAPSIPKENFSCLTRLDHNRARSQVAMRVGVPSDSVKNVTIWGNHSSTQYPDVHHAIVT-RNGKEIAAFDAVNDESWLKGDFISTVQQRGAAVIKARKLSSAMSAAKAICDHMRDIWFGTPDGEWVSMGIYSSGNSYGVPDDLMYSFPVKIKNKSWKVVDGLSINDFSRGKMDATAAELVEERDTALTFLS 332          
BLAST of Malate dehydrogenase vs. Ensembl Zebrafish
Match: mdh1aa (malate dehydrogenase 1Aa, NAD (soluble) [Source:ZFIN;Acc:ZDB-GENE-040204-1])

HSP 1 Score: 418.313 bits (1074), Expect = 1.617e-143
Identity = 215/330 (65.15%), Postives = 259/330 (78.48%), Query Frame = 3
Query:  168 PITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            PI V++TGAAGQI Y L++S+A G+VFG  QPI L LLDI  M+P L G++MEL+DCA P L  VI TD ++  F D+D A++VG+MPRKEGMERKDLLKANV IFK QGEAL+KYAKK+ KV VVGNPANTNCL+ SK APSIPKENFS LTRLDHNRA++Q+A + GVP D VK   IWGNHS+TQYPDV+H +V   +GKE++  DAV D++WLK DFI TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   EWVSM +YS G SYGVP D+++SFPV I +  W +V GL+I+DFSR K+D T  EL+EERD AL F S
Sbjct:   21 PIRVLVTGAAGQIAYSLLYSIAKGDVFGKDQPIILVLLDITPMLPVLDGVVMELQDCALPLLREVIPTDKVEVGFKDLDAAILVGSMPRKEGMERKDLLKANVAIFKTQGEALEKYAKKTVKVLVVGNPANTNCLIASKSAPSIPKENFSCLTRLDHNRARSQVAMRVGVPSDSVKNVTIWGNHSSTQYPDVHHAIVT-RNGKEIAAFDAVNDESWLKGDFISTVQQRGAAVIKARKLSSAMSAAKAICDHMRDIWFGTPDGEWVSMGIYSSGNSYGVPDDLMYSFPVKIKNKSWKVVDGLSINDFSRGKMDATAAELVEERDTALTFLS 349          
BLAST of Malate dehydrogenase vs. Ensembl Zebrafish
Match: mdh1ab (malate dehydrogenase 1Ab, NAD (soluble) [Source:ZFIN;Acc:ZDB-GENE-030131-7655])

HSP 1 Score: 384.03 bits (985), Expect = 1.893e-130
Identity = 205/331 (61.93%), Postives = 256/331 (77.34%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAF 1142
            M+ PI V++TGAAGQI Y L++ +A G+VFG  QP+ L LLDI  M+P L+G++MEL+DCA P L  VI TD    AF D+D A++VG+MPR+EGMERKDLLKANV IFK QGEALDKYAKK+ KV VVGNPANTNCL+ +K APSIPKENFS LTRLDHNRA +Q+A + G+  ++VK  +IWGNHS+TQYPDV+H  V+   GK+ +  DAVKDD WLK +FI TVQ RGAAVI ARKLSSA+SAAKA+    +D + GT   E++SM VYS G SYGVP+D+I+SFP++I    W IV GL I+DFS+ K++ T  EL+EERD AL+F
Sbjct:    1 MSEPIRVLVTGAAGQIAYSLLYGIAKGDVFGKDQPLVLLLLDITPMLPVLEGVVMELQDCALPLLREVIPTDKEDVAFKDLDAAILVGSMPRREGMERKDLLKANVAIFKSQGEALDKYAKKTVKVLVVGNPANTNCLIAAKSAPSIPKENFSCLTRLDHNRASSQVALRCGIAPNNVKNVIIWGNHSSTQYPDVHHCKVNVQ-GKDETAFDAVKDDAWLKGEFISTVQQRGAAVIKARKLSSAMSAAKAI---*QDIWTGTPEGEFISMGVYSTGNSYGVPEDLIYSFPISIKDKNWKIVDGLPINDFSKAKMEATAAELVEERDTALSF 327          
BLAST of Malate dehydrogenase vs. Ensembl Zebrafish
Match: mdh1aa (malate dehydrogenase 1Aa, NAD (soluble) [Source:ZFIN;Acc:ZDB-GENE-040204-1])

HSP 1 Score: 120.168 bits (300), Expect = 4.316e-32
Identity = 55/93 (59.14%), Postives = 71/93 (76.34%), Query Frame = 3
Query:  168 PITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGM 446
            PI V++TGAAGQI Y L++S+A G+VFG  QPI L LLDI  M+P L G++MEL+DCA P L  VI TD ++  F D+D A++VG+MPRKEGM
Sbjct:   21 PIRVLVTGAAGQIAYSLLYSIAKGDVFGKDQPIILVLLDITPMLPVLDGVVMELQDCALPLLREVIPTDKVEVGFKDLDAAILVGSMPRKEGM 113          
BLAST of Malate dehydrogenase vs. Ensembl Zebrafish
Match: mdh1b (malate dehydrogenase 1B, NAD (soluble) [Source:NCBI gene;Acc:767794])

HSP 1 Score: 109.383 bits (272), Expect = 3.686e-25
Identity = 85/332 (25.60%), Postives = 141/332 (42.47%), Query Frame = 3
Query:  168 PITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNP-ANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNH-------GLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGT--KEWVSMAVYSDGSYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQA 1133
            P+ + ++ A   + Y L+  + +  +F      +LHL+D       L+ L ME  D A P LH                        P  E  + ++        F   G+ ++  A+K  +V V G+   N  C ++ + APSI   NF A+T      A+ Q+A K  V    +   ++WGN S + + D+         G + G DG    + + + D  WLK DF   +    A + +    ++A+S   A+    + W +    +E  S+ V S G +G+P  ++FS PV+   G W +   + + D  R  LD    EL  ERD A
Sbjct:  138 PLHIWISSALNPVCYSLIPHLFTPGLFSGLPIFSLHLMDTSGSEEMLQALKMETVDLAIPRLHE-----------------------PAGEYNDEQNDKDQVAEHFHRYGQLIETNAQKDVRVLVAGDFFINMKCSLLIENAPSIDPRNFVAMTTQLEYEARTQLAQKLSVKTSDITNVIVWGNISGSFHIDLQRAKVFRYDGAIRGPDGFSQHVMEMIYDWKWLKTDFRSLLHKHRATISSKTNKATAISTTNAILAILKAWNNAESPEEVFSLGVLSTGQFGIPAGLVFSMPVSFTDGHWSVRSDVIVTDELRVNLDACADELRMERDMA 446          
BLAST of Malate dehydrogenase vs. Ensembl Xenopus
Match: mdh1 (malate dehydrogenase 1 [Source:NCBI gene;Acc:448318])

HSP 1 Score: 390.963 bits (1003), Expect = 8.221e-133
Identity = 208/333 (62.46%), Postives = 255/333 (76.58%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            M  P+ V++TGAAGQI Y L++ +A G+VFG  QP+ L LLDI  M+  L+G++MEL+DCA P L  VIATD    AF D+D A++VG+MPR+EGMERKDLLKANV IFK QG AL+KY+KKS KV VVGNPANTNCL   K APSIPKENFS LTRLDHNRA+ QIA K  V  D VK  +IWGNHS+TQYPD +H  V+   GK+V   +AVK+D WLK +FI TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   ++VSM V SDG SYG+P+D+++SFP+TI +  W IV+GL I+DFSR+K+DLT KEL EE++ AL F S
Sbjct:    1 MPEPVKVLVTGAAGQIAYSLLYGIAKGDVFGKDQPLILVLLDITPMMTVLEGVVMELQDCALPLLKEVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALNKYSKKSVKVIVVGNPANTNCLTAMKSAPSIPKENFSCLTRLDHNRAKGQIALKLNVASDDVKNVIIWGNHSSTQYPDASHATVNLQ-GKDVGAFEAVKNDDWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPDGQFVSMGVISDGNSYGIPEDLMYSFPLTIKNKTWKIVEGLPINDFSREKMDLTAKELHEEKETALEFLS 332          
BLAST of Malate dehydrogenase vs. Ensembl Xenopus
Match: mdh1 (malate dehydrogenase 1 [Source:NCBI gene;Acc:448318])

HSP 1 Score: 389.808 bits (1000), Expect = 2.412e-132
Identity = 207/330 (62.73%), Postives = 254/330 (76.97%), Query Frame = 3
Query:  168 PITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            P+ V++TGAAGQI Y L++ +A G+VFG  QP+ L LLDI  M+  L+G++MEL+DCA P L  VIATD    AF D+D A++VG+MPR+EGMERKDLLKANV IFK QG AL+KY+KKS KV VVGNPANTNCL   K APSIPKENFS LTRLDHNRA+ QIA K  V  D VK  +IWGNHS+TQYPD +H  V+   GK+V   +AVK+D WLK +FI TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   ++VSM V SDG SYG+P+D+++SFP+TI +  W IV+GL I+DFSR+K+DLT KEL EE++ AL F S
Sbjct:   10 PVKVLVTGAAGQIAYSLLYGIAKGDVFGKDQPLILVLLDITPMMTVLEGVVMELQDCALPLLKEVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALNKYSKKSVKVIVVGNPANTNCLTAMKSAPSIPKENFSCLTRLDHNRAKGQIALKLNVASDDVKNVIIWGNHSSTQYPDASHATVNLQ-GKDVGAFEAVKNDDWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPDGQFVSMGVISDGNSYGIPEDLMYSFPLTIKNKTWKIVEGLPINDFSREKMDLTAKELHEEKETALEFLS 338          
BLAST of Malate dehydrogenase vs. Ensembl Xenopus
Match: mdh1 (malate dehydrogenase 1 [Source:NCBI gene;Acc:448318])

HSP 1 Score: 389.423 bits (999), Expect = 2.606e-132
Identity = 207/330 (62.73%), Postives = 254/330 (76.97%), Query Frame = 3
Query:  168 PITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            P+ V++TGAAGQI Y L++ +A G+VFG  QP+ L LLDI  M+  L+G++MEL+DCA P L  VIATD    AF D+D A++VG+MPR+EGMERKDLLKANV IFK QG AL+KY+KKS KV VVGNPANTNCL   K APSIPKENFS LTRLDHNRA+ QIA K  V  D VK  +IWGNHS+TQYPD +H  V+   GK+V   +AVK+D WLK +FI TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   ++VSM V SDG SYG+P+D+++SFP+TI +  W IV+GL I+DFSR+K+DLT KEL EE++ AL F S
Sbjct:    5 PVKVLVTGAAGQIAYSLLYGIAKGDVFGKDQPLILVLLDITPMMTVLEGVVMELQDCALPLLKEVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALNKYSKKSVKVIVVGNPANTNCLTAMKSAPSIPKENFSCLTRLDHNRAKGQIALKLNVASDDVKNVIIWGNHSSTQYPDASHATVNLQ-GKDVGAFEAVKNDDWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPDGQFVSMGVISDGNSYGIPEDLMYSFPLTIKNKTWKIVEGLPINDFSREKMDLTAKELHEEKETALEFLS 333          
BLAST of Malate dehydrogenase vs. Ensembl Xenopus
Match: mdh1 (malate dehydrogenase 1 [Source:NCBI gene;Acc:448318])

