ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30034378
Length (bp)1729
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30034378) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30034378) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30034378) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30034378) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034378

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 36

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30034378h1SMcG0008237 dd_Smed_v4_91547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034378h1SMcG0008237 dd_Smed_v4_91547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034378h1SMcG0008237 dd_Smed_v4_91547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034378h1SMcG0008237 dd_Smed_v4_96152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034378h1SMcG0008237 dd_Smed_v4_96152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034378h1SMcG0008237 dd_Smed_v4_96152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034378h1SMcG0008237 dd_Smed_v4_98586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034378h1SMcG0008237 dd_Smed_v4_98586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034378h1SMcG0008237 dd_Smed_v4_98586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034378h1SMcG0008237 dd_Smed_v4_92330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034378h1SMcG0008237 dd_Smed_v4_92330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034378h1SMcG0008237 dd_Smed_v4_92330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034378h1SMcG0008237 Contig29127uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034378h1SMcG0008237 Contig29127newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30034378h1SMcG0008237 dd_Smed_v4_71921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034378h1SMcG0008237 dd_Smed_v4_71921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034378h1SMcG0008237 dd_Smed_v4_71921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034378h1SMcG0008236 Contig29127uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034378h1SMcG0008236 Contig29127newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30034378h1SMcG0008237 dd_Smed_v4_89532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034378h1SMcG0008237 dd_Smed_v4_89532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034378h1SMcG0008237 dd_Smed_v4_55264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034378h1SMcG0008237 dd_Smed_v4_55264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034378h1SMcG0008237 dd_Smed_v4_55264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034378h1SMcG0008237 dd_Smed_v4_55117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034378h1SMcG0008237 dd_Smed_v4_55117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034378h1SMcG0008237 dd_Smed_v4_55117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034378h1SMcG0008237 dd_Smed_v4_82108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034378h1SMcG0008237 dd_Smed_v4_82108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034378h1SMcG0008237 dd_Smed_v4_82108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30034378h1SMcG0008237 dd_Smed_v6_55264_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034378h1SMcG0008237 dd_Smed_v6_55117_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30034378h1SMcG0008237 Contig29127uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30034378h1SMcG0008237 Contig29127newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30034378h1SMcG0008236 Contig29127uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30034378h1SMcG0008236 Contig29127newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: TRPC6 (transient receptor potential cation channel subfamily C member 6 [Source:HGNC Symbol;Acc:HGNC:12338])

HSP 1 Score: 53.5286 bits (127), Expect = 1.099e-6
Identity = 49/194 (25.26%), Postives = 91/194 (46.91%), Query Frame = 3
Query:   75 SKLNNYKTIEEFIHVSPA---PAETAAKLSKLYFILSGKEKERSKDLQMISKYCEA-------MCTDLVALAAYESGADKLLKSYD--KNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFILIFPVS----------WLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQ 590
            S++N YK +    ++S +   P  TA +LS    +L+  EKE   D + +S  C+        +C +   + A  +G  + L+S D  +  +  L + I+ E K+ ++H + Q+ L  +W  NL+    +   + F+++  V+          W       GKI+ + P +KFV +  S  I   LL++ A D+
Sbjct:  272 SRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVETLQSGDHGRPNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFLALIYWFAPCSKMGKIM-RGPFMKFVAHAASFTIFLGLLVMNAADR 464          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: TRPC6 (transient receptor potential cation channel subfamily C member 6 [Source:HGNC Symbol;Acc:HGNC:12338])

HSP 1 Score: 53.1434 bits (126), Expect = 1.361e-6
Identity = 49/194 (25.26%), Postives = 91/194 (46.91%), Query Frame = 3
Query:   75 SKLNNYKTIEEFIHVSPA---PAETAAKLSKLYFILSGKEKERSKDLQMISKYCEA-------MCTDLVALAAYESGADKLLKSYD--KNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFILIFPVS----------WLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQ 590
            S++N YK +    ++S +   P  TA +LS    +L+  EKE   D + +S  C+        +C +   + A  +G  + L+S D  +  +  L + I+ E K+ ++H + Q+ L  +W  NL+    +   + F+++  V+          W       GKI+ + P +KFV +  S  I   LL++ A D+
Sbjct:  272 SRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVETLQSGDHGRPNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFLALIYWFAPCSKMGKIM-RGPFMKFVAHAASFTIFLGLLVMNAADR 464          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: trp-4 (TRP (Transient receptor potential) channel family [Source:UniProtKB/TrEMBL;Acc:Q9GRV5])

HSP 1 Score: 276.944 bits (707), Expect = 1.275e-80
Identity = 200/541 (36.97%), Postives = 307/541 (56.75%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLL-FFILIFPVSWLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYD---QPYNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSYFIKTLELPE------------MIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPIILQSKTSNSEETNKDIIDMAI------LLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPF-----IIIYQFWLYSSILYYKIRNIPIESLLEDEVDDPEHKSRRKSQVSPNILEASKTSRHGSEKL--------EEVVNWSDIINKYLAIRG 1565
            K ++DLM+C K N+ + ++EFI  SPAP ETA KLS LY  +S KEKER+KDL  ++ + E M  +L+ + A E  A  LLK+ D  G   LD+LIE EQKEV+S+ASVQ+YL+ VW   ++W   KF     F+LI P +W Y   P    + ++P+IKFV ++ SH+  TILL IV  +   + Y    V P  +EW+L +WL+G  +SEL      S + ++++LIL+LS  ++ VH +++ +  + L              M+Y++NQ+   +    FV  LDFL+ HHLFGPW II+R+L+ DL +FLV  ++F+  F   ++  +QP          +E + +++ +A       +L+FS+FG V PD +P   + P ++  + + +F   +M+ +IVL+NLLIAMM+DTYQRIQA+SD EWKFGRA LIR M   +  PSP      +II     + + L    R    +   E+ +D       ++ + SP     +   R G ++L        E V++W  I++ Y    G
Sbjct: 1373 KFIFDLMVCGKTNDNEPLQEFILQSPAPIETAVKLSALYRDMSEKEKERAKDLLNVAVFSENMAVELLGITATEYNAALLLKAKDNRGRPLLDVLIENEQKEVVSYASVQRYLTEVWTARVDWSFGKFVAFSLFVLICPPAWFYFSLPLDSRIGRAPIIKFVCHIVSHVYFTILLTIVVLNITHKMYEVTSVVPNPVEWLLLLWLSGNLVSELSTVGGGSGLGIVKVLILVLSAMAIAVHVLAFLLPAVFLTHLDNDEKLHFARTMLYLKNQLFAFALLFAFVEYLDFLTVHHLFGPWAIIIRDLMYDLARFLVILMLFVAGFTLHVTSIFQP-----AYQPVDEDSAELMRLASPSQTLEMLFFSLFGLVEPDSMPPLHLVPDFAKIILKLLFGIYMMVTLIVLINLLIAMMSDTYQRIQAQSDKEWKFGRAILIRQMNKKSATPSPINMLTKLIIVLRVAWRNRLRCMTRKAQDDLRFEENIDAFSMGGGQQGRQSP-----TNEGREGQQELGNSADWNIETVIDWRKIVSMYYQANG 1903          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0300012)

HSP 1 Score: 303.523 bits (776), Expect = 1.116e-89
Identity = 226/545 (41.47%), Postives = 320/545 (58.72%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLF--FILIFPVSWLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQ--PYNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSY-FIKTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLS------GTYQPIILQS--KTSNSEETNKDIIDMAIL----LYFSVFGQVTPDDL-PNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLY---------------SSILYYKIRNI-PIESLLEDEVDDPEHKSRRKSQVSPNILEASKT-SRHGSEKLEEVVNWSDIINKYLAIRGNKSG 1577
            + +Y+LM+ SK +N K I+EF+ VSPAP +TAAKLS +Y +LS KEKER+KDL    K CEAM T+L+ALAA    A K+L++ DK  ++FLD+LIE EQKEVI+H  VQ+YL  +W G+L W +WK  LL   FI+  PV W+   FP G    K P+IKF+ YL SHI + I L IV      P  R  + P   E  L IWL+GL L EL NP D+S +  +++L+L+L +A V VH  ++ F+     P ++Y RNQ    +  L  V  LDFLSFHHLFGPW II+ +L++DL +FL    IF+F F+  +         + P  L+S  K + +     D      L    L+F+VFGQ T  D+ P   + P++++ L +F+F   L++ ++VL+NLLIAMM+DTYQRIQA+SDIEWKFG +KLIRNM  TT  PSP  ++  ++++               S +    IR   P        +   +  S   SQV  + L +  + S+    ++E V +W  I  KY A+ G++ G
Sbjct: 1144 RFVYNLMVVSKNHNNKPIQEFVLVSPAPVDTAAKLSNIYIVLSTKEKERAKDLVAAGKQCEAMATELLALAAGSDSAGKILQATDKRNVEFLDVLIENEQKEVIAHTVVQRYLQELWHGSLTWASWKILLLLVAFIVCPPV-WIGFTFPMGHKFNKVPIIKFMSYLTSHIYLMIHLSIVGITPIYPVLRLSLVPYWYEVGLLIWLSGLLLFELTNPSDKSGLGSIKVLVLLLGMAGVGVHVSAFLFVSKEYWPTLVYCRNQCFALAFLLACVQILDFLSFHHLFGPWAIIIGDLLKDLARFLAVLAIFVFGFSMHIVALNQSFANFSPEDLRSFEKKNRNRGYFSDGPMTPFLAFERLFFAVFGQTTTLDINPMRHLRPEWTEVLFKFVFGIYLLVSVVVLINLLIAMMSDTYQRIQAQSDIEWKFGLSKLIRNMHRTTTAPSPLNLVTTWFMWIVEKVKARMKKKKRPSLVQMMGIRQASPRTKAGAKWLSKIKKDSVALSQVHLSPLGSQASFSQANQNRIENVADWEAIAKKYRALVGDEEG 1687          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0304843)

HSP 1 Score: 298.13 bits (762), Expect = 1.010e-87
Identity = 225/551 (40.83%), Postives = 319/551 (57.89%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLF--FILIFPVSWLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQ--PYNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSY-FIKTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLS------GTYQPIILQS--KTSNSEETNKDI----IDMAILLYFSVFGQVTP-----DDLPN--PDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLY---------------SSILYYKIRNI-PIESLLEDEVDDPEHKSRRKSQVSPNILEASKT-SRHGSEKLEEVVNWSDIINKYLAIRGNKSG 1577
            + +Y+LM+ SK +N K I+EF+ VSPAP +TAAKLS +Y +LS KEKER+KDL    K CEAM T+L+ALAA    A K+L++ DK  ++FLD+LIE EQKEVI+H  VQ+YL  +W G+L W +WK  LL   FI+  PV W+   FP G    K P+IKF+ YL SHI + I L IV      P  R  + P   E  L IWL+GL L EL NP D+S +  +++L+L+L +A V VH  ++ F+     P ++Y RNQ    +  L  V  LDFLSFHHLFGPW II+ +L++DL +FL    IF+F F+  +         + P  L+S  K + +     D+    I+   LL+F+VFGQ T      D + N      P + + L + +F   +++ ++VL+NLLIAMM+DTYQRIQA+SDIEWKFG +KLIRNM  TT  PSP  ++  ++++               S +    IR   P        +   +  S   SQV  + L +  + S+    ++E V +W  I  KY A+ G++ G
Sbjct: 1144 RFVYNLMVVSKNHNNKPIQEFVLVSPAPVDTAAKLSNIYIVLSTKEKERAKDLVAAGKQCEAMATELLALAAGSDSAGKILQATDKRNVEFLDVLIENEQKEVIAHTVVQRYLQELWHGSLTWASWKILLLLVAFIVCPPV-WIGFTFPMGHKFNKVPIIKFMSYLTSHIYLMIHLSIVGITPIYPVLRLSLVPYWYEVGLLIWLSGLLLFELTNPSDKSGLGSIKVLVLLLGMAGVGVHVSAFLFVSKEYWPTLVYCRNQCFALAFLLACVQILDFLSFHHLFGPWAIIIGDLLKDLARFLAVLAIFVFGFSMHIVALNQSFANFSPEDLRSFEKKNRNRGYFSDVRMHPINSFELLFFAVFGQTTTEQTQVDKIKNVATPTQPYWVEYLFKIVFGIYMLVSVVVLINLLIAMMSDTYQRIQAQSDIEWKFGLSKLIRNMHRTTTAPSPLNLVTTWFMWIVEKVKARMKKKKRPSLVQMMGIRQASPRTKAGAKWLSKIKKDSVALSQVHLSPLGSQASFSQANQNRIENVADWEAIAKKYRALVGDEEG 1693          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0343224)

HSP 1 Score: 297.745 bits (761), Expect = 1.134e-87
Identity = 225/554 (40.61%), Postives = 320/554 (57.76%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLF--FILIFPVSWLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQ--PYNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSY-FIKTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLS------GTYQPIILQS--KTSNSEETNKDI----IDMAILLYFSVFGQVTP-----DDLPN--PDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLY---------------SSILYYKIRNIPIESLLE----DEVDDPEHKSRRKSQVSPNILEASKT-SRHGSEKLEEVVNWSDIINKYLAIRGNKSG 1577
            + +Y+LM+ SK +N K I+EF+ VSPAP +TAAKLS +Y +LS KEKER+KDL    K CEAM T+L+ALAA    A K+L++ DK  ++FLD+LIE EQKEVI+H  VQ+YL  +W G+L W +WK  LL   FI+  PV W+   FP G    K P+IKF+ YL SHI + I L IV      P  R  + P   E  L IWL+GL L EL NP D+S +  +++L+L+L +A V VH  ++ F+     P ++Y RNQ    +  L  V  LDFLSFHHLFGPW II+ +L++DL +FL    IF+F F+  +         + P  L+S  K + +     D+    I+   LL+F+VFGQ T      D + N      P + + L + +F   +++ ++VL+NLLIAMM+DTYQRIQA+SDIEWKFG +KLIRNM  TT  PSP  ++  ++++               S +    IR     +        ++   E  S   SQV  + L +  + S+    ++E V +W  I  KY A+ G++ G
Sbjct: 1144 RFVYNLMVVSKNHNNKPIQEFVLVSPAPVDTAAKLSNIYIVLSTKEKERAKDLVAAGKQCEAMATELLALAAGSDSAGKILQATDKRNVEFLDVLIENEQKEVIAHTVVQRYLQELWHGSLTWASWKILLLLVAFIVCPPV-WIGFTFPMGHKFNKVPIIKFMSYLTSHIYLMIHLSIVGITPIYPVLRLSLVPYWYEVGLLIWLSGLLLFELTNPSDKSGLGSIKVLVLLLGMAGVGVHVSAFLFVSKEYWPTLVYCRNQCFALAFLLACVQILDFLSFHHLFGPWAIIIGDLLKDLARFLAVLAIFVFGFSMHIVALNQSFANFSPEDLRSFEKKNRNRGYFSDVRMHPINSFELLFFAVFGQTTTEQTQVDKIKNVATPTQPYWVEYLFKIVFGIYMLVSVVVLINLLIAMMSDTYQRIQAQSDIEWKFGLSKLIRNMHRTTTAPSPLNLVTTWFMWIVEKVKARMKKKKRPSLVQMMGIRQASPRTKAGAKWLSKIKKGETYSVALSQVHLSPLGSQASFSQANQNRIENVADWEAIAKKYRALVGDEEG 1696          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0347408)

HSP 1 Score: 295.049 bits (754), Expect = 1.142e-86
Identity = 227/574 (39.55%), Postives = 320/574 (55.75%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLF--FILIFPVSWLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQ--PYNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSY-FIKTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLS------GTYQPIILQS------------------------------KTSNSEETNKDIIDMAILLYF-----SVFGQVTPDDL-PNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLY---------------SSILYYKIRNI-PIESLLEDEVDDPEHKSRRKSQVSPNILEASKT-SRHGSEKLEEVVNWSDIINKYLAIRGNKSG 1577
            + +Y+LM+ SK +N K I+EF+ VSPAP +TAAKLS +Y +LS KEKER+KDL    K CEAM T+L+ALAA    A K+L++ DK  ++FLD+LIE EQKEVI+H  VQ+YL  +W G+L W +WK  LL   FI+  PV W+   FP G    K P+IKF+ YL SHI + I L IV      P  R  + P   E  L IWL+GL L EL NP D+S +  +++L+L+L +A V VH  ++ F+     P ++Y RNQ    +  L  V  LDFLSFHHLFGPW II+ +L++DL +FL    IF+F F+  +         + P  L+S                              + S     +KD   M   L F     +VFGQ T  D+ P   + P++++ L +F+F   L++ ++VL+NLLIAMM+DTYQRIQA+SDIEWKFG +KLIRNM  TT  PSP  ++  ++++               S +    IR   P        +   +  S   SQV  + L +  + S+    ++E V +W  I  KY A+ G++ G
Sbjct: 1144 RFVYNLMVVSKNHNNKPIQEFVLVSPAPVDTAAKLSNIYIVLSTKEKERAKDLVAAGKQCEAMATELLALAAGSDSAGKILQATDKRNVEFLDVLIENEQKEVIAHTVVQRYLQELWHGSLTWASWKILLLLVAFIVCPPV-WIGFTFPMGHKFNKVPIIKFMSYLTSHIYLMIHLSIVGITPIYPVLRLSLVPYWYEVGLLIWLSGLLLFELTNPSDKSGLGSIKVLVLLLGMAGVGVHVSAFLFVSKEYWPTLVYCRNQCFALAFLLACVQILDFLSFHHLFGPWAIIIGDLLKDLARFLAVLAIFVFGFSMHIVALNQSFANFSPEDLRSFEKKNRNRGYFSDDDMPTPRPPPVENYVDSRFSEFRRKHKDDRPMTPFLAFERLFFAVFGQTTTLDINPMRHLRPEWTEVLFKFVFGIYLLVSVVVLINLLIAMMSDTYQRIQAQSDIEWKFGLSKLIRNMHRTTTAPSPLNLVTTWFMWIVEKVKARMKKKKRPSLVQMMGIRQASPRTKAGAKWLSKIKKDSVALSQVHLSPLGSQASFSQANQNRIENVADWEAIAKKYRALVGDEEG 1716          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0347409)