HSP 1 Score: 390.193 bits (1001), Expect = 2.679e-132
Identity = 209/333 (62.76%), Postives = 256/333 (76.88%), Query Frame = 3
Query:  162 TP-PITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            TP P+ V++TGAAGQI Y L++ +A G+VFG  QP+ L LLDI  M+  L+G++MEL+DCA P L  VIATD    AF D+D A++VG+MPR+EGMERKDLLKANV IFK QG AL+KY+KKS KV VVGNPANTNCL   K APSIPKENFS LTRLDHNRA+ QIA K  V  D VK  +IWGNHS+TQYPD +H  V+   GK+V   +AVK+D WLK +FI TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   ++VSM V SDG SYG+P+D+++SFP+TI +  W IV+GL I+DFSR+K+DLT KEL EE++ AL F S
Sbjct:   17 TPEPVKVLVTGAAGQIAYSLLYGIAKGDVFGKDQPLILVLLDITPMMTVLEGVVMELQDCALPLLKEVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALNKYSKKSVKVIVVGNPANTNCLTAMKSAPSIPKENFSCLTRLDHNRAKGQIALKLNVASDDVKNVIIWGNHSSTQYPDASHATVNLQ-GKDVGAFEAVKNDDWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPDGQFVSMGVISDGNSYGIPEDLMYSFPLTIKNKTWKIVEGLPINDFSREKMDLTAKELHEEKETALEFLS 348          
BLAST of Malate dehydrogenase vs. Ensembl Xenopus
Match: mdh1 (malate dehydrogenase 1 [Source:NCBI gene;Acc:448318])

HSP 1 Score: 379.793 bits (974), Expect = 1.503e-128
Identity = 203/329 (61.70%), Postives = 250/329 (75.99%), Query Frame = 3
Query:  171 ITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            +T+    +AGQI Y L++ +A G+VFG  QP+ L LLDI  M+  L+G++MEL+DCA P L  VIATD    AF D+D A++VG+MPR+EGMERKDLLKANV IFK QG AL+KY+KKS KV VVGNPANTNCL   K APSIPKENFS LTRLDHNRA+ QIA K  V  D VK  +IWGNHS+TQYPD +H  V+   GK+V   +AVK+D WLK +FI TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   ++VSM V SDG SYG+P+D+++SFP+TI +  W IV+GL I+DFSR+K+DLT KEL EE++ AL F S
Sbjct:    2 LTLFFLPSAGQIAYSLLYGIAKGDVFGKDQPLILVLLDITPMMTVLEGVVMELQDCALPLLKEVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALNKYSKKSVKVIVVGNPANTNCLTAMKSAPSIPKENFSCLTRLDHNRAKGQIALKLNVASDDVKNVIIWGNHSSTQYPDASHATVNLQ-GKDVGAFEAVKNDDWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPDGQFVSMGVISDGNSYGIPEDLMYSFPLTIKNKTWKIVEGLPINDFSREKMDLTAKELHEEKETALEFLS 329          
BLAST of Malate dehydrogenase vs. Ensembl Mouse
Match: Mdh1 (malate dehydrogenase 1, NAD (soluble) [Source:MGI Symbol;Acc:MGI:97051])

HSP 1 Score: 408.683 bits (1049), Expect = 5.750e-140
Identity = 217/333 (65.17%), Postives = 259/333 (77.78%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            M+ PI V++TGAAGQI Y L++S+ +G+VFG  QPI L LLDI  M+  L G++MEL+DCA P L  VIATD  + AF D+D A++VG+MPR+EGMERKDLLKANV IFK QG AL+KYAKKS KV VVGNPANTNCL  SK APSIPKENFS LTRLDHNRA++QIA K GV  D VK  +IWGNHS+TQYPDVNH  V    GKEV + +A+KDD+WLK +FI TVQ RGAAVI ARKLSSA+SAAKA+ADH RD + GT   E+VSM V SDG SYGVP D+++SFPV I +  W  V+GL I+DFSR+K+DLT KEL EE++ A  F S
Sbjct:    1 MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIATDKEEIAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGTALEKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKNVIIWGNHSSTQYPDVNHAKVKLQ-GKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAIADHIRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKETAFEFLS 332          
BLAST of Malate dehydrogenase vs. Ensembl Mouse
Match: Mdh1 (malate dehydrogenase 1, NAD (soluble) [Source:MGI Symbol;Acc:MGI:97051])

HSP 1 Score: 408.683 bits (1049), Expect = 5.750e-140
Identity = 217/333 (65.17%), Postives = 259/333 (77.78%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            M+ PI V++TGAAGQI Y L++S+ +G+VFG  QPI L LLDI  M+  L G++MEL+DCA P L  VIATD  + AF D+D A++VG+MPR+EGMERKDLLKANV IFK QG AL+KYAKKS KV VVGNPANTNCL  SK APSIPKENFS LTRLDHNRA++QIA K GV  D VK  +IWGNHS+TQYPDVNH  V    GKEV + +A+KDD+WLK +FI TVQ RGAAVI ARKLSSA+SAAKA+ADH RD + GT   E+VSM V SDG SYGVP D+++SFPV I +  W  V+GL I+DFSR+K+DLT KEL EE++ A  F S
Sbjct:    1 MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIATDKEEIAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGTALEKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKNVIIWGNHSSTQYPDVNHAKVKLQ-GKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAIADHIRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKETAFEFLS 332          
BLAST of Malate dehydrogenase vs. Ensembl Mouse
Match: Mdh1 (malate dehydrogenase 1, NAD (soluble) [Source:MGI Symbol;Acc:MGI:97051])

HSP 1 Score: 409.068 bits (1050), Expect = 9.703e-140
Identity = 217/333 (65.17%), Postives = 259/333 (77.78%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            M+ PI V++TGAAGQI Y L++S+ +G+VFG  QPI L LLDI  M+  L G++MEL+DCA P L  VIATD  + AF D+D A++VG+MPR+EGMERKDLLKANV IFK QG AL+KYAKKS KV VVGNPANTNCL  SK APSIPKENFS LTRLDHNRA++QIA K GV  D VK  +IWGNHS+TQYPDVNH  V    GKEV + +A+KDD+WLK +FI TVQ RGAAVI ARKLSSA+SAAKA+ADH RD + GT   E+VSM V SDG SYGVP D+++SFPV I +  W  V+GL I+DFSR+K+DLT KEL EE++ A  F S
Sbjct:    1 MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIATDKEEIAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGTALEKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKNVIIWGNHSSTQYPDVNHAKVKLQ-GKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAIADHIRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKETAFEFLS 332          
BLAST of Malate dehydrogenase vs. Ensembl Mouse
Match: Mdh1 (malate dehydrogenase 1, NAD (soluble) [Source:MGI Symbol;Acc:MGI:97051])

HSP 1 Score: 213.001 bits (541), Expect = 2.737e-66
Identity = 104/155 (67.10%), Postives = 123/155 (79.35%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSAL 623
            M+ PI V++TGAAGQI Y L++S+ +G+VFG  QPI L LLDI  M+  L G++MEL+DCA P L  VIATD  + AF D+D A++VG+MPR+EGMERKDLLKANV IFK QG AL+KYAKKS KV VVGNPANTNCL  SK APSIPKENFS L
Sbjct:    1 MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIATDKEEIAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGTALEKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCL 155          
BLAST of Malate dehydrogenase vs. Ensembl Mouse
Match: Mdh1b (malate dehydrogenase 1B, NAD (soluble) [Source:MGI Symbol;Acc:MGI:1923918])

HSP 1 Score: 127.102 bits (318), Expect = 5.144e-31
Identity = 90/333 (27.03%), Postives = 162/333 (48.65%), Query Frame = 3
Query:  156 NMTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVG-NPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHD-------GKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDGSYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEER 1124
            ++  P+ V +  A   +   L+  + SG VFG H  I+L L D       L+ ++ME +D A P L +V     +KEAF      +++     +E    +  L++ V + ++ G  ++K A KS KV V G N  N    ++ +YAP+I   N  A+      +A+A +A K      ++K  +IWGN +   Y D+    V+ ++       G   S+   + D  W+  +F++T++   +      K    + AA ++A   + W+HG+   E VS+ V S+G + +P+ ++FS PV  ++G W ++  L     S + L     +LI+E+
Sbjct:  127 DLISPLQVWIASAGTYVCCHLIPLLLSGEVFGMHTEISLTLFDQEQREDCLRSIVMETQDLASPVLRTVSFCTTVKEAFLQAQVIIILDDSTEEEVYSLESCLRSRVPLCRLYGYLIEKNAHKSVKVIVGGKNFVNLKTTLLMQYAPNIAS-NIIAVALGVEGQAKAVLARKMKTTSANIKDVIIWGNITGNNYVDLRKAKVYNYESAVKGPPGHYHSVLSLIFDREWITKEFVQTLKILSST----GKQFGGILAAHSIATTLKYWYHGSPPGEIVSLGVMSEGQFDIPEGIVFSMPVKFENGTWVVLTDLEDISLSEKTLSRLTGDLIQEK 454          
BLAST of Malate dehydrogenase vs. UniProt/SwissProt
Match: sp|O88989|MDHC_RAT (Malate dehydrogenase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Mdh1 PE=1 SV=3)

HSP 1 Score: 409.068 bits (1050), Expect = 2.903e-139
Identity = 216/333 (64.86%), Postives = 259/333 (77.78%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            M+ PI V++TGAAGQI Y L++S+ +G+VFG  QPI L LLDI  M+  L G++MEL+DCA P L  VIATD  + AF D+D A++VG+MPR+EGMERKDLLKANV IFK QG AL+KYAKKS KV VVGNPANTNCL  SK APSIPKENFS LTRLDHNRA++QIA K GV  D VK  +IWGNHS+TQYPDVNH  V    GKEV + +A+KDD+WLK +FI TVQ RGAAVI ARKLSSA+SAAKA++DH RD + GT   E+VSM V SDG SYGVP D+++SFPV I +  W  V+GL I+DFSR+K+DLT KEL EE++ A  F S
Sbjct:    1 MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIATDKEEVAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGAALEKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKNVIIWGNHSSTQYPDVNHAKVKLQ-GKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAISDHIRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKETAFEFLS 332          
BLAST of Malate dehydrogenase vs. UniProt/SwissProt
Match: sp|P14152|MDHC_MOUSE (Malate dehydrogenase, cytoplasmic OS=Mus musculus OX=10090 GN=Mdh1 PE=1 SV=3)