HSP 1 Score: 238.81 bits (608), Expect = 1.693e-67
Identity = 144/297 (48.48%), Postives = 193/297 (64.98%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLF--FILIFPVSWLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQ--PYNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSY-FIKTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRD 923
            + +Y+LM+ SK +N K I+EF+ VSPAP +TAAKLS +Y +LS KEKER+KDL    K CEAM T+L+ALAA    A K+L++ DK  ++FLD+LIE EQKEVI+H  VQ+YL  +W G+L W +WK  LL   FI+  PV W+   FP G    K P+IKF+ YL SHI + I L IV      P  R  + P   E  L IWL+GL L EL NP D+S +  +++L+L+L +A V VH  ++ F+     P ++Y RNQ    +  L  V  LDFLSFHHLFGPW II+ +L++D
Sbjct: 1144 RFVYNLMVVSKNHNNKPIQEFVLVSPAPVDTAAKLSNIYIVLSTKEKERAKDLVAAGKQCEAMATELLALAAGSDSAGKILQATDKRNVEFLDVLIENEQKEVIAHTVVQRYLQELWHGSLTWASWKILLLLVAFIVCPPV-WIGFTFPMGHKFNKVPIIKFMSYLTSHIYLMIHLSIVGITPIYPVLRLSLVPYWYEVGLLIWLSGLLLFELTNPSDKSGLGSIKVLVLLLGMAGVGVHVSAFLFVSKEYWPTLVYCRNQCFALAFLLACVQILDFLSFHHLFGPWAIIIGDLLKD 1439          

HSP 2 Score: 81.6481 bits (200), Expect = 1.193e-15
Identity = 68/195 (34.87%), Postives = 103/195 (52.82%), Query Frame = 3
Query: 1065 LLYFSVFGQVTP-----DDLPN--PDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLY---------------SSILYYKIRNI-PIESLLEDEVDDPEHKSRRKSQVSPNILEASKT-SRHGSEKLEEVVNWSDIINKYLAIRGNKSG 1577
            LL+F+VFGQ T      D + N      P + + L + +F   +++ ++VL+NLLIAMM+DTYQRIQA+SDIEWKFG +KLIRNM  TT  PSP  ++  ++++               S +    IR   P        +   +  S   SQV  + L +  + S+    ++E V +W  I  KY A+ G++ G
Sbjct: 1528 LLFFAVFGQTTTEQTQVDKIKNVATPTQPYWVEYLFKIVFGIYMLVSVVVLINLLIAMMSDTYQRIQAQSDIEWKFGLSKLIRNMHRTTTAPSPLNLVTTWFMWIVEKVKARMKKKKRPSLVQMMGIRQASPRTKAGAKWLSKIKKDSVALSQVHLSPLGSQASFSQANQNRIENVADWEAIAKKYRALVGDEEG 1722          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01073736.1 (pep chromosome:GRCz11:19:1465004:1479740:1 gene:ENSDARG00000099438.2 transcript:ENSDART00000159157.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01073736.1)

HSP 1 Score: 262.307 bits (669), Expect = 5.547e-77
Identity = 187/539 (34.69%), Postives = 313/539 (58.07%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADK----LLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFILIFPVSWLYAMFPKGKILFKS-PVIKFVVYLFSHI-IMTILLLIVAYD--QPYNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSYFIKTLELPEM--IYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPIILQSK-TSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLYSSILYYKIRNI----PIESLLEDEVDDPEHKSR----------------RKSQVSPNILEASKTSRHGSEKLEEVVNWSDIINKYLAIRGNK 1571
            K +++LM+C ++N+  ++EE +  + AP +TA +LS+   + + +EKERS DLQ  + +CE M +DL++L+A   G       +L++ D  G+  LD LIE  QK V+S  +VQ YL+ VW G L W +WK  LLF  L+        +       F + P++KF+ +L SHI ++T+ +L + Y    P ++ R+ P+  E +L IWL G+ +SEL  P +R+ +A +R+L+L  S A+++ H ++ F +      +  ++ RN +L  +  L F+  L+FL+FHHLFGPW II+R+LI+DL +F V  ++F  AF   L+   QP+  Q +  + +E T    ++M++LL+F++FG   PD +P+ D +P  +  LA+ +F   L++  IVL+NLLIAMM+DTYQRIQA+SD EWKFGRA LIR+M   + +PSPF +    +    ++  +   +      + + EDE  +   +SR                +++Q+ P   + S     G  ++E V +W  ++ ++L+ R  +
Sbjct:  358 KFIFNLMVCGRMNDNLSLEELVLHTSAPLDTAVRLSRALTLCALREKERSVDLQAAAHHCELMASDLLSLSASAGGQGAGAGPILRALDHRGLSVLDCLIEGRQKGVVSQPAVQTYLTEVWCGGLQWDSWKILLLFCCLLLCPPLWLLLALPLTHSFNTIPIVKFMSHLVSHIFLLTLFILTIVYPPVSPLSQARLMPSWSECLLLIWLCGMLVSELTFPGERTGLAWIRLLLLGFSAAALLCHLLAVFTQWWPPTHLHCLFARNVLLAVAMTLGFIQLLEFLTFHHLFGPWAIIIRDLIKDLCRFAVILMLFHTAFTLSLTALCQPLYPQEQHNTTTEVTVPGPLNMSVLLFFALFGLTEPDKIPDVDRSPPATAVLAKMVFGVYLVVTFIVLINLLIAMMSDTYQRIQAQSDTEWKFGRAVLIRDMSRKSGIPSPFNLFTNLFYSVKVVCKRAGKMCSSESRDVMNEDEDAEGLSESRSLDLLSQASVSGIRGNKRTQILPEGGQISLAHSGGHVRVENVADWPSVVQQFLSQRRQR 896          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: trpc2a (transient receptor potential cation channel subfamily C member 2a [Source:ZFIN;Acc:ZDB-GENE-130530-602])

HSP 1 Score: 76.2554 bits (186), Expect = 4.793e-14
Identity = 120/493 (24.34%), Postives = 213/493 (43.20%), Query Frame = 3
Query:   57 YDLM--ICSKLNNYKTIEEFIHVSPAPAE---TAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKN----------------GIQFLDILIETEQKEVISHASVQKYLSVVWKGNL-NW----PTWKFCL-LFFILIFPVSWL-YAMFPKGKI--LFKSPVIKFVVYLFSHIIMTILLLIVAYDQPYNRKRVFPT---------HLEWILF--------IWLTGL--FLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFM----------SYFIKTL------ELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPIILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKL-IRNMKHTTPVPSPFIII 1337
            YDL+    S++N Y+ I    ++S    +   +A  LSK    LS KE E       + + C+    +L+ +   +S    +L S + +                 +  L + +   QK+ ++H   Q+ LS +W G+L  W     TWK  + L   L  PV  L Y + PK K+  L K PVIKF+++  S++   I LL  +      R               H+ W+          +W+ GL  +  +L N +D   +++      +  +  +  +F+           YF  T+      E P++I     +   ++ L F      L  H   G   I +  +I D+ +F+   +I   AF C ++  Y P ++        ET          L++++FG      +  PD     ++ + R  +    ++I+IVL+N+LIAM+++++QRI+  +D+EWKF R+KL +   +    +P PF II
Sbjct:  185 YDLLKFSLSRINTYRGIASRAYLSITSEDAMLSAFHLSKELRKLSKKEPEFKPQYLALEELCQEFAVELLGMCRNQSEVSTILNSAEGDSEDEELDEQTFEEGIPNLARLRLAVNYNQKQFVTHPICQQVLSSIWCGSLSGWRGSRTTWKLLVSLGIFLTMPVLCLIYWIAPKSKLGKLLKVPVIKFLLHSASYMWFLIALLTESIFMEIYRTEFASRNQNILHNSLHMVWVAGFFWFECKEVWIEGLKSYFLDLWNILDMMVLSMYLASFTLRILIMLKGYFLCQDSSTQELCDYFTNTVRENWRQEDPQLI--AETLFAVTSMLSFTRLAYILPAHESLGTLQISMGRMIDDMMRFMFILMIIGTAFLCGINNIYVPYVISPHLGRLNETFN-------FLFWTMFGMANQGYVDMPDYA--LAEFVGRIFYGIFTLLIVIVLLNMLIAMISNSFQRIEDDADVEWKFARSKLYLSYFREGLTMPVPFNII 666          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: trpc2b (transient receptor potential cation channel subfamily C member 2b [Source:ZFIN;Acc:ZDB-GENE-050712-3])

HSP 1 Score: 71.633 bits (174), Expect = 1.593e-12
Identity = 123/496 (24.80%), Postives = 222/496 (44.76%), Query Frame = 3
Query:   57 YDLM--ICSKLNNYKTIEEFIHVSPAPAE---TAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKS---YDKNGIQFLD---------------ILIETEQKEVISHASVQKYLSVVWKGNL-NW----PTWKFCLLFFI-LIFP-VSWLYAMFPKGKI--LFKSPVIKFVVYLFSHIIMTILLLIVAYDQPYNRKRVFPT----------HLEWILF--------IWLTGL--FLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMS----------YFIKTL------ELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPIILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKL-IRNMKHTTPVPSPFIII 1337
            YDL+    S++N Y+ I    ++S    +   +A +LS+    LS KE E       + + C+    +L+ +   +S    +L S    D++    LD               + +   QK+ ++H   Q+ LS +W GNL  W     +WK  + F I L  P +  +Y + PK K+  + K PVIKF+++  S++   I LL  +      R+  F T          H+ W++         +W+ GL  +  +  N +D   +++      +  +  + VHF+           YF +T+      E P+  +I   +   ++ L F      L  H   G   I + ++I D+ +F+   +I   AF C ++  Y P I+        ET          L++++FG      +  P      ++ + R ++    +II+IVL+N+LIAM+T+++Q+I+  +D+EWKF R+KL +   +    +P PF II
Sbjct:  185 YDLLKFSLSRINTYRGIASRAYLSITAEDAMLSAFRLSRDLRKLSKKEPEFKPQYLSLEQVCQEFAVELLGMCRNQSEVTTILNSCGDRDEDSEDELDHQTFEEGIPNLARLRLAVNYNQKQFVAHPICQQVLSSIWCGNLSGWRGSRTSWKLLVSFGIFLTMPFLCLIYWIAPKSKLGKILKIPVIKFLLHSASYMWFLITLLGESIAMEVYRES-FATRQHTILHNSFHMVWVVGFFWFECKEVWIEGLRSYFLDWWNCLDVMVLSMYLASFALRLVIMLKVHFLCQLQDNQDECVYFTETMRDQWHQEDPQ--FISEVLFAVTSMLSFTRLAYILPAHESLGTLQISIGKMIDDMMRFMFILVIIGTAFLCGINNIYVPYIISPNLGKLNETFS-------FLFWTMFGMADQTYVDMPAFA--LAELVGRILYGIYTLIIVIVLLNMLIAMITNSFQKIEDDADVEWKFARSKLYLSYFREGLTMPVPFNII 668          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: trpc5a (transient receptor potential cation channel, subfamily C, member 5a [Source:ZFIN;Acc:ZDB-GENE-040812-1])

HSP 1 Score: 51.6026 bits (122), Expect = 2.341e-6
Identity = 60/229 (26.20%), Postives = 100/229 (43.67%), Query Frame = 3
Query:   75 SKLNNYKTIEE---FIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQF----------LDILIETEQKEVISHASVQKYLSVVWKGNLNWPTW-------KFCLLFFI-LIFPV-SWLYAMFPKG--KILFKSPVIKFVVYLFSHIIMTILLLIVAYDQPYNRKRVF-----PTHLEWILFIWLTGLFLSEL 674
            S+LN YK +         S  P  TA +L      LS  E E  ++ + +S+ C+    DL+  A      + +L   D    +           L + I+  QKE ++  + Q+ L+ +W     +P W       K  + F I L+FPV S +Y + PK    +  K P IKF+ +  S++    LLL+ +  Q   R  +      PT +EW++  W+ G   +E+
Sbjct:  198 SRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKLFAKDLLDQARSSRELETILNHRDDQSEELDPRECRDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDG--FPGWRRRHWAVKLVMCFIIGLLFPVFSLVYLLAPKSTLGLFIKKPFIKFICHTASYLTFLFLLLLAS--QHIARTNLHMQGPPPTVVEWMILPWVLGFIWAEI 422          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: trpc5a (transient receptor potential cation channel, subfamily C, member 5a [Source:ZFIN;Acc:ZDB-GENE-040812-1])

HSP 1 Score: 51.2174 bits (121), Expect = 3.128e-6
Identity = 60/229 (26.20%), Postives = 100/229 (43.67%), Query Frame = 3
Query:   75 SKLNNYKTIEE---FIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQF----------LDILIETEQKEVISHASVQKYLSVVWKGNLNWPTW-------KFCLLFFI-LIFPV-SWLYAMFPKG--KILFKSPVIKFVVYLFSHIIMTILLLIVAYDQPYNRKRVF-----PTHLEWILFIWLTGLFLSEL 674
            S+LN YK +         S  P  TA +L      LS  E E  ++ + +S+ C+    DL+  A      + +L   D    +           L + I+  QKE ++  + Q+ L+ +W     +P W       K  + F I L+FPV S +Y + PK    +  K P IKF+ +  S++    LLL+ +  Q   R  +      PT +EW++  W+ G   +E+
Sbjct:  220 SRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKLFAKDLLDQARSSRELETILNHRDDQSEELDPRECRDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDG--FPGWRRRHWAVKLVMCFIIGLLFPVFSLVYLLAPKSTLGLFIKKPFIKFICHTASYLTFLFLLLLAS--QHIARTNLHMQGPPPTVVEWMILPWVLGFIWAEI 444          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: snx14 (sorting nexin 14 [Source:Xenbase;Acc:XB-GENE-984188])

HSP 1 Score: 320.472 bits (820), Expect = 2.041e-95
Identity = 211/538 (39.22%), Postives = 314/538 (58.36%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFI-LIFPVSWLYAMFPKGKILFKSPVIKFVVYLFSHIIMTIL-LLIVAYD--QPYNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSYFIKTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPIILQS-------KTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLYSSIL---YYKIRNIPIESLLEDEVDDPEHKSR------------------RKSQVSPNILEASKTSRHGSEKLEEVVNWSDIINKYLAIRG 1565
            K ++DLM+C KLNN + I+EFI  S AP +TA KLS+   I + KEKER+ DL   +KY E M T+L+ +A+  + A  +L++ D      LD LIE EQK+V++H +VQKYL+ VW G+L+W TWK  LLFF  L  P  WL    P      K P++KF+ YL SHI + +L +L + Y    P    R+ P   EW+L  WL+G  +SEL +  +R+ +A +R+ +L  S  +   H +++     +    ++ RN +LG +  L FV  L+FL+FHHLFGPW II+R+LI+DL +F V   +F  AF   LS  YQP+  ++       +T +SE   +D ID+ +LL+FS+FG V P  LP+ + TP+++  + RF+F   L++ +IVL+NLLIAMM+DTYQRIQA+SD EWKFGRA LIR+M      PSPF +    + Y  +L     K+ +    +L+ +E  D    +R                  R  QV+P           G  K+E++ +W ++  +YL+++G
Sbjct:  942 KFVFDLMVCGKLNNNRVIQEFILNSIAPLDTAVKLSRALNITAFKEKERAVDLLNAAKYSENMATELLTIASGSTNAGFILRAVDHRCTTILDCLIECEQKDVVAHPAVQKYLTEVWYGSLDWATWKLVLLFFTFLACPPVWLVFSLPLKHRFNKIPIMKFMSYLASHIFLIVLFILTIVYPPLSPIYEGRMVPCWNEWLLLAWLSGTLVSELTHHGERAGLAWIRVFVLGFSAVAFFCHLLAFLFSDRDRLHCLFARNILLGVAMTLSFVQFLEFLTFHHLFGPWAIIIRDLIKDLTRFAVILAMFHVAFTMQLSAVYQPVYPEATSAQSLNETVHSESNIQDPIDITVLLFFSLFGLVEPGCLPSLNRTPQFTFVIVRFVFGVYLIVTLIVLINLLIAMMSDTYQRIQAQSDTEWKFGRATLIRDMTRKPGTPSPFNLFTNLFYYVKLLCKHKGKLCSANARNLMSEEDIDGFSDTRSIDLLAQTSLSWIRTPAKRTMQVAPEGGLNRDQHYPGPVKIEDMTDWHNVGVRYLSLKG 1479          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: snx14 (sorting nexin 14 [Source:Xenbase;Acc:XB-GENE-984188])

HSP 1 Score: 313.538 bits (802), Expect = 2.492e-93
Identity = 195/451 (43.24%), Postives = 281/451 (62.31%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFI-LIFPVSWLYAMFPKGKILFKSPVIKFVVYLFSHIIMTIL-LLIVAYD--QPYNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSYFIKTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPIILQS-------KTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLYSSIL 1367
            K ++DLM+C KLNN + I+EFI  S AP +TA KLS+   I + KEKER+ DL   +KY E M T+L+ +A+  + A  +L++ D      LD LIE EQK+V++H +VQKYL+ VW G+L+W TWK  LLFF  L  P  WL    P      K P++KF+ YL SHI + +L +L + Y    P    R+ P   EW+L  WL+G  +SEL +  +R+ +A +R+ +L  S  +   H +++     +    ++ RN +LG +  L FV  L+FL+FHHLFGPW II+R+LI+DL +F V   +F  AF   LS  YQP+  ++       +T +SE   +D ID+ +LL+FS+FG V P  LP+ + TP+++  + RF+F   L++ +IVL+NLLIAMM+DTYQRIQA+SD EWKFGRA LIR+M      PSPF +    + Y  +L
Sbjct:  854 KFVFDLMVCGKLNNNRVIQEFILNSIAPLDTAVKLSRALNITAFKEKERAVDLLNAAKYSENMATELLTIASGSTNAGFILRAVDHRCTTILDCLIECEQKDVVAHPAVQKYLTEVWYGSLDWATWKLVLLFFTFLACPPVWLVFSLPLKHRFNKIPIMKFMSYLASHIFLIVLFILTIVYPPLSPIYEGRMVPCWNEWLLLAWLSGTLVSELTHHGERAGLAWIRVFVLGFSAVAFFCHLLAFLFSDRDRLHCLFARNILLGVAMTLSFVQFLEFLTFHHLFGPWAIIIRDLIKDLTRFAVILAMFHVAFTMQLSAVYQPVYPEATSAQSLNETVHSESNIQDPIDITVLLFFSLFGLVEPGCLPSLNRTPQFTFVIVRFVFGVYLIVTLIVLINLLIAMMSDTYQRIQAQSDTEWKFGRATLIRDMTRKPGTPSPFNLFTNLFYYVKLL 1304          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085])