HSP 1 Score: 408.683 bits (1049), Expect = 4.022e-139
Identity = 217/333 (65.17%), Postives = 259/333 (77.78%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            M+ PI V++TGAAGQI Y L++S+ +G+VFG  QPI L LLDI  M+  L G++MEL+DCA P L  VIATD  + AF D+D A++VG+MPR+EGMERKDLLKANV IFK QG AL+KYAKKS KV VVGNPANTNCL  SK APSIPKENFS LTRLDHNRA++QIA K GV  D VK  +IWGNHS+TQYPDVNH  V    GKEV + +A+KDD+WLK +FI TVQ RGAAVI ARKLSSA+SAAKA+ADH RD + GT   E+VSM V SDG SYGVP D+++SFPV I +  W  V+GL I+DFSR+K+DLT KEL EE++ A  F S
Sbjct:    1 MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIATDKEEIAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGTALEKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKNVIIWGNHSSTQYPDVNHAKVKLQ-GKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAIADHIRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKETAFEFLS 332          
BLAST of Malate dehydrogenase vs. UniProt/SwissProt
Match: sp|P11708|MDHC_PIG (Malate dehydrogenase, cytoplasmic OS=Sus scrofa OX=9823 GN=MDH1 PE=1 SV=4)

HSP 1 Score: 408.683 bits (1049), Expect = 4.633e-139
Identity = 218/333 (65.47%), Postives = 258/333 (77.48%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            M+ PI V++TGAAGQI Y L++S+ +G+VFG  QPI L LLDI  M+  L G++MEL+DCA P L  VIATD  + AF D+D A++VG+MPR++GMERKDLLKANV IFK QG ALDKYAKKS KV VVGNPANTNCL  SK APSIPKENFS LTRLDHNRA+AQIA K GV  D VK  +IWGNHS+TQYPDVNH  V     KEV + +AVKDD+WLK +FI TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   E+VSM + SDG SYGVP D+++SFPVTI    W IV+GL I+DFSR+K+DLT KEL EE++ A  F S
Sbjct:    1 MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEEIAFKDLDVAILVGSMPRRDGMERKDLLKANVKIFKCQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTSDDVKNVIIWGNHSSTQYPDVNHAKVKLQ-AKEVGVYEAVKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGIISDGNSYGVPDDLLYSFPVTIKDKTWKIVEGLPINDFSREKMDLTAKELAEEKETAFEFLS 332          
BLAST of Malate dehydrogenase vs. UniProt/SwissProt
Match: sp|Q7YRU4|MDHC_FELCA (Malate dehydrogenase, cytoplasmic OS=Felis catus OX=9685 GN=MDH1 PE=2 SV=3)

HSP 1 Score: 407.527 bits (1046), Expect = 1.375e-138
Identity = 216/333 (64.86%), Postives = 260/333 (78.08%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDGS-YGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            M+ PI V++TGAAGQI Y L++S+ +G+VFG  QPI L LLDI  M+  L G++MEL+DCA P L  VIATD    AF D+D A++VG+MPR++GMERKDLLKANV IFK QG AL+KYAKKS KV VVGNPANTNCL   K APSIPKENFS LTRLDHNRA+AQIA K GV  D VK  +IWGNHS+TQYPDV+H  V  H GKEV + DA+KDD+WLK +FI TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   E+VSM + SDG+ YGVP D+++SFPVTI +  W +V+GLTI+DFSR+K+DLT KEL EE++ A  F S
Sbjct:    1 MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRRDGMERKDLLKANVKIFKCQGAALEKYAKKSVKVIVVGNPANTNCLTACKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTSDDVKNVIIWGNHSSTQYPDVSHAKVKLH-GKEVGVYDALKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGIISDGNPYGVPDDLLYSFPVTIKNKTWKVVEGLTINDFSREKMDLTAKELAEEKETAFEFLS 332          
BLAST of Malate dehydrogenase vs. UniProt/SwissProt
Match: sp|P40925|MDHC_HUMAN (Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1 PE=1 SV=4)

HSP 1 Score: 407.142 bits (1045), Expect = 1.516e-138
Identity = 216/333 (64.86%), Postives = 257/333 (77.18%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            M+ PI V++TGAAGQI Y L++S+ +G+VFG  QPI L LLDI  M+  L G++MEL+DCA P L  VIATD    AF D+D A++VG+MPR+EGMERKDLLKANV IFK QG ALDKYAKKS KV VVGNPANTNCL  SK APSIPKENFS LTRLDHNRA+AQIA K GV  + VK  +IWGNHS+TQYPDVNH  V    GKEV + +A+KDD+WLK +F+ TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   E+VSM V SDG SYGVP D+++SFPV I +  W  V+GL I+DFSR+K+DLT KEL EE++ A  F S
Sbjct:    1 MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQ-GKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLS 332          
BLAST of Malate dehydrogenase vs. TrEMBL
Match: A0A1W5YLL5 (Malate dehydrogenase OS=Leptinotarsa decemlineata OX=7539 GN=MDH PE=2 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 4.253e-143
Identity = 218/331 (65.86%), Postives = 264/331 (79.76%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDGSYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFC 1145
            M+ PI VV+TGAAGQI Y L++ +A G+VFGP+QP+ L+LLDIP M+  L+G++MEL DCA P LH VI TDD   AFTDV  A +VGAMPRK+GMERKDLL ANV IFKVQGEALDKYA+K  KV VVGNPANTN L+ SKYAPSIP+ENF+A+TRLD NRAQAQIAAK GVP  +V   +IWGNHS+TQ+PD +H +V   D K++   +AVKDD W+++ F++TVQ RGA VIAARK+SSA+SAAKA +DH RDWF GT    +VSM V SDGSYG PKDV+FSFPVTI +GKW IVQGL IDDF+ + L++TGKEL EER +A+A  
Sbjct:    1 MSEPIKVVVTGAAGQIAYSLLYMIAKGDVFGPNQPLILYLLDIPPMMGVLEGVVMELADCAIPLLHGVIPTDDPVVAFTDVSAAFLVGAMPRKQGMERKDLLSANVKIFKVQGEALDKYARKDVKVLVVGNPANTNALICSKYAPSIPRENFTAMTRLDQNRAQAQIAAKIGVPVGNVNNLIIWGNHSSTQFPDASHAVVQ-IDSKQLKATEAVKDDNWIRSTFVETVQKRGATVIAARKMSSAMSAAKAASDHMRDWFLGTAPGHFVSMGVVSDGSYGAPKDVVFSFPVTIKNGKWEIVQGLPIDDFATKMLNITGKELEEERLEAIAII 330          
BLAST of Malate dehydrogenase vs. TrEMBL
Match: A0A482VY42 (Malate dehydrogenase OS=Asbolus verrucosus OX=1661398 GN=BDFB_004295 PE=3 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 1.540e-142
Identity = 216/326 (66.26%), Postives = 259/326 (79.45%), Query Frame = 3
Query:  168 PITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDGSYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALA 1139
            PI VV+TGAAGQI Y L++ +A G+VFG  QP+ LHLLDIP M+  L+G++MEL DCA P L SV+ TDD   AF DV  A +VGAMPRK+GMERKDLL ANV IFKVQGEALDK+AKK  KV VVGNPANTN L+ S+YAPSIPKENF+A+TRLD NRAQAQIAAK  VP   V   +IWGNHS+TQ+PD +HG VH   GK++  +DAV DD WL+  F++TVQ RGAAVI ARK+SSA+SAAKA  DH RDWF+GT   ++VSM V SDGSYG PKDV+FSFPV+I +GKW IVQGL  DDF+++ LD+TGKEL+EER +A+A
Sbjct:    5 PIRVVVTGAAGQIAYSLLYMIAKGDVFGSEQPLILHLLDIPPMMGVLEGVVMELSDCALPLLRSVVPTDDPVVAFKDVAAAFLVGAMPRKQGMERKDLLSANVKIFKVQGEALDKHAKKDVKVLVVGNPANTNALICSRYAPSIPKENFTAMTRLDQNRAQAQIAAKVNVPVASVSNVIIWGNHSSTQFPDASHGTVH-MAGKDIPARDAVGDDVWLRTAFVETVQKRGAAVINARKMSSAMSAAKAAGDHMRDWFNGTPPGKFVSMGVISDGSYGAPKDVVFSFPVSIKNGKWEIVQGLVTDDFAKELLDVTGKELLEERAEAIA 329          
BLAST of Malate dehydrogenase vs. TrEMBL
Match: A0A3B4DZ11 (Malate dehydrogenase OS=Pygocentrus nattereri OX=42514 PE=3 SV=1)

HSP 1 Score: 421.009 bits (1081), Expect = 1.966e-141
Identity = 222/331 (67.07%), Postives = 261/331 (78.85%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGT--KEWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAF 1142
            M  PI V++TGAAGQI Y L++S+A G+VFG  QPI L LLDIP M+P L G++MEL+DCA P L  VI TD ++ AF D+D A++VG+MPRKEGMERKDLLKANV IFK QG ALDKYAKK+ KV VVGNPANTNCL+ SK APSIPKENFS LTRLDHNRA++Q+A + GV  D VK  +IWGNHS+TQYPDV+H +V  H GKEV+  DAVKDDTWLK DFI TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   E+VSM VYS G SYGVP D+++SFPV I +  W +V GL I+DFSR K+D T  ELIEERD AL+F
Sbjct:    1 MAEPIRVLVTGAAGQIAYSLLYSIAKGDVFGKDQPIILVLLDIPPMLPVLDGVVMELQDCALPLLREVIPTDKVEVAFKDLDAAILVGSMPRKEGMERKDLLKANVAIFKTQGAALDKYAKKTVKVLVVGNPANTNCLIASKSAPSIPKENFSCLTRLDHNRARSQVAIRVGVSSDKVKNVIIWGNHSSTQYPDVHHAMVDLH-GKEVAAFDAVKDDTWLKGDFISTVQQRGAAVIKARKLSSAMSAAKAICDHMRDIWFGTLDGEFVSMGVYSTGNSYGVPDDLMYSFPVMIKNKSWKVVDGLPINDFSRGKMDATAAELIEERDTALSF 330          
BLAST of Malate dehydrogenase vs. TrEMBL
Match: E0VFB4 (Malate dehydrogenase OS=Pediculus humanus subsp. corporis OX=121224 GN=8236460 PE=3 SV=1)

HSP 1 Score: 420.624 bits (1080), Expect = 3.546e-141
Identity = 211/329 (64.13%), Postives = 258/329 (78.42%), Query Frame = 3
Query:  168 PITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTKE--WVSMAVYSDGSYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            PI VV+TGAAGQI Y L++ +A G+VFGP+QP+ LHLLDIP M+  L+G++MEL DCA P L+ ++ T D   AF DVD A +VGAMPRKEGMERKDLL ANV IFK+QGEALDK+AKK+ KV VVGNPANTN L+ SK+APSIPKENFSA+TRLD NRA AQIA K GVP  +VK  ++WGNHS+TQYPDV H  VH      V + DAV D  WL+ +F+ T+Q RGAAVI+ARK+SSA+SAAKA  DH +D +HGT+   WVSM V SDGSYG+PKD++FSFPVTI++  W IVQGL +D FS+ KL+LT KEL+EER +AL  C+
Sbjct:   14 PIRVVVTGAAGQIAYSLLYQIAHGDVFGPNQPLILHLLDIPPMMGVLEGVVMELTDCALPLLYEIVPTADPGVAFKDVDAAFLVGAMPRKEGMERKDLLSANVKIFKIQGEALDKFAKKTVKVLVVGNPANTNALICSKFAPSIPKENFSAMTRLDQNRASAQIALKLGVPISNVKNVIVWGNHSSTQYPDVFHATVHKQGSNPVPVYDAVNDTKWLQENFVTTIQKRGAAVISARKMSSAMSAAKAAGDHMKDIWHGTQPGCWVSMGVVSDGSYGIPKDIVFSFPVTIENKNWKIVQGLNLDGFSKGKLELTAKELLEERQEALEVCN 342          
BLAST of Malate dehydrogenase vs. TrEMBL
Match: C0H820 (Malate dehydrogenase OS=Salmo salar OX=8030 GN=MDHC PE=2 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 3.903e-141
Identity = 217/333 (65.17%), Postives = 265/333 (79.58%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGT--KEWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            M  PI V++TGAAGQI Y L++S+A G+VFG  QPI L LLDIP M+P L G++MEL+DCA P L  VI TD ++  F D+D A++VG+MPRKEGMERKDLLKANV IFK QG AL+KYAKK+ +V VVGNPANTNCL+ SK APSIPKENFS LTRLDHNRA++Q+A + GVP D VK  +IWGNHS+TQYPDV+H +V+ H GKEV   DAVKDD+WLK DFI TVQ RGAAVI ARKLSSA+SAAKA++DH RDW+ GT   E++SM VY+ G SYG+P+D+I+SFPV I +  W+I  GL ++DFSR K+D T  EL+EERD AL+F S
Sbjct:    1 MADPIRVLVTGAAGQIAYSLLYSIAKGDVFGKDQPIILVLLDIPPMLPVLDGVVMELQDCALPLLREVIPTDKVEVGFKDLDAAILVGSMPRKEGMERKDLLKANVAIFKTQGAALEKYAKKTVRVLVVGNPANTNCLIASKSAPSIPKENFSCLTRLDHNRARSQVAMRCGVPADAVKNVIIWGNHSSTQYPDVHHAMVNVH-GKEVKAYDAVKDDSWLKGDFISTVQLRGAAVIKARKLSSAMSAAKAISDHMRDWWFGTLDGEFMSMGVYAGGNSYGIPEDLIYSFPVHIKNKSWNIHDGLPVNDFSRAKMDATAAELVEERDTALSFLS 332          
BLAST of Malate dehydrogenase vs. Ensembl Cavefish
Match: mdh1aa (malate dehydrogenase, cytoplasmic [Source:NCBI gene;Acc:103036835])

HSP 1 Score: 411.764 bits (1057), Expect = 2.693e-141
Identity = 217/331 (65.56%), Postives = 258/331 (77.95%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAF 1142
            M  PI V++TGAAGQI Y L++S+A G+VFG  QPI L LLDIP M+P L G++MEL+DCA P L  VI TD ++  F D+D A++VG+MPRKEGMERKDLLKANV IFK QG AL+KYAKK+ KV VVGNPANTNCL+ SK APSIPKENFS LTRLDHNRA++Q+A + GV  D VK  +IWGNHS+TQYPDV+H  V+ H GKEV   DAVKDD+WLK DFI TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   E+VSM VYS G SYGV  D+++SFPV I +  W +V GL I+DFSR K+D T  ELIEERD A++F
Sbjct:    1 MAEPIRVLVTGAAGQIAYSLLYSIAKGDVFGKDQPIILVLLDIPPMLPVLDGVVMELQDCALPLLREVIPTDKVEVGFKDLDAAILVGSMPRKEGMERKDLLKANVAIFKTQGAALEKYAKKTVKVLVVGNPANTNCLIASKSAPSIPKENFSCLTRLDHNRARSQVAMRVGVSSDKVKNVIIWGNHSSTQYPDVHHATVNQH-GKEVPAYDAVKDDSWLKADFISTVQQRGAAVIKARKLSSAMSAAKAICDHMRDIWFGTPDGEFVSMGVYSSGNSYGVADDLMYSFPVMIKNKSWKVVDGLPINDFSRGKMDATAAELIEERDTAVSF 330          
BLAST of Malate dehydrogenase vs. Ensembl Cavefish
Match: mdh1aa (malate dehydrogenase, cytoplasmic [Source:NCBI gene;Acc:103036835])

HSP 1 Score: 411.764 bits (1057), Expect = 5.922e-141
Identity = 216/328 (65.85%), Postives = 257/328 (78.35%), Query Frame = 3
Query:  168 PITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAF 1142
            PI V++TGAAGQI Y L++S+A G+VFG  QPI L LLDIP M+P L G++MEL+DCA P L  VI TD ++  F D+D A++VG+MPRKEGMERKDLLKANV IFK QG AL+KYAKK+ KV VVGNPANTNCL+ SK APSIPKENFS LTRLDHNRA++Q+A + GV  D VK  +IWGNHS+TQYPDV+H  V+ H GKEV   DAVKDD+WLK DFI TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   E+VSM VYS G SYGV  D+++SFPV I +  W +V GL I+DFSR K+D T  ELIEERD A++F
Sbjct:   21 PIRVLVTGAAGQIAYSLLYSIAKGDVFGKDQPIILVLLDIPPMLPVLDGVVMELQDCALPLLREVIPTDKVEVGFKDLDAAILVGSMPRKEGMERKDLLKANVAIFKTQGAALEKYAKKTVKVLVVGNPANTNCLIASKSAPSIPKENFSCLTRLDHNRARSQVAMRVGVSSDKVKNVIIWGNHSSTQYPDVHHATVNQH-GKEVPAYDAVKDDSWLKADFISTVQQRGAAVIKARKLSSAMSAAKAICDHMRDIWFGTPDGEFVSMGVYSSGNSYGVADDLMYSFPVMIKNKSWKVVDGLPINDFSRGKMDATAAELIEERDTAVSF 347          
BLAST of Malate dehydrogenase vs. Ensembl Cavefish
Match: mdh1ab (malate dehydrogenase, cytoplasmic [Source:NCBI gene;Acc:103033607])

HSP 1 Score: 408.683 bits (1049), Expect = 5.304e-140
Identity = 215/331 (64.95%), Postives = 261/331 (78.85%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDGS-YGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAF 1142
            M   I V++TGAAGQI Y L++S+A G+VFG  QP+ L LLDIP M+P L+G++MEL+DCA P L  VI TD  + AF D+D A++VG+MPRKEGMERKDLLKANV IFK QG ALDKYAKK+ KV VVGNPANTNCLV +K APSIPKENFS LTRLDHNRA++Q+A + G+P D+VK  +IWGNHS+TQYPDV+H +V    GK+V+  D VKDD WLK DFI TVQ RGAAVI ARKLSSA+SAAKA+ DH RD ++GT   E++SM VYS G+ YGVP+D+I+SFPVTI    W IV GL I+DFSR K+D T  EL+EERD A++F
Sbjct:    1 MAETIRVLVTGAAGQIAYSLLYSIAKGDVFGRDQPLVLVLLDIPPMLPVLEGVVMELQDCALPILKEVIPTDKEEVAFKDLDAAILVGSMPRKEGMERKDLLKANVAIFKSQGAALDKYAKKTVKVLVVGNPANTNCLVAAKSAPSIPKENFSCLTRLDHNRARSQVAMRCGIPADNVKNVIIWGNHSSTQYPDVHHCMV-SVGGKDVAAFDMVKDDDWLKGDFISTVQQRGAAVIKARKLSSAMSAAKAICDHMRDIWNGTPEGEFISMGVYSTGNPYGVPEDLIYSFPVTIKDKSWKIVDGLAINDFSRAKMDATAAELVEERDTAVSF 330          
BLAST of Malate dehydrogenase vs. Ensembl Cavefish
Match: mdh1aa (malate dehydrogenase 1Aa, NAD (soluble) [Source:ZFIN;Acc:ZDB-GENE-040204-1])

HSP 1 Score: 372.089 bits (954), Expect = 4.286e-126
Identity = 198/298 (66.44%), Postives = 233/298 (78.19%), Query Frame = 3
Query:  258 QPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAF 1142
            QPI L LLDIP M+P L G++MEL+DCA P L  VI TD ++  F D+D A++VG+MPRKEGMERKDLLKANV IFK QG AL+KYAKK+ KV VVGNPANTNCL+ SK APSIPKENFS LTRLDHNRA++Q+A + GV  D VK  +IWGNHS+TQYPDV+H  V+ H GKEV   DAVKDD+WLK DFI TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   E+VSM VYS G SYGV  D+++SFPV I +  W +V GL I+DFSR K+D T  ELIEERD A++F
Sbjct:    7 QPIILVLLDIPPMLPVLDGVVMELQDCALPLLREVIPTDKVEVGFKDLDAAILVGSMPRKEGMERKDLLKANVAIFKTQGAALEKYAKKTVKVLVVGNPANTNCLIASKSAPSIPKENFSCLTRLDHNRARSQVAMRVGVSSDKVKNVIIWGNHSSTQYPDVHHATVNQH-GKEVPAYDAVKDDSWLKADFISTVQQRGAAVIKARKLSSAMSAAKAICDHMRDIWFGTPDGEFVSMGVYSSGNSYGVADDLMYSFPVMIKNKSWKVVDGLPINDFSRGKMDATAAELIEERDTAVSF 303          
BLAST of Malate dehydrogenase vs. Ensembl Cavefish
Match: mdh1b (malate dehydrogenase 1B [Source:NCBI gene;Acc:103037214])