HSP 1 Score: 52.373 bits (124), Expect = 1.798e-6
Identity = 55/242 (22.73%), Postives = 101/242 (41.74%), Query Frame = 3
Query:   75 SKLNNYKTIEEFIHVSPA---PAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKS-YDKNGIQF----------LDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFILIFPVS----------WLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQPYNRKRVFPTH-------------------LEWILFIWLTGLFLSE 671
            S++N YK +    ++S +   P  TA +LS    +L+  EKE   D + +S  C+     L+ L       + +L    D NG             L + I+ E K+ ++H + Q+ L  +W  NL+    +   + F+++  V+          W+      GKI+ + P +KFV +  S  I   LL++ A D+ +   ++ P                     +E ++  W+ G+  SE
Sbjct:  197 SRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVDTNGGNVELDGRPSLCRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTTAVKFLVVLAVAMGLPFLAMVYWIAPCSKLGKIM-RGPFMKFVAHAASFTIFLGLLVMNAADR-FEGTKILPNESLTDNAKQLFRMKTSCFSWMELLIISWVIGMIWSE 436          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085])

HSP 1 Score: 52.373 bits (124), Expect = 2.120e-6
Identity = 55/242 (22.73%), Postives = 101/242 (41.74%), Query Frame = 3
Query:   75 SKLNNYKTIEEFIHVSPA---PAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKS-YDKNGIQF----------LDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFILIFPVS----------WLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQPYNRKRVFPTH-------------------LEWILFIWLTGLFLSE 671
            S++N YK +    ++S +   P  TA +LS    +L+  EKE   D + +S  C+     L+ L       + +L    D NG             L + I+ E K+ ++H + Q+ L  +W  NL+    +   + F+++  V+          W+      GKI+ + P +KFV +  S  I   LL++ A D+ +   ++ P                     +E ++  W+ G+  SE
Sbjct:  214 SRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVDTNGGNVELDGRPSLCRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTTAVKFLVVLAVAMGLPFLAMVYWIAPCSKLGKIM-RGPFMKFVAHAASFTIFLGLLVMNAADR-FEGTKILPNESLTDNAKQLFRMKTSCFSWMELLIISWVIGMIWSE 453          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-5933085])

HSP 1 Score: 52.373 bits (124), Expect = 2.141e-6
Identity = 55/242 (22.73%), Postives = 101/242 (41.74%), Query Frame = 3
Query:   75 SKLNNYKTIEEFIHVSPA---PAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKS-YDKNGIQF----------LDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFILIFPVS----------WLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQPYNRKRVFPTH-------------------LEWILFIWLTGLFLSE 671
            S++N YK +    ++S +   P  TA +LS    +L+  EKE   D + +S  C+     L+ L       + +L    D NG             L + I+ E K+ ++H + Q+ L  +W  NL+    +   + F+++  V+          W+      GKI+ + P +KFV +  S  I   LL++ A D+ +   ++ P                     +E ++  W+ G+  SE
Sbjct:  227 SRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVDTNGGNVELDGRPSLCRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTTAVKFLVVLAVAMGLPFLAMVYWIAPCSKLGKIM-RGPFMKFVAHAASFTIFLGLLVMNAADR-FEGTKILPNESLTDNAKQLFRMKTSCFSWMELLIISWVIGMIWSE 466          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Xntrpc (Xndc1-transient receptor potential cation channel, subfamily C, member 2 readthrough [Source:MGI Symbol;Acc:MGI:5546370])

HSP 1 Score: 54.6842 bits (130), Expect = 3.437e-7
Identity = 67/245 (27.35%), Postives = 107/245 (43.67%), Query Frame = 3
Query:   57 YDLM--ICSKLNNYKTIEEFIHVSPAPAET---AAKLSKLYFILSGKEKERSKDLQMISKYCE-------AMC----------TDLVALAAYESGADKLLKSYDKN--GIQFLDILIETEQKEVISHASVQKYLSVVWKGNL-NW----PTWKFCLLFFI-LIFPVSWL-YAMFPKGKI--LFKSPVIKFVVYLFSHIIMTILLL---IVAYDQPYNRK----RVFPTHLEWILFIWLTGLFLSE 671
            YDL+    S++N Y+ I    H+S A  +    A +LS+    L+ KE E       +   C+        MC           DL   +  E  A+ L +++++    +  L + +   QK+ ++H   Q+ LS +W GNL  W      WK  + F I L  P   + Y + PK ++  L K PV+KF+++  S++   I LL   +V   Q    K     V+ T L     IW+TG    E
Sbjct:  568 YDLLKFSLSRINTYRGIASRAHLSLASEDAMLAAFQLSRELRRLARKEPEFKPQYIALESLCQDYGFELLGMCRNQSEVTAVLNDLGEDSETEPEAEGLGQAFEEGIPNLARLRLAVNYNQKQFVAHPICQQVLSSIWCGNLAGWRGSTTIWKLFVAFLIFLTMPFLCIGYWLAPKSQLGRLLKIPVLKFLLHSASYLWFLIFLLGESLVMETQLSTFKGRSQSVWETSLH---MIWVTGFLWFE 809          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Trpc2 (transient receptor potential cation channel, subfamily C, member 2 [Source:MGI Symbol;Acc:MGI:109527])

HSP 1 Score: 51.6026 bits (122), Expect = 2.792e-6
Identity = 56/205 (27.32%), Postives = 93/205 (45.37%), Query Frame = 3
Query:   57 YDLM--ICSKLNNYKTIEEFIHVSPAPAET---AAKLSKLYFILSGKEKERSKDLQMISKYCE-------AMC----------TDLVALAAYESGADKLLKSYDKN--GIQFLDILIETEQKEVISHASVQKYLSVVWKGNL-NWPT----WKFCLLFFI-LIFPVSWL-YAMFPKGKI--LFKSPVIKFVVYLFSHIIMTILLL 572
            YDL+    S++N Y+ I    H+S A  +    A +LS+    L+ KE E       +   C+        MC           DL   +  E  A+ L +++++    +  L + +   QK+ ++H   Q+ LS +W GNL  W      WK  + F I L  P   + Y + PK ++  L K PV+KF+++  S++   I LL
Sbjct:  194 YDLLKFSLSRINTYRGIASRAHLSLASEDAMLAAFQLSRELRRLARKEPEFKPQYIALESLCQDYGFELLGMCRNQSEVTAVLNDLGEDSETEPEAEGLGQAFEEGIPNLARLRLAVNYNQKQFVAHPICQQVLSSIWCGNLAGWRGSTTIWKLFVAFLIFLTMPFLCIGYWLAPKSQLGRLLKIPVLKFLLHSASYLWFLIFLL 398          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Trpc6 (transient receptor potential cation channel, subfamily C, member 6 [Source:MGI Symbol;Acc:MGI:109523])

HSP 1 Score: 50.8322 bits (120), Expect = 4.537e-6
Identity = 47/194 (24.23%), Postives = 85/194 (43.81%), Query Frame = 3
Query:   75 SKLNNYKTIEEFIHVS---PAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKS---------YDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFILIFPVS----------WLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQ 590
            S++N YK +    ++S     P  TA +LS    +L+  EKE   D + +S  C+     L+ L       + +L           + +  +  L + I+ E K+ ++H + Q+ L  +W  NL+    +   + F+++  V+          W       GKIL + P +KFV +  S  I   LL++ A D+
Sbjct:  271 SRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYRKLSMQCKDFVVGLLDLCRNTEEVEAILNGDAETRQPGDFGRPNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFLALIYWCAPCSKMGKIL-RGPFMKFVAHAASFTIFLGLLVMNAADR 463          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Trpc6 (transient receptor potential cation channel, subfamily C, member 6 [Source:MGI Symbol;Acc:MGI:109523])

HSP 1 Score: 50.8322 bits (120), Expect = 4.768e-6
Identity = 47/194 (24.23%), Postives = 85/194 (43.81%), Query Frame = 3
Query:   75 SKLNNYKTIEEFIHVS---PAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKS---------YDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFILIFPVS----------WLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQ 590
            S++N YK +    ++S     P  TA +LS    +L+  EKE   D + +S  C+     L+ L       + +L           + +  +  L + I+ E K+ ++H + Q+ L  +W  NL+    +   + F+++  V+          W       GKIL + P +KFV +  S  I   LL++ A D+
Sbjct:  271 SRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYRKLSMQCKDFVVGLLDLCRNTEEVEAILNGDAETRQPGDFGRPNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFLALIYWCAPCSKMGKIL-RGPFMKFVAHAASFTIFLGLLVMNAADR 463          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Trpc7 (transient receptor potential cation channel, subfamily C, member 7 [Source:MGI Symbol;Acc:MGI:1349470])

HSP 1 Score: 50.0618 bits (118), Expect = 9.281e-6
Identity = 57/239 (23.85%), Postives = 100/239 (41.84%), Query Frame = 3
Query:   75 SKLNNYKTIEEFIHVSPA---PAETAAKLSKLYFILSGKEKERSKDLQMISKYCEA-------MCTDLVALAAYESGADKLL--KSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFILIFPVS----------WLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQ---------------PYNRKRVFPTHLEW---ILFIWLTGLFLSE 671
            S++N YK +    ++S +   P  TA +LS     L+  E E   D + +S  C+        +C D   + A  +G   L     + +  +  + + I+ E K+ ++H + Q+ L  +W  NL+    +   + F+ +F VS          W+      G+ L +SP +KFV +  S  I   LL++ A D+               P    RV  T   W   ++  W+ G+  SE
Sbjct:  217 SRMNAYKGLASAAYLSLSSEDPVLTALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDVNLQVWSDHHRPSLSRIKLAIKYEVKKFVAHPNCQQQLLTMWYENLSGLRQQSIAVKFLAVFGVSIGLPFLAIAYWIAPCSKLGQTL-RSPFMKFVAHAVSFTIFLGLLVVNASDRFEGVKTLPNETFTDYPKQIFRVKTTQFSWTEMLIMKWVLGMIWSE 454          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9R244|TRPC2_MOUSE (Short transient receptor potential channel 2 OS=Mus musculus OX=10090 GN=Trpc2 PE=2 SV=2)