HSP 1 Score: 137.887 bits (346), Expect = 7.149e-35
Identity = 95/334 (28.44%), Postives = 154/334 (46.11%), Query Frame = 3
Query:  177 VVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRK-----EGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNP-ANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNH-------GLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWF--HGTKEWVSMAVYSDGSYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQA 1133
            + +TGA     Y L+  + +  +      I+LHLLD+     SL GL ME ED A   LH V    D+  AF   D  L +   P       E  ++  ++      F+  G  ++  A+K  +V V G+   N  C ++ + APS+    F A+T      A+AQ+A K  V    +   ++WGN S + + D+         G + G  G    + + + D  WL+ DF+  V  R  A+      ++A SA   +      W   + ++E  S+ V S G++GVP  ++FS PV   +G W +   +TI+D  R KL +   EL+ E++ A
Sbjct:  134 IWITGALSPTCYSLIPKLFTTELIRDISTISLHLLDVNSSEESLLGLKMETEDLALSQLHEVTVHSDMTWAFQSADLILFLDDWPSNSETPVEQGDKDHMVSQVAERFRSYGRLVEANAQKDVRVMVAGDSYVNLKCSLLIENAPSVDPCRFVAMTTQLEYEARAQLAEKLSVKTTDITDIIVWGNISGSSHVDLQRAKVFRYKGSIWGPTGFSQQVLEMIYDKKWLETDFLSLVALRRRAISLKTNRTAANSATNGILAVLNAWSNCYSSREVFSLGVVSSGNFGVPAGLVFSVPVKFHNGDWSVCSDITINDELRSKLGVAINELLVEKNTA 467          
BLAST of Malate dehydrogenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007050.1 (pep scaffold:Pmarinus_7.0:GL479360:144570:153551:-1 gene:ENSPMAG00000006369.1 transcript:ENSPMAT00000007050.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 229.18 bits (583), Expect = 3.842e-73
Identity = 108/167 (64.67%), Postives = 135/167 (80.84%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQI 659
            MT  + V++TGAAGQI Y L++S+ASGNVFG  QPI+L LLDI  M+  L+G++MEL+DCA P L  VIATD  + AF D+D A++VG+MPR+EGMERKDLLKANV IFK QG AL+KY+KK+ KV VVGNPANTNCL+  K A +IP+ENF+ LTRLDHNRA +Q+
Sbjct:    1 MTGTVKVLVTGAAGQIAYSLLYSIASGNVFGKDQPISLVLLDITPMLGVLEGVVMELQDCALPLLKEVIATDKEEVAFKDLDAAILVGSMPRREGMERKDLLKANVRIFKSQGAALNKYSKKTVKVLVVGNPANTNCLIALKSALTIPRENFTCLTRLDHNRAVSQV 167          
BLAST of Malate dehydrogenase vs. Ensembl Sea Lamprey
Match: mdh1b (malate dehydrogenase 1B, NAD (soluble) [Source:NCBI gene;Acc:767794])

HSP 1 Score: 117.087 bits (292), Expect = 1.762e-28
Identity = 91/337 (27.00%), Postives = 155/337 (45.99%), Query Frame = 3
Query:  156 NMTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVG-NPANTNC-LVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGK------EVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGT--KEWVSMAVYSDGSYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQAL 1136
             ++ P  V +TGA       L+  + +G + G    +++ LL       +L+ +  +  D A   L  V    D + AF      +++  +    G E  D   A   +    G AL + A    +V V     AN    L+ +  AP +P+ NF AL+     RA+  +AAK  V    V+  V+WG+   + Y  ++   + G+DG          + + + D  WL+N+F   +Q RG+    A+   +  +   A+A   R WFHG+  ++  S+AV S+G YG+ + ++FS PV  + G W +V  L++ D  R ++     EL E R QA+
Sbjct:  128 ELSRPFHVCITGANSACVPGLLWLLGTGELCGGSTGLSVCLLGKVGEQEALRCVRQDTLDMACAALRDVTIHSDPELAFDGAGLVIVLDNVAPGLGQEWSD---AGAPLCAAYGSALGRRAGPDVRVLVAAAKGANLRAQLLATAAAPHVPRRNFVALSTHLERRAKGLLAAKLKVNSAGVEDVVVWGDAGGSTYTQLSAARLRGYDGAVWGPGLTYPLLEVLNDREWLENEFPAALQARGSLQAKAQGYPATTALNAAIASTLRLWFHGSDDQQIHSLAVPSNGEYGLLQGLVFSLPVRFEGGDWSVVSDLSLTDAERSRIHAIAAELQEVRVQAV 461          
BLAST of Malate dehydrogenase vs. Ensembl Yeast
Match: MDH1 (Mitochondrial malate dehydrogenase; catalyzes interconversion of malate and oxaloacetate; involved in the tricarboxylic acid (TCA) cycle; phosphorylated [Source:SGD;Acc:S000001568])

HSP 1 Score: 49.6766 bits (117), Expect = 6.158e-7
Identity = 58/210 (27.62%), Postives = 85/210 (40.48%), Query Frame = 3
Query:  168 PITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVI------ATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSI----PKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYP---DVNHGLV 758
            P  V + GA G IG  L   +        H+  +L L D       LKG      D +    +SV+        D L  A  D D  L+   +PRK GM R DL   N +I +    A  + A  +A + V+ NP N+   ++++   +     PK+ F  +T LD  RA   I+          +  VI G+   T  P     NH L+
Sbjct:   17 PYKVTVLGAGGGIGQPLSLLLKLN-----HKVTDLRLYD-------LKGAKGVATDLSHIPTNSVVKGFTPEEPDGLNNALKDTDMVLIPAGVPRKPGMTRDDLFAINASIVRDLAAATAESAPNAA-ILVISNPVNSTVPIVAQVLKNKGVYNPKKLF-GVTTLDSIRAARFISEVENTDPTQERVNVIGGHSGITIIPLISQTNHKLM 212          
BLAST of Malate dehydrogenase vs. Ensembl Yeast
Match: MDH3 (Peroxisomal malate dehydrogenase; catalyzes interconversion of malate and oxaloacetate; involved in the glyoxylate cycle [Source:SGD;Acc:S000002236])

HSP 1 Score: 48.521 bits (114), Expect = 1.551e-6
Identity = 38/140 (27.14%), Postives = 59/140 (42.14%), Query Frame = 3
Query:  372 DDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLV-------MSKYAPSIPKENFSALTRLDHNRAQA-----------QIAAKAGVPCDHVKRCVIWGNHSNTQYP 737
            D ++   ++    L+   +PRK G+ R DL K N  I K    A+ K+A  +A++ V+ NP N+   +       M K+ P     N   +T LD  RA+            +I  +      H K  VI G+   T  P
Sbjct:   60 DSIENTLSNAQVVLIPAGVPRKPGLTRDDLFKMNAGIVKSLVTAVGKFA-PNARILVISNPVNSLVPIAVETLKKMGKFKPG----NVMGVTNLDLVRAETFLVDYLMLKNPKIGQEQDKTTMHRKVTVIGGHSGETIIP 194          
BLAST of Malate dehydrogenase vs. Ensembl Nematostella
Match: EDO41218 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4V3])

HSP 1 Score: 393.66 bits (1010), Expect = 1.103e-134
Identity = 201/325 (61.85%), Postives = 252/325 (77.54%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDGSYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERD 1127
            M  P+ V +TGAAGQI Y L++SVA G+VFG +QPI LHLLDI  M+ +L G+++EL+DCA P LH V+ATDD ++AFTD+D A++VGAMPR+EGMERKDLL AN  IF+ QG+ALDK AKK+ K+ VVGNPANTNCL+  ++APSIPKENFS LTRLD NR  +QIA +  +  D VK  +IWGNHS TQYPDVNHG V   +G  V+I+DAVKDD +L  +FI TVQ RGAA+I ARKLSSA+SAAKA+ DH RDW+ GT+  EWVSM V SDGSYG+ + +++SFPV I    W IVQGL+I+DFSR+K++ T  EL  E +
Sbjct:    1 MAEPLRVCITGAAGQIAYSLLYSVAKGDVFGANQPIILHLLDITPMMGALGGVVLELQDCAIPLLHEVVATDDAEKAFTDIDVAILVGAMPRREGMERKDLLSANAKIFEAQGKALDKVAKKTCKILVVGNPANTNCLIAQRWAPSIPKENFSCLTRLDQNRGGSQIAGRLNLRVDQVKNVIIWGNHSATQYPDVNHGKVC-VNGNWVAIRDAVKDDDYLNGEFISTVQKRGAAIIKARKLSSAMSAAKAICDHMRDWWFGTREGEWVSMGVVSDGSYGIEEGLVYSFPVQICDRTWKIVQGLSINDFSREKMNATATELKGESE 324          
BLAST of Malate dehydrogenase vs. Ensembl Nematostella
Match: EDO45840 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRY2])

HSP 1 Score: 191.43 bits (485), Expect = 5.790e-55
Identity = 104/337 (30.86%), Postives = 176/337 (52.23%), Query Frame = 3
Query:  168 PITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGK---------EVSIKDAVKDDTWLKNDFIKTVQ--TRGAAVIXXXXXXXXXXXXXXXXDHCRDWFH-GTKEWVSMAVYSDGSYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAF 1142
            P+ V ++ A+G + Y ++ S+  G VFG  + ++++LLD P    +L+G+  E+EDCA+P    V  T D   AF D    +++      EG ++K+ L ++  +F+  G+AL+ +AK   KV   G PAN +  + SK+APSI K+NF +L+R++ NRA+  IA +  V    +K  ++WGN     YPD +H  V G DG             + + V D+ WL  +F++ ++  + G   +       +L          +DW    + +  S+ V S+G Y +P+ + FSFPV    G W +V+GL + D  ++ L    +E   E ++ LA 
Sbjct:  131 PLRVCVSKASGPLAYGMLASLVQGEVFGFQEEVSIYLLDTPENQEALQGVAYEIEDCAWPLFRGVHITSDPAVAFKDASVVVLLDGKAINEGTDKKEYLLSHAKLFRDYGKALEAHAKPDCKVLTAGGPANFSTFIASKFAPSIQKKNFVSLSRIEENRAKGLIAKRLNVNTAGIKDLIVWGNPGFNHYPDASHARVDGFDGAIWGPHVPGFTRPVPEMVHDNKWLSGEFVEVLKKPSEGENALMGSVAVKSL---------LQDWCQCASSDMWSLGVISEGWYDIPEGIAFSFPVKFTGGSWQVVEGLALSDSLKEVLKNIAQEAKAETEEVLAL 458          
BLAST of Malate dehydrogenase vs. Ensembl Nematostella
Match: EDO30176 (Malate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:A7T1J0])

HSP 1 Score: 60.4622 bits (145), Expect = 5.765e-10
Identity = 58/192 (30.21%), Postives = 83/192 (43.23%), Query Frame = 3
Query:  177 VVLTGAAGQIGYCLVHSVASGNVFGPHQPI--NLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMS---KYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYP 737
            V + GAAG IG  +       ++     P+  +L L DI V  P +   +  +   A  T H     DDLK A        +   +PRK GM R DL   N +I K   EA  K+  K A +C++ NP N+   + S   K A          +T LD  RA   +A   G+  +++K  VI G+   T  P
Sbjct:   32 VAILGAAGGIGQPM-------SLLLKQSPLISHLALYDI-VNTPGVAADLSHISTRAKVTSHQ--GPDDLKAALEGCSVVAIPAGVPRKPGMTRDDLFNTNASIVKNLSEACAKHCPK-AIICIISNPVNSTVPIASEVYKKAGVYDPGRILGVTTLDIVRAHTFVAEAKGLDVNNIKIPVIGGHSGVTILP 212          
BLAST of Malate dehydrogenase vs. Ensembl Nematostella
Match: EDO33958 (Malate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:A7SQS1])

HSP 1 Score: 53.9138 bits (128), Expect = 4.622e-8
Identity = 36/107 (33.64%), Postives = 47/107 (43.93%), Query Frame = 3
Query:  372 DDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMS---KYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPC 683
            DDLK A        +   +PRK GM R DL   N +I K   EA  K+  K A +C++ NP N+   + S   K A          +T LD  RA   +A     PC
Sbjct:   28 DDLKAALEGCSVVAIPAGVPRKPGMTRDDLFNTNASIVKNLSEACAKHCPK-AIICIISNPVNSTVPIASEVYKKAGVYDPARILGVTTLDIVRAHTFVAEAKTTPC 133          
BLAST of Malate dehydrogenase vs. Ensembl Medaka
Match: mdh1 (malate dehydrogenase 1 [Source:NCBI gene;Acc:100302445])

HSP 1 Score: 410.609 bits (1054), Expect = 8.759e-141
Identity = 215/333 (64.56%), Postives = 258/333 (77.48%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            M  PI VV+TGAAGQI Y L+ S+A G+VFG  QPI L LLDIP M+P L G++MEL+DCA P L  VI TD ++  F D+D A++VG+MPRKEGMERKDLLKANV IFK QG+ALDKYAKK+ KV VVGNPANTNCL+ SK APSIPKENFS LTRLDHNRA +Q+A + GV  D VK  +IWGNHS+TQYPDV+H  V+   G EVS  DAVK+D WL+ DFI TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GTK  E++SM VY+ G SYG+P+D+I+SFP+ I +  W +V GL I+DFSR K+D T  EL+EERD A+ F S
Sbjct:    1 MAEPIRVVVTGAAGQIAYSLLFSIAKGDVFGKDQPIILILLDIPPMLPVLDGVVMELQDCALPLLREVIPTDKVEVGFKDIDAAILVGSMPRKEGMERKDLLKANVAIFKTQGQALDKYAKKTVKVLVVGNPANTNCLIASKSAPSIPKENFSCLTRLDHNRACSQVAMRCGVSSDKVKNVIIWGNHSSTQYPDVHHAKVN-VSGSEVSAYDAVKNDAWLRGDFISTVQLRGAAVIKARKLSSAMSAAKAICDHMRDIWFGTKEGEFISMGVYAAGNSYGIPEDLIYSFPIQIKNKTWKVVDGLPINDFSRAKMDATAAELVEERDTAMDFLS 332          
BLAST of Malate dehydrogenase vs. Ensembl Medaka
Match: mdh1 (malate dehydrogenase 1 [Source:NCBI gene;Acc:100302445])

HSP 1 Score: 410.223 bits (1053), Expect = 1.968e-140
Identity = 214/330 (64.85%), Postives = 257/330 (77.88%), Query Frame = 3
Query:  168 PITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            PI VV+TGAAGQI Y L+ S+A G+VFG  QPI L LLDIP M+P L G++MEL+DCA P L  VI TD ++  F D+D A++VG+MPRKEGMERKDLLKANV IFK QG+ALDKYAKK+ KV VVGNPANTNCL+ SK APSIPKENFS LTRLDHNRA +Q+A + GV  D VK  +IWGNHS+TQYPDV+H  V+   G EVS  DAVK+D WL+ DFI TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GTK  E++SM VY+ G SYG+P+D+I+SFP+ I +  W +V GL I+DFSR K+D T  EL+EERD A+ F S
Sbjct:   21 PIRVVVTGAAGQIAYSLLFSIAKGDVFGKDQPIILILLDIPPMLPVLDGVVMELQDCALPLLREVIPTDKVEVGFKDIDAAILVGSMPRKEGMERKDLLKANVAIFKTQGQALDKYAKKTVKVLVVGNPANTNCLIASKSAPSIPKENFSCLTRLDHNRACSQVAMRCGVSSDKVKNVIIWGNHSSTQYPDVHHAKVN-VSGSEVSAYDAVKNDAWLRGDFISTVQLRGAAVIKARKLSSAMSAAKAICDHMRDIWFGTKEGEFISMGVYAAGNSYGIPEDLIYSFPIQIKNKTWKVVDGLPINDFSRAKMDATAAELVEERDTAMDFLS 349          
BLAST of Malate dehydrogenase vs. Ensembl Medaka
Match: mdh1 (malate dehydrogenase 1 [Source:NCBI gene;Acc:100302445])

HSP 1 Score: 408.683 bits (1049), Expect = 4.854e-140
Identity = 214/330 (64.85%), Postives = 257/330 (77.88%), Query Frame = 3
Query:  168 PITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDG-SYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            PI VV+TGAAGQI Y L+ S+A G+VFG  QPI L LLDIP M+P L G++MEL+DCA P L  VI TD ++  F D+D A++VG+MPRKEGMERKDLLKANV IFK QG+ALDKYAKK+ KV VVGNPANTNCL+ SK APSIPKENFS LTRLDHNRA +Q+A + GV  D VK  +IWGNHS+TQYPDV+H  V+   G EVS  DAVK+D WL+ DFI TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GTK  E++SM VY+ G SYG+P+D+I+SFP+ I +  W +V GL I+DFSR K+D T  EL+EERD A+ F S
Sbjct:    6 PIRVVVTGAAGQIAYSLLFSIAKGDVFGKDQPIILILLDIPPMLPVLDGVVMELQDCALPLLREVIPTDKVEVGFKDIDAAILVGSMPRKEGMERKDLLKANVAIFKTQGQALDKYAKKTVKVLVVGNPANTNCLIASKSAPSIPKENFSCLTRLDHNRACSQVAMRCGVSSDKVKNVIIWGNHSSTQYPDVHHAKVN-VSGSEVSAYDAVKNDAWLRGDFISTVQLRGAAVIKARKLSSAMSAAKAICDHMRDIWFGTKEGEFISMGVYAAGNSYGIPEDLIYSFPIQIKNKTWKVVDGLPINDFSRAKMDATAAELVEERDTAMDFLS 334          
BLAST of Malate dehydrogenase vs. Ensembl Medaka
Match: mdhb (cytosolic malate dehydrogenase B [Source:NCBI gene;Acc:100049475])

HSP 1 Score: 402.905 bits (1034), Expect = 7.841e-138
Identity = 214/331 (64.65%), Postives = 256/331 (77.34%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDGS-YGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAF 1142
            M  PI+V++TGAAGQI Y L+ S+A G+VFG  QPI L LLDI  M+P L+G++MEL+DCA P L  VIATD  + AF D+D A++VG+MPRKEGMERKDLLKANV IF+ QG ALDKYAKK+  V VVGNPANTNCL+ +K APSIPKENFS LTRLDHNRA +Q+A + GVP  HVK  +IWGNHS+TQYPDV+H  V    G E++  DAVKDD+WLK DFI TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   E++SM VYS G+ YGVP+D+I+SFPV I    W IV  L I+DFS+ K+D T  EL+EERD ALAF
Sbjct:    1 MAEPISVLVTGAAGQIAYSLLFSIAKGDVFGKDQPIILLLLDITPMLPVLEGVVMELQDCALPLLREVIATDKEEVAFKDLDAAILVGSMPRKEGMERKDLLKANVAIFRSQGAALDKYAKKTVHVLVVGNPANTNCLIAAKSAPSIPKENFSCLTRLDHNRACSQVAMRCGVPATHVKNVIIWGNHSSTQYPDVHHCKVSMSSG-ELACFDAVKDDSWLKGDFIATVQQRGAAVIKARKLSSAMSAAKAICDHMRDIWSGTPEGEFISMGVYSTGNPYGVPEDLIYSFPVQIKDKAWKIVDSLAINDFSKSKMDATAAELMEERDTALAF 330          
BLAST of Malate dehydrogenase vs. Ensembl Medaka
Match: mdhb (cytosolic malate dehydrogenase B [Source:NCBI gene;Acc:100049475])

HSP 1 Score: 395.971 bits (1016), Expect = 3.417e-135
Identity = 211/325 (64.92%), Postives = 252/325 (77.54%), Query Frame = 3
Query:  177 VVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTK--EWVSMAVYSDGS-YGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAF 1142
            V++TGAAGQI Y L+ S+A G+VFG  QPI L LLDI  M+P L+G++MEL+DCA P L  VIATD  + AF D+D A++VG+MPRKEGMERKDLLKANV IF+ QG ALDKYAKK+  V VVGNPANTNCL+ +K APSIPKENFS LTRLDHNRA +Q+A + GVP  HVK  +IWGNHS+TQYPDV+H  V    G E++  DAVKDD+WLK DFI TVQ RGAAVI ARKLSSA+SAAKA+ DH RD + GT   E++SM VYS G+ YGVP+D+I+SFPV I    W IV  L I+DFS+ K+D T  EL+EERD ALAF
Sbjct:    2 VLVTGAAGQIAYSLLFSIAKGDVFGKDQPIILLLLDITPMLPVLEGVVMELQDCALPLLREVIATDKEEVAFKDLDAAILVGSMPRKEGMERKDLLKANVAIFRSQGAALDKYAKKTVHVLVVGNPANTNCLIAAKSAPSIPKENFSCLTRLDHNRACSQVAMRCGVPATHVKNVIIWGNHSSTQYPDVHHCKVSMSSG-ELACFDAVKDDSWLKGDFIATVQQRGAAVIKARKLSSAMSAAKAICDHMRDIWSGTPEGEFISMGVYSTGNPYGVPEDLIYSFPVQIKDKAWKIVDSLAINDFSKSKMDATAAELMEERDTALAF 325          
BLAST of Malate dehydrogenase vs. Planmine SMEST
Match: SMESG000056995.1 (SMESG000056995.1)