HSP 1 Score: 54.6842 bits (130), Expect = 2.229e-6
Identity = 67/245 (27.35%), Postives = 107/245 (43.67%), Query Frame = 3
Query:   57 YDLM--ICSKLNNYKTIEEFIHVSPAPAET---AAKLSKLYFILSGKEKERSKDLQMISKYCE-------AMC----------TDLVALAAYESGADKLLKSYDKN--GIQFLDILIETEQKEVISHASVQKYLSVVWKGNL-NW----PTWKFCLLFFI-LIFPVSWL-YAMFPKGKI--LFKSPVIKFVVYLFSHIIMTILLL---IVAYDQPYNRK----RVFPTHLEWILFIWLTGLFLSE 671
            YDL+    S++N Y+ I    H+S A  +    A +LS+    L+ KE E       +   C+        MC           DL   +  E  A+ L +++++    +  L + +   QK+ ++H   Q+ LS +W GNL  W      WK  + F I L  P   + Y + PK ++  L K PV+KF+++  S++   I LL   +V   Q    K     V+ T L     IW+TG    E
Sbjct:  476 YDLLKFSLSRINTYRGIASRAHLSLASEDAMLAAFQLSRELRRLARKEPEFKPQYIALESLCQDYGFELLGMCRNQSEVTAVLNDLGEDSETEPEAEGLGQAFEEGIPNLARLRLAVNYNQKQFVAHPICQQVLSSIWCGNLAGWRGSTTIWKLFVAFLIFLTMPFLCIGYWLAPKSQLGRLLKIPVLKFLLHSASYLWFLIFLLGESLVMETQLSTFKGRSQSVWETSLH---MIWVTGFLWFE 717          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y210|TRPC6_HUMAN (Short transient receptor potential channel 6 OS=Homo sapiens OX=9606 GN=TRPC6 PE=1 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 6.537e-6
Identity = 49/194 (25.26%), Postives = 91/194 (46.91%), Query Frame = 3
Query:   75 SKLNNYKTIEEFIHVSPA---PAETAAKLSKLYFILSGKEKERSKDLQMISKYCEA-------MCTDLVALAAYESGADKLLKSYD--KNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFILIFPVS----------WLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQ 590
            S++N YK +    ++S +   P  TA +LS    +L+  EKE   D + +S  C+        +C +   + A  +G  + L+S D  +  +  L + I+ E K+ ++H + Q+ L  +W  NL+    +   + F+++  V+          W       GKI+ + P +KFV +  S  I   LL++ A D+
Sbjct:  272 SRINAYKGLASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVETLQSGDHGRPNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFLALIYWFAPCSKMGKIM-RGPFMKFVAHAASFTIFLGLLVMNAADR 464          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267FPR4 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014653g1 PE=3 SV=1)

HSP 1 Score: 396.741 bits (1018), Expect = 1.083e-118
Identity = 240/526 (45.63%), Postives = 336/526 (63.88%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGAD---KLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLF--FILIFPVSWLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQP------YNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSYFI--KTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPIILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLYSSILYYKIRNIPIESLLEDEVD----DPEHKS---RRKSQVSPNILEASKTSRHGSEKLEEVVNWSDIINKYLAIRG 1565
            K LY++M+CSK++  KT+EEFI VSPAPAETAAKLSK + ILS +EKER+K+L  + KYCE MCT+LVA+AA ESG D   KLLK+ D  G+QFLDIL+ETEQKEVI+H +VQ+YL+ VWKGNL+WPTWKF LLF  F+ I PV   +++        + PVIKF+ YL +H+ +  L + VA +        Y R+ + PT LE +L +WL+G  +SEL NP DRS + + +++++ ++   V+ H  ++ +   T    + ++ RNQ+   +T LCFV+ L+FL+FHHLFGPW+II+R+L+RDL +FLV   IF+  F   L   Y P+             K ++    LL+F++FG + PD+LPN   +P ++  L + IF C L+I +IVL+NLLIAMM+DTY+RI+A SD EWKFGRAKLI NM  T+  P+P I++ Q          K R      L ED+VD    D  H      R +Q S    E +   R G  K+E+VV+W  +I K+ +I G
Sbjct: 1229 KFLYNIMLCSKISGNKTLEEFILVSPAPAETAAKLSKKFVILSEREKERAKELVQMGKYCENMCTELVAVAAAESGGDGAAKLLKAVDNRGVQFLDILLETEQKEVIAHPAVQRYLTDVWKGNLDWPTWKFLLLFTVFLAIPPVMMAFSLPLSCNRYHRKPVIKFIAYLIAHVHLIFLFVFVAVEPEWLGPPYYTRRDLMPTWLECLLLLWLSGQLVSELTNPADRSGLGIFKVIVIAVAAVGVITHLAAFALPSDTNARLDALFARNQLFAFATLLCFVMFLEFLTFHHLFGPWSIIIRDLMRDLMRFLVILAIFMAGFTVHLRSLYVPVYRPDTYDTPVAMGKSLLTAFELLFFALFGYIEPDNLPNMTQSPTWTMTLVKVIFGCYLIITLIVLINLLIAMMSDTYERIRAESDTEWKFGRAKLISNMNKTSSTPTPLILVTQLIFVLRNFRRKHRVQSQSGLEEDDVDASRGDVTHSRGAVNRNAQSSGQ--ENATEHRGGPAKIEDVVDWESVIKKFSSIHG 1752          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267DZS7 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025367g1 PE=3 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 1.827e-117
Identity = 238/526 (45.25%), Postives = 336/526 (63.88%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGAD---KLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLF--FILIFPVSWLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQP------YNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSYFI--KTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPIILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLYSSILYYKIRNIPIESLLEDEVD----DPEHKS---RRKSQVSPNILEASKTSRHGSEKLEEVVNWSDIINKYLAIRG 1565
            K LY++M+CSK++  KT+EEFI VSPAPAETAAKLSK + ILS +EKER+K+L  + KYCE MCT+LVA+AA ESG D   KLLK+ D  G+QFLDIL+ETEQKEVI+H +VQ+YL+ VW+GNL+WPTWKF LLF  F+ I PV   +++        + PVIKF+ YL +H+ +  L + VA +        Y R+ + PT LE +L +WL+G  +SEL NP DRS + + +++++ ++   V+ H  ++ +   T    + ++ RNQ+   +T LCFV+ L+FL+FHHLFGPW+II+R+L+RDL +FLV   IF+  F   L   Y P+             K ++    LL+F++FG + PD+LPN   +P ++  L + IF C L+I +IVL+NLLIAMM+DTY+RI+A SD EWKFGRAKLI N+  T+  P+P I++ Q          K R      L ED+VD    D  H      R +Q S    E +   R G  K+E+VV+W  +I K+ +I G
Sbjct: 1229 KFLYNIMLCSKISGNKTLEEFILVSPAPAETAAKLSKKFVILSEREKERAKELVQMGKYCENMCTELVAVAAAESGGDGAAKLLKAVDNRGVQFLDILLETEQKEVIAHPAVQRYLTDVWRGNLDWPTWKFLLLFTVFLAIPPVMMAFSLPLSCNRYHRKPVIKFIAYLIAHVHLIFLFVFVAVEPEWLGPPYYTRRDLMPTWLECLLLLWLSGQLVSELTNPADRSGLGIFKVIVIAVAAVGVITHLAAFALPSDTNARLDALFARNQLFAFATLLCFVMFLEFLTFHHLFGPWSIIIRDLMRDLMRFLVILAIFMAGFTVHLRSLYVPVYRPDTYDTPVAMGKSLLTAFELLFFALFGYIEPDNLPNMTQSPTWTMTLVKVIFGCYLIITLIVLINLLIAMMSDTYERIRAESDTEWKFGRAKLISNINKTSSTPTPMILVTQLIFVLRNFRRKHRVQSQSGLEEDDVDTSRGDVMHSRGAVNRNAQSSGQ--ENATEHRGGPAKIEDVVDWESVIKKFSSIHG 1752          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267GWH2 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007249g1 PE=3 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 3.317e-108
Identity = 221/471 (46.92%), Postives = 311/471 (66.03%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGAD---KLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLF--FILIFPVSWLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQP------YNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSYFI--KTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPIILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLYSSILYYKIRNIPIESLLEDEVD 1421
            K LY++M+CSK++  KT+EEFI VSPAPAETAAKLSK + ILS +EKER+K+L  + KYCE MCT+LVA+AA ESG D   KLLK+ D  G+QFLDIL+ETEQKEVI+H +VQ+YL+ VW+GNL+WPTWKF LLF  F+ I PV   +++        + PVIKF+ YL +H+ +  L + VA +        Y R+ + PT LE +L +WL+G  +SEL NP DRS + + +++++ ++   V+ H  ++ +   T    + ++ RNQ+   +T LCFV+ L+FL+FHHLFGPW+II+R+L+RDL +FLV   IF+  F   L   Y P+             K ++    LL+F++FG + PD+LPN   +P ++  L + IF C L+I +IVL+NLLIAMM+DTY+RI+A SD EWKFGRAKLI N+  T+  P+P I++ Q          K R      L ED+VD
Sbjct: 1229 KFLYNIMLCSKISGNKTLEEFILVSPAPAETAAKLSKKFVILSEREKERAKELVQMGKYCENMCTELVAVAAAESGGDGAAKLLKAVDNRGVQFLDILLETEQKEVIAHPAVQRYLTDVWRGNLDWPTWKFLLLFTVFLAIPPVMMAFSLPLSCNRYHRKPVIKFIAYLIAHVHLIFLFVFVAVEPEWLGPPYYTRRDLMPTWLECLLLLWLSGQLVSELTNPADRSGLGIFKVIVIAVAAVGVITHLAAFALPSDTNARLDALFARNQLFAFATLLCFVMFLEFLTFHHLFGPWSIIIRDLMRDLMRFLVILAIFMAGFTVHLRSLYVPVYRPDTYDTPVAMGKSLLTAFELLFFALFGYIEPDNLPNMTQSPTWTMTLVKVIFGCYLIITLIVLINLLIAMMSDTYERIRAESDTEWKFGRAKLISNINKTSSTPTPMILVTQLIFVLRNFRRKHRVQSQSGLEEDDVD 1699          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267DZ63 (ANK_REP_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005281g1 PE=4 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 1.075e-104
Identity = 237/560 (42.32%), Postives = 336/560 (60.00%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGAD---KLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLF--------FILIFPVSWLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQ-----PY-NRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSYFIK--TLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPIILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLYSSILYYKIRNIPIESLLEDEVDDPEHKSR-----------------------RKSQVS---PNILEASKTSRH--GSEKLEEVVNWSDIINKYLAIRGNKSGEKN 1586
            K LYD+M CSK +  KT+EEFI  SPAPAETAAKLS+ + ILS +EKER+K+L +I K+CE MC +LVA+A+ E+G++    LLK+ D  G+QFLDIL+ETEQKEVI+H +VQ+YL+ +WKGNL+WPTWKF LLF         +++F + W    +       + PVIKF+ YL +H  +  L ++VA +      PY  R  + PT +E +L +WL+G  +SEL NP DRS + + ++ ++ +S   V+ H +++     + +  + ++ RNQ+   +T LCFVV L+FL+FHH FGPW+II+R+++RDL +FLV   +F+  F   L  TY  +     +S     NKD+I     L+F++FG + PD+ PN  + P ++  L + +F   L++ IIVLVNLLIAMMTDTYQRIQ  SD EWKFGRAKLIRNM  T+P P+P I+  Q +        K R+       EDE       SR                       R SQ +   P I     T R   G  KLE+VV+W  +I K+  ++G  SG+ N
Sbjct: 1211 KFLYDIMQCSKASGNKTVEEFILASPAPAETAAKLSRKFQILSEREKERAKELMLIGKHCELMCAELVAVASTENGSEGAASLLKAVDSRGVQFLDILLETEQKEVIAHPAVQRYLTDLWKGNLDWPTWKFLLLFTVFLLLPPVMMVFSLPWRRYRYQ------RKPVIKFIAYLIAHFHLIALFMLVAIEPGWLGYPYWTRHDLIPTWVECLLLLWLSGQLVSELTNPADRSGLGIFKVFVVGISAVGVVTHLVAFIFPYGSNQRLDTLFARNQLFAFATLLCFVVFLEFLTFHHQFGPWSIIIRDIMRDLMRFLVMLALFVLGFTLQLRSTYVAVYAPQTSSALALVNKDLIASFEELFFALFGFIEPDNQPNLALAPPWAATLVKILFGGHLVVCIIVLVNLLIAMMTDTYQRIQTESDTEWKFGRAKLIRNMNKTSPTPTPLILFTQMFTVLRNASQKGRSQHRLGFDEDEEATVADTSRPDVAQSQAAVAGRNPRESSSVALRMSQAATRPPLITTGLSTGREHRGPVKLEDVVDWKVVIVKFTRMQGG-SGKAN 1763          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A210QIK2 (Ankyrin-1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT01142 PE=3 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 1.570e-104
Identity = 240/542 (44.28%), Postives = 326/542 (60.15%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFILIF-PVSWLYAMFPKGKILFKSPVIKFVVYLFSHIIMTIL--LLIVAYDQP-YNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSYFIKTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPI--------ILQSKTSNSE-ETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLYSSILYYKIRNIPIESLLED---EVDDPEHKS--------------------RRKSQVSPNILEASKTSRHGSEKLEEVVNWSDIINKYLAIRG 1565
            K ++DLM+C K+NN K IEEFI +SPAP +TAAK+SK + +L+ KEKERS+DL     YCE M T+L+A+AA  + A  LLK+ D +G QFLD+LIE EQKEV+SH +VQKYLS VW GNL W TWK  +LF   +F P+ WL    P      K P+IKF+ YL SH+ + IL  L +V    P +    + P   EW+L  WL+GL +SEL NP DR  +  ++++ + LS   + VH +++   T     M+YIRNQ    +  + FV  LDFLSFHHLFGPW II+R+L++DL +FLV  +IF+  F   LS  YQP+         L +   N E ET    ID   LL+FS+FG V PD LP    +P +   LA+ +F   +M+ +IVL+NLLIAMM+DTYQRIQ +SD+EWKFGRAKLIRNM  T+  PSP  +  +   Y  +  YK R        +D   E DD ++ S                    RR +QV+P          HG ++LE+VV+W  ++ KYL+++G
Sbjct: 1134 KFVFDLMVCGKMNNNKCIEEFILLSPAPVDTAAKMSKNFRLLAIKEKERSRDLTSAGNYCEFMATELLAIAASANSAGTLLKAVDCHGTQFLDVLIEHEQKEVVSHPAVQKYLSDVWVGNLRWATWKIVMLFMAFLFIPIVWLIFSLPLKHRFNKVPIIKFMAYLVSHLYLMILFSLTVVLPLVPIWQSGSLIPHWYEWLLLAWLSGLLVSELTNPGDRGGLGWIKVISIGLSSIGIFVHVIAFAFDTENRLLMLYIRNQFFACALLMSFVQLLDFLSFHHLFGPWAIIIRDLLKDLTRFLVILLIFITGFTLHLSAIYQPVYSPVSENAALGTGVGNGEPETFMTPIDTFELLFFSLFGLVDPDSLPTTYRSPFWVISLAKIVFGIYMMVTLIVLINLLIAMMSDTYQRIQQQSDMEWKFGRAKLIRNMNKTSATPSPLNLFTKLITYCRV-AYKHRGKLCSGQSQDYVHEDDDLDNVSDSRSVDLLAHNSVSWLRNVVRRNTQVAPEGGFLRVGGHHGPQRLEDVVDWLMVVKKYLSMQG 1674          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000048767.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B-like [Source:NCBI gene;Acc:103025232])

HSP 1 Score: 265.003 bits (676), Expect = 2.079e-76
Identity = 179/459 (39.00%), Postives = 284/459 (61.87%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALA--AYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFILIF-PVSWLYAMFPKGKILFKSPVIKFVVYLFSHI-IMTILLLIVAYD--QPYNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSYFIKTLELPEM--IYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPI-----------ILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLYSSIL 1367
            K ++DLM+C +LN+  T+EE +  S +P  TA +LS+   + + +EKERS  LQ  + +CEAM +DL+ LA  A   GA  +L++ D  G   LD LIE  QK V++H +VQKYL+ VW G+L+W +W+  LLFF L+  P  WL+   P        P+IKF+ +L SH+ ++ + +L + Y    P +  R+ P   EW+L  WL G+ +SEL +P +R+ +A +R+L+L  S ++++ H ++  +++  L  +  ++ RN +L  +  L F+  L+FL+FHHLFGPW II+R+LI+DL +F V  ++F  AF+  L+   QP+            + +   +  ++  + + +++LL+F++FG    +D+P  D +P  ++ LAR  F   L++ +IVLVNLLIAMM+DTYQRIQA+SD EWKFGRA LIR+M   +  PSPF ++     +  IL
Sbjct: 1072 KFVFDLMVCGRLNDNATLEELVLHSSSPLCTAVRLSRALSLAALREKERSAHLQAAAHHCEAMASDLLTLASSAEGHGAGVILRAVDHRGASVLDCLIEGRQKSVVAHPAVQKYLTEVWYGSLHWDSWRILLLFFSLLLCPPLWLFLSLPLKHRFNTVPIIKFMSHLVSHLFLLALFILTIVYPPINPLSEGRLLPGWCEWLLLTWLCGMLVSELSHPGERAGLAWVRLLLLGFSASALLCHLLAAALQSWPLAPLNCLFARNVLLTVAMTLGFIQLLEFLTFHHLFGPWAIIIRDLIKDLCRFAVILLLFHTAFSLSLTAICQPVYPENELNSSNSNVSNSEGSRSDSELNPLYVSVLLFFALFGLTEQEDIPAMDRSPAAANILARLTFGIYLVVSVIVLVNLLIAMMSDTYQRIQAQSDTEWKFGRAVLIRDMSRKSGTPSPFNLLTSLVFFIKIL 1530          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000016978.2 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B-like [Source:NCBI gene;Acc:103025232])

HSP 1 Score: 259.996 bits (663), Expect = 1.047e-74
Identity = 178/457 (38.95%), Postives = 285/457 (62.36%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALA--AYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFILIF-PVSWLYAMFPKGKILFKS-PVIKFVVYLFSHI-IMTILLLIVAYD--QPYNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSYFIKTLELPEM--IYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPI-----------ILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLYS 1358
            K ++DLM+C +LN+  T+EE +  S +P  TA +LS+   + + +EKERS  LQ  + +CEAM +DL+ LA  A   GA  +L++ D  G   LD LIE  QK V++H +VQKYL+ VW G+L+W +W+  LLFF L+  P  WL+        LF + P+IKF+ +L SH+ ++ + +L + Y    P +  R+ P   EW+L  WL G+ +SEL +P +R+ +A +R+L+L  S ++++ H ++  +++  L  +  ++ RN +L  +  L F+  L+FL+FHHLFGPW II+R+LI+DL +F V  ++F  AF+  L+   QP+            + +   +  ++  + + +++LL+F++FG    +D+P  D +P  ++ LAR  F   L++ +IVLVNLLIAMM+DTYQRIQA+SD EWKFGRA LIR+M   +  PSPF ++   + + 
Sbjct: 1061 KFVFDLMVCGRLNDNATLEELVLHSSSPLCTAVRLSRALSLAALREKERSAHLQAAAHHCEAMASDLLTLASSAEGHGAGVILRAVDHRGASVLDCLIEGRQKSVVAHPAVQKYLTEVWYGSLHWDSWRILLLFFSLLLCPPLWLFLS------LFNTVPIIKFMSHLVSHLFLLALFILTIVYPPINPLSEGRLLPGWCEWLLLTWLCGMLVSELSHPGERAGLAWVRLLLLGFSASALLCHLLAAALQSWPLAPLNCLFARNVLLTVAMTLGFIQLLEFLTFHHLFGPWAIIIRDLIKDLCRFAVILLLFHTAFSLSLTAICQPVYPENELNSSNSNVSNSEGSRSDSELNPLYVSVLLFFALFGLTEQEDIPAMDRSPAAANILARLTFGIYLVVSVIVLVNLLIAMMSDTYQRIQAQSDTEWKFGRAVLIRDMSRKSGTPSPFNLLTSLYNFG 1511          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: trpc2b (short transient receptor potential channel 2-like [Source:NCBI gene;Acc:103035354])

HSP 1 Score: 75.8702 bits (185), Expect = 5.833e-14
Identity = 134/552 (24.28%), Postives = 234/552 (42.39%), Query Frame = 3
Query:   57 YDLM--ICSKLNNYKTIEEFIHVSPAPAE---TAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYD------------KNGI---QFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFILIFPVSWLYAM---------FPK---GKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQPYNRKRVFPT---------HLEWILF--------IWLTGL--FLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMS----------YFIKTL------ELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPIILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKL-IRNMKHTTPVPSPFIIIYQFWLYSSILYYKIRNI-----------------PIESLLEDEVDDPEHKSRRKSQV 1457
            YDL+    S++N Y+ +    ++S    +   +A  LS+    LS KE E       + + C+    +L+ +   +S    +L +              + GI     L + +   QK+ ++H   Q+ LS +W GNL  P W+     + L+  V    AM          PK   GKIL K PVIKF+V+  S++   I LL  +      R+              H+ W+          +W+ G+  +  +L N +D   +++      +  +  +  H +           YF +TL      E P++I     +   ++ L F      L      G   I + ++I D+ +FL   +I   AF C ++  Y P I+  +     ET          L++++FG V+ D +  PD     ++ + R ++    ++I+IVL+N+ IAM+T+++Q+I+  +D+EWKF R+KL +   +    +P PF II         L+Y +R I                 PI S+ + +  DP  K   K QV
Sbjct:  186 YDLLKFSLSRINTYRGLASRAYLSITTEDAMLSAFHLSRDLRKLSKKEPEFKPQYLALEELCQEFAVELLGMCRNQSEVSTILNNCGLDDDDHEEELAFEEGIPNLARLRLAVNFNQKQFVAHPICQQVLSSIWCGNL--PGWRGSRTAWKLLVSVGIFVAMPFLCLTYWIAPKSKAGKIL-KIPVIKFLVHSASYLWFLITLLGESITMEMYRESFASREQNMLHNSFHMVWVAGFFWFECKEVWIEGVRNYFRDLWNCLDMMVLSMYLASFSLRVVIMLKGHLLCNSPGYEEECVYFTQTLRQDWRQEDPQLI--SEVLFAVTSMLSFARLAYILPAQESLGTLQISMGKMIDDMIRFLFILMIIGTAFLCGINNIYVPYIISPQLGRFNET-------ISFLFWTMFGVVSKDYVDMPDFV--VAEFVGRILYGIFTLLIVIVLLNMFIAMITNSFQKIEDDADVEWKFARSKLYLSYFREGLTMPVPFNIIPS----PKALFYLLRGIFRKICCCCNFNSTPDYPPITSMPQKDDGDPTEKMTYKQQV 719          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: trpc2a (transient receptor potential cation channel subfamily C member 2a [Source:ZFIN;Acc:ZDB-GENE-130530-602])

HSP 1 Score: 73.559 bits (179), Expect = 3.070e-13
Identity = 120/492 (24.39%), Postives = 217/492 (44.11%), Query Frame = 3
Query:   57 YDLM--ICSKLNNYKTIEEFIHVSPAPAE---TAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLD---------------ILIETEQKEVISHASVQKYLSVVWKGNL-NW----PTWKF--CLLFFILIFPVSWLYAMFPKGKI--LFKSPVIKFVVYLFSHIIMTILLLI------VAYDQPYNRKRVF---PTHLEWILF--------IWLTGL--FLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFM----------SYFIKTL------ELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPIILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKL-IRNMKHTTPVPSPFIII 1337
            YDL+    S++N Y+ I    ++S    +   +A  LS     LS KE E       + + C+    +L+ +   +S    LL   +    + LD               + I   QK+ ++H   Q+ LS +W G+L  W     +WK    L  F+ +  + ++Y + PK KI    K PVIKF+++  S++   I+LL       +  D   +R +       H+ W++         +W+ GL  +L +  N +D   +++      +  +  +  HF+           YF  T       E P++I     +   ++ L F      L  H   G   I + ++I D+ +F+   +I   AF C +   Y P +       +E  N         L++++FG    + +  PD     ++ + R ++    +II+IVL+N+LIAM+T+++Q+I+  +D+EWKF R+KL +   +    +P PF II
Sbjct:  174 YDLLKFSLSRINTYRGIASRAYLSITSEDAILSAFHLSSEMRKLSKKEPEFKPQYLALEQVCQEYAVELLGMCRNQSEVSTLLNYGEDVSDEELDEQTFEEGIPNLALIRLAITYNQKQFVTHPICQQVLSSIWCGSLSGWRGSNTSWKLLVSLGIFVSMPLLCFIYWIAPKSKIGRTLKIPVIKFLLHSASYLWFLIILLTESIFMEIWRDDIASRSQNLLHNSLHMIWVVGFFWFECKEVWIEGLKTYLLDWWNILDMLVLSMYLASFTLRILIVLKGHFLCQDPSAEDLCDYFTNTARENWRQEDPQLIA--EMLFAVTSMLSFTRLAYILPAHEFLGTLQISIGKMIDDMMRFVFILMIIGTAFLCGMHNIYAPYVSSPLGRLNETFN--------FLFWTMFGVFNQEKVDMPDHV--MAEFVGRVLYGIFTLIIVIVLLNMLIAMITNSFQKIENDADVEWKFARSKLYLSFFREGLTMPVPFNII 653          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: trpc5b (transient receptor potential cation channel, subfamily C, member 5b [Source:ZFIN;Acc:ZDB-GENE-091112-24])

HSP 1 Score: 51.6026 bits (122), Expect = 2.136e-6
Identity = 63/229 (27.51%), Postives = 102/229 (44.54%), Query Frame = 3
Query:   75 SKLNNYKTIEE---FIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQF----------LDILIETEQKEVISHASVQKYLSVVWKGNLNWPTW-------KFCLLFFI-LIFPV-SWLYAMFPKGKILF--KSPVIKFVVYLFSHIIMTILLL-----IVAYDQPYNRKRVFPTHLEWILFIWLTGLFLSEL 674
            S+LN YKT+         S  P  TA +L      LS  E E  ++ + +S+ C+    DL+  A      + +L   D +  +           L + I+  QKE ++  + Q+ L+ +W     +P W       K    F I L+FPV S +Y + PK  + F  K P IKF+ +  S++    LLL     IV  D   + +   PT +EW++  W+ G   +E+
Sbjct:  195 SRLNIYKTLASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKLFAKDLLDQARSSRELETILNHRDDHSEELDPRECRDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDG--FPGWRRRHWVVKLVTCFTIGLLFPVFSIIYLLAPKSALGFFIKKPFIKFICHTASYLTFLFLLLLASQHIVRTD--LHVQGPPPTIVEWMILPWVLGFIWAEI 419          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007334.1 (pep scaffold:Pmarinus_7.0:GL483392:1130:8888:1 gene:ENSPMAG00000006613.1 transcript:ENSPMAT00000007334.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 246.514 bits (628), Expect = 2.016e-73
Identity = 179/478 (37.45%), Postives = 278/478 (58.16%), Query Frame = 3
Query:   54 LYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALA--AYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFF-ILIFPVSWLYAMFPKGKILFKSPVIKFVVYLFSHI-IMTILLLIVAYD--QPYNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHF--MSYFIKTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPIILQSKTSNSEET----------NKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQ-FWLYSSILYYK-IRNIPIESLLE--DEVD 1421
            +YDLM+C +   ++ I+EF+ ++PAP E A KL++ +   + +EKERS DL + +++C+A+ TDL++LA  +  +GA  LL++ D+ G+  LD+LIE  Q+ V +H +VQ +LS