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 329/330 (99.70%), Postives = 330/330 (100.00%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTKEWVSMAVYSDGSYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 1148
            MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKK+AKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIAARKLSSALSAAKAVADHCRDWFHGTKEWVSMAVYSDGSYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS
Sbjct:    1 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKTAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIAARKLSSALSAAKAVADHCRDWFHGTKEWVSMAVYSDGSYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLTGKELIEERDQALAFCS 330          
BLAST of Malate dehydrogenase vs. Planmine SMEST
Match: SMESG000027913.1 (SMESG000027913.1)

HSP 1 Score: 465.307 bits (1196), Expect = 1.520e-162
Identity = 234/314 (74.52%), Postives = 270/314 (85.99%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTKEWVSMAVYSDGSYGVPKDVIFSFPVTIDHGKWHIVQGLTIDDFSRQKLDLT 1100
            M+ PI V++TGAAGQIGY LV ++A+G+VFG  Q + LHL DIP MVP+LKGL+MELEDC+FPTL S+IAT D KE FTD+D+ALMVGAMPRK+GMER+DLLKANV+IFKVQGE LDKYAKK+ KV VVGNPANTNC ++SKYAPSIPKENFSALTRLDHNRAQ+QIA K GV    V R VIWGNHS TQYPDV +GLV   +GKEVS+K+AVK+D WL+ +F+KTVQTRGAAVIAARKLSSA+SAAKA+ DHCRDWF GT +WVSMAVYSDGSY  PKD+IFSFPVTI +GKW IV GL IDDFS+ KL+ T
Sbjct:    1 MSAPIHVLITGAAGQIGYSLVGNIANGSVFGEKQQVILHLFDIPDMVPALKGLVMELEDCSFPTLKSIIATGDAKEGFTDIDWALMVGAMPRKDGMERRDLLKANVSIFKVQGEYLDKYAKKTVKVIVVGNPANTNCFILSKYAPSIPKENFSALTRLDHNRAQSQIALKVGVGFTDVHRVVIWGNHSGTQYPDVTNGLVKLANGKEVSVKEAVKNDGWLQEEFLKTVQTRGAAVIAARKLSSAMSAAKAICDHCRDWFKGTSDWVSMAVYSDGSYNSPKDIIFSFPVTIKNGKWTIVTGLKIDDFSKAKLEAT 314          
BLAST of Malate dehydrogenase vs. Planmine SMEST
Match: SMESG000042152.1 (SMESG000042152.1)

HSP 1 Score: 236.884 bits (603), Expect = 1.129e-73
Identity = 119/286 (41.61%), Postives = 182/286 (63.64%), Query Frame = 3
Query:  168 PITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGKEVSIKDAVKDDTWLKNDFIKTVQTR-------GAAVIXXXXXXXXXXXXXXXXDHCRDWFHGTKEWVSMAVYSDGSYGVPKDV 1004
            P+ +VL+GAA      L+  + +G ++G  QPI LHLL+    +P +  L MEL+DCAF  L  ++ T +  EA+T+V+   M+     ++ M + D+ + N+  FK   E +++YA K  K+ +   P NTNCLVMSKYAP+IP EN + + RLD NRAQAQ+A++ GVPC+ ++R +IWGNHS+T++ D+++ +V   D KE+SI+DA+K+D W+KN FIKT+QTR       G   +     S  +S AKA+ DH  D ++GT +W++M VY + S    K +
Sbjct:   11 PLKIVLSGAAHPASIFLIRYILNGEIYGKDQPIILHLLEGSSKLPLVMALEMELQDCAFFLLEKILVTSNKIEAYTNVNIIFMLSEKKDQKEMFKVDVFRYNLKHFKRHAEIINEYADKRVKIIMCSRPINTNCLVMSKYAPNIPVENITGIIRLDVNRAQAQLASELGVPCNTIRRIIIWGNHSDTKFTDISYAMVKLPDTKEMSIQDAIKNDNWIKNHFIKTIQTRTDDPNFGGTGKV-----SYYMSLAKAIMDHSYDMWNGTADWINMIVYREESEITSKQI 291          
BLAST of Malate dehydrogenase vs. Planmine SMEST
Match: SMESG000027913.1 (SMESG000027913.1)

HSP 1 Score: 192.2 bits (487), Expect = 7.978e-59
Identity = 92/128 (71.88%), Postives = 111/128 (86.72%), Query Frame = 3
Query:  159 MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAK-VC 539
            M+ PI V++TGAAGQIGY LV ++A+G+VFG  Q + LHL DIP MVP+LKGL+MELEDC+FPTL S+IAT D KE FTD+D+ALMVGAMPRK+GMER+DLLKANV+IFKVQGE LDKYAKK+ K +C
Sbjct:    1 MSAPIHVLITGAAGQIGYSLVGNIANGSVFGEKQQVILHLFDIPDMVPALKGLVMELEDCSFPTLKSIIATGDAKEGFTDIDWALMVGAMPRKDGMERRDLLKANVSIFKVQGEYLDKYAKKTVKQIC 128          
BLAST of Malate dehydrogenase vs. Planmine SMEST
Match: SMESG000070444.1 (SMESG000070444.1)

HSP 1 Score: 106.301 bits (264), Expect = 5.780e-24
Identity = 98/367 (26.70%), Postives = 165/367 (44.96%), Query Frame = 3
Query:   54 KLLIHFIIDFCLSHIKIIFCNFVR-DQV**KYI--F*NMTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSLKGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAM--PRKEGMERKDLLKANVNIFKVQGEALDKYAKKSAKVCVVGNPA----NTNCLVMSKYAPSIPKENFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLVHGHDGK-------EVSIKDAVKDDTWLKNDFIKTVQTRGAAVIXXXX-XXXXXXXXXXXXDHCRDWFHGTKEWV--SMAVYSDGSYGVPKDVIFSFPVTID-HGKWHIVQGLTIDDFSRQKLD 1094
            K   + I DF  SH++ I  + VR  +   K I  F  ++ P  VV+ GA  +     V S++ G+V   +  + +  +D    +P LK L M   D A+  + S+  TD+ + AF D    ++         +  E    +KAN   ++  G  ++KY     KV +V   A    N N + + +    IPK N   L+R    + ++ +A K  V   +V   ++WGN     Y D N+  VH +DG         +S+   V D  WLKN+    +  R   +      L + L+ A A+      W +G +     S+ + S+G YGVP  + FS PVT++  G W +VQ + + +   + ++
Sbjct:   90 KCYYNVISDFTSSHMQDIALDNVRFKENEDKEIREFKALSTPTKVVIVGAVNEAVPHFVLSLSRGDVLNSNTELAIVFVDKTEHLPILKSLQMGTFDLAYRLVRSISITDNFEAAFADSSLVVIFDDRNPSPADPDEYIPWMKANQEYYEYIGNFIEKYCSLDVKVLLVPIKAISYLNINLISIHRMLQRIPKFNVVGLSRTVEQQVRSVVARKLNVNPSNVHNNIVWGNIGGKMYIDTNNSRVHRYDGAVMGPEPFSLSVTKTVWDKKWLKNEMEPLILNRFQEISDLNNGLGTPLALASAITTFLGQWINGDEHGYIHSLVIASEGWYGVPDGMAFSMPVTLNPQGYWTVVQDVELSEIQFKSIN 456          
The following BLAST results are available for this feature:
BLAST of Malate dehydrogenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MDH13.157e-13964.86malate dehydrogenase 1 [Source:HGNC Symbol;Acc:HGN... [more]
MDH13.157e-13964.86malate dehydrogenase 1 [Source:HGNC Symbol;Acc:HGN... [more]
MDH14.705e-13964.24malate dehydrogenase 1 [Source:HGNC Symbol;Acc:HGN... [more]
MDH11.367e-9068.34malate dehydrogenase 1 [Source:HGNC Symbol;Acc:HGN... [more]
MDH15.969e-7865.38malate dehydrogenase 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Malate dehydrogenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mdh-19.072e-12558.73Malate dehydrogenase [Source:UniProtKB/TrEMBL;Acc... [more]
mdh-12.184e-9357.95Malate dehydrogenase [Source:UniProtKB/TrEMBL;Acc... [more]
mdh-12.604e-5257.63Malate dehydrogenase [Source:UniProtKB/TrEMBL;Acc... [more]
ldh-13.895e-624.92L-lactate dehydrogenase [Source:UniProtKB/Swiss-P... [more]
ldh-14.042e-624.92L-lactate dehydrogenase [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Malate dehydrogenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mdh11.213e-13262.61gene:FBgn0262782 transcript:FBtr0345435[more]
Mdh11.213e-13262.61gene:FBgn0262782 transcript:FBtr0080050[more]
back to top
BLAST of Malate dehydrogenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mdh1aa1.062e-14364.86malate dehydrogenase 1Aa, NAD (soluble) [Source:ZF... [more]
mdh1aa1.617e-14365.15malate dehydrogenase 1Aa, NAD (soluble) [Source:ZF... [more]
mdh1ab1.893e-13061.93malate dehydrogenase 1Ab, NAD (soluble) [Source:ZF... [more]
mdh1aa4.316e-3259.14malate dehydrogenase 1Aa, NAD (soluble) [Source:ZF... [more]
mdh1b3.686e-2525.60malate dehydrogenase 1B, NAD (soluble) [Source:NCB... [more]
back to top
BLAST of Malate dehydrogenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mdh18.221e-13362.46malate dehydrogenase 1 [Source:NCBI gene;Acc:44831... [more]
mdh12.412e-13262.73malate dehydrogenase 1 [Source:NCBI gene;Acc:44831... [more]
mdh12.606e-13262.73malate dehydrogenase 1 [Source:NCBI gene;Acc:44831... [more]
mdh12.679e-13262.76malate dehydrogenase 1 [Source:NCBI gene;Acc:44831... [more]
mdh11.503e-12861.70malate dehydrogenase 1 [Source:NCBI gene;Acc:44831... [more]
back to top
BLAST of Malate dehydrogenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mdh15.750e-14065.17malate dehydrogenase 1, NAD (soluble) [Source:MGI ... [more]
Mdh15.750e-14065.17malate dehydrogenase 1, NAD (soluble) [Source:MGI ... [more]
Mdh19.703e-14065.17malate dehydrogenase 1, NAD (soluble) [Source:MGI ... [more]
Mdh12.737e-6667.10malate dehydrogenase 1, NAD (soluble) [Source:MGI ... [more]
Mdh1b5.144e-3127.03malate dehydrogenase 1B, NAD (soluble) [Source:MGI... [more]
back to top
BLAST of Malate dehydrogenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O88989|MDHC_RAT2.903e-13964.86Malate dehydrogenase, cytoplasmic OS=Rattus norveg... [more]
sp|P14152|MDHC_MOUSE4.022e-13965.17Malate dehydrogenase, cytoplasmic OS=Mus musculus ... [more]
sp|P11708|MDHC_PIG4.633e-13965.47Malate dehydrogenase, cytoplasmic OS=Sus scrofa OX... [more]
sp|Q7YRU4|MDHC_FELCA1.375e-13864.86Malate dehydrogenase, cytoplasmic OS=Felis catus O... [more]
sp|P40925|MDHC_HUMAN1.516e-13864.86Malate dehydrogenase, cytoplasmic OS=Homo sapiens ... [more]
back to top
BLAST of Malate dehydrogenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W5YLL54.253e-14365.86Malate dehydrogenase OS=Leptinotarsa decemlineata ... [more]
A0A482VY421.540e-14266.26Malate dehydrogenase OS=Asbolus verrucosus OX=1661... [more]
A0A3B4DZ111.966e-14167.07Malate dehydrogenase OS=Pygocentrus nattereri OX=4... [more]
E0VFB43.546e-14164.13Malate dehydrogenase OS=Pediculus humanus subsp. c... [more]
C0H8203.903e-14165.17Malate dehydrogenase OS=Salmo salar OX=8030 GN=MDH... [more]
back to top
BLAST of Malate dehydrogenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mdh1aa2.693e-14165.56malate dehydrogenase, cytoplasmic [Source:NCBI gen... [more]
mdh1aa5.922e-14165.85malate dehydrogenase, cytoplasmic [Source:NCBI gen... [more]
mdh1ab5.304e-14064.95malate dehydrogenase, cytoplasmic [Source:NCBI gen... [more]
mdh1aa4.286e-12666.44malate dehydrogenase 1Aa, NAD (soluble) [Source:ZF... [more]
mdh1b7.149e-3528.44malate dehydrogenase 1B [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Malate dehydrogenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007050.13.842e-7364.67pep scaffold:Pmarinus_7.0:GL479360:144570:153551:-... [more]
mdh1b1.762e-2827.00malate dehydrogenase 1B, NAD (soluble) [Source:NCB... [more]
back to top
BLAST of Malate dehydrogenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
MDH16.158e-727.62Mitochondrial malate dehydrogenase; catalyzes inte... [more]
MDH31.551e-627.14Peroxisomal malate dehydrogenase; catalyzes interc... [more]
back to top
BLAST of Malate dehydrogenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO412181.103e-13461.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458405.790e-5530.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301765.765e-1030.21Malate dehydrogenase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO339584.622e-833.64Malate dehydrogenase [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Malate dehydrogenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mdh18.759e-14164.56malate dehydrogenase 1 [Source:NCBI gene;Acc:10030... [more]
mdh11.968e-14064.85malate dehydrogenase 1 [Source:NCBI gene;Acc:10030... [more]
mdh14.854e-14064.85malate dehydrogenase 1 [Source:NCBI gene;Acc:10030... [more]
mdhb7.841e-13864.65cytosolic malate dehydrogenase B [Source:NCBI gene... [more]
mdhb3.417e-13564.92cytosolic malate dehydrogenase B [Source:NCBI gene... [more]
back to top
BLAST of Malate dehydrogenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056995.10.000e+099.70SMESG000056995.1[more]
SMESG000027913.11.520e-16274.52SMESG000027913.1[more]
SMESG000042152.11.129e-7341.61SMESG000042152.1[more]
SMESG000027913.17.978e-5971.88SMESG000027913.1[more]
SMESG000070444.15.780e-2426.70SMESG000070444.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034381 ID=SMED30034381|Name=Malate dehydrogenase|organism=Schmidtea mediterranea sexual|type=transcript|length=1624bp
TTTTTATTATTGCATAATAATTTCGCATTGGTCTCAAATCAATAAAAAAT
TCAAAACTTTTAATTCACTTTATAATTGATTTTTGTTTATCTCATATCAA
AATTATTTTCTGCAATTTTGTACGTGACCAAGTTTAATAAAAATATATTT
TCTAGAATATGACTCCGCCTATTACTGTTGTGTTGACTGGTGCAGCTGGA
CAGATTGGCTATTGTCTAGTTCACAGTGTTGCTAGTGGAAACGTTTTTGG
GCCCCACCAACCCATTAATCTTCATCTTTTGGATATTCCGGTAATGGTTC
CATCCTTAAAAGGATTAATTATGGAACTAGAAGATTGCGCTTTTCCTACT
TTACATAGTGTTATCGCCACTGATGATTTGAAAGAAGCATTCACTGATGT
AGATTTTGCATTAATGGTTGGTGCAATGCCTAGAAAAGAAGGCATGGAGC
GAAAAGATCTACTTAAAGCGAATGTTAATATTTTTAAAGTTCAAGGAGAA
GCTTTAGATAAATACGCTAAAAAATCTGCTAAAGTTTGTGTAGTTGGTAA
TCCAGCTAACACAAACTGTTTGGTTATGAGTAAATATGCGCCATCTATTC
CAAAAGAAAACTTTTCAGCTTTAACGAGATTAGATCATAATAGAGCTCAA
GCTCAAATTGCAGCTAAAGCAGGTGTTCCATGCGATCATGTTAAGCGGTG
TGTTATCTGGGGTAATCATAGTAATACTCAATATCCTGATGTCAACCATG
GATTGGTACACGGTCACGATGGTAAAGAAGTTTCAATAAAGGATGCTGTC
AAAGATGACACTTGGTTGAAAAATGATTTTATCAAAACCGTGCAAACTAG
AGGAGCTGCGGTTATTGCAGCTCGCAAACTTAGTAGTGCTTTATCTGCAG
CAAAAGCTGTAGCTGATCATTGCAGAGATTGGTTTCATGGGACGAAAGAA
TGGGTATCTATGGCGGTTTATAGCGATGGGTCCTATGGTGTACCGAAGGA
TGTAATTTTCAGTTTCCCTGTTACTATCGATCATGGAAAATGGCACATTG
TTCAAGGTCTGACAATCGATGATTTTTCAAGGCAAAAATTAGATCTTACT
GGAAAGGAGTTAATTGAAGAAAGAGATCAAGCTCTTGCATTTTGTAGTTG
AAAATTGATGGCTTTGCTTTAGAATGACGTCATTTATGATTGATTTATTT
TAGACTTAAACTATATTAGAAGTTCCGTGTTTTTGTCTTTATAATACTAT
AATAGGATTTGAAAAATAATATTGTTATTTTACTGATATCTCGAAATTGT
TCATTTATTTTTTACTTATAAATTTGAAAATCTAATGTTATTAGGACTCT
TATAAATCCAATAACTAGGAGTTTTTTGGTTATTTTAATTGTATCGTACA
AAATTGTGTGTTGAATACTATTTATTATTTTGCTTGGGGATTCGATTCAA
AACCCGGAAACTTATATCAACTATAGAGGGCACGAAGTAAACGGCAGGTG
GGATATGGGCCAACTTGTAAATGGCTCATTTTCAGCGTACATCAATGAGG
TACAATCGGATGAGTCAAACCAGTGGTAAATGTTTCCTGTTCTTATCACT
TCGTGAGATTGAACTAAACCATTT
back to top

protein sequence of SMED30034381-orf-1

>SMED30034381-orf-1 ID=SMED30034381-orf-1|Name=SMED30034381-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=331bp
MTPPITVVLTGAAGQIGYCLVHSVASGNVFGPHQPINLHLLDIPVMVPSL
KGLIMELEDCAFPTLHSVIATDDLKEAFTDVDFALMVGAMPRKEGMERKD
LLKANVNIFKVQGEALDKYAKKSAKVCVVGNPANTNCLVMSKYAPSIPKE
NFSALTRLDHNRAQAQIAAKAGVPCDHVKRCVIWGNHSNTQYPDVNHGLV
HGHDGKEVSIKDAVKDDTWLKNDFIKTVQTRGAAVIAARKLSSALSAAKA
VADHCRDWFHGTKEWVSMAVYSDGSYGVPKDVIFSFPVTIDHGKWHIVQG
LTIDDFSRQKLDLTGKELIEERDQALAFCS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0000428musculature system
Vocabulary: INTERPRO
TermDefinition
IPR011274Malate_DH_NAD-dep_euk
IPR010945Malate_DH_type2
IPR036291NAD(P)-bd_dom_sf
IPR016040NAD(P)-bd_dom
IPR001557L-lactate/malate_DH
IPR001236Lactate/malate_DH_N
IPR015955Lactate_DH/Glyco_Ohase_4_C
IPR022383Lactate/malate_DH_C
IPR001252Malate_DH_AS
Vocabulary: biological process
TermDefinition
GO:0019752carboxylic acid metabolic process
GO:0055114oxidation-reduction process
GO:0005975carbohydrate metabolic process
GO:0006108malate metabolic process
GO:0006099tricarboxylic acid cycle
Vocabulary: molecular function
TermDefinition
GO:0016616oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0016491oxidoreductase activity
GO:0003824catalytic activity
GO:0016615malate dehydrogenase activity
GO:0030060L-malate dehydrogenase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001236Lactate/malate dehydrogenase, N-terminalPFAMPF00056Ldh_1_Ncoord: 7..152
e-value: 1.5E-35
score: 122.4
IPR001557L-lactate/malate dehydrogenasePIRSFPIRSF000102Lac_mal_DHcoord: 1..329
e-value: 2.3E-68
score: 228.2
IPR022383Lactate/malate dehydrogenase, C-terminalPFAMPF02866Ldh_1_Ccoord: 156..328
e-value: 3.7E-41
score: 140.8
IPR011274Malate dehydrogenase, NAD-dependent, cytosolicTIGRFAMTIGR01758TIGR01758coord: 7..327
e-value: 1.2E-157
score: 522.3
IPR011274Malate dehydrogenase, NAD-dependent, cytosolicCDDcd01336MDH_cytoplasmic_cytosoliccoord: 4..326
e-value: 0.0
score: 617.33
IPR010945Malate dehydrogenase, type 2TIGRFAMTIGR01759TIGR01759coord: 4..325
e-value: 5.5E-150
score: 496.8
IPR010945Malate dehydrogenase, type 2PANTHERPTHR23382MALATE DEHYDROGENASEcoord: 2..329
IPR015955Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminalGENE3DG3DSA:3.90.110.10coord: 155..330
e-value: 1.0E-70
score: 238.9
IPR015955Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminalSUPERFAMILYSSF56327LDH C-terminal domain-likecoord: 156..328
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 3..154
e-value: 7.1E-59
score: 200.0
NoneNo IPR availablePANTHERPTHR23382:SF3MALATE DEHYDROGENASE, CYTOPLASMICcoord: 2..329
IPR001252Malate dehydrogenase, active sitePROSITEPS00068MDHcoord: 155..167
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 2..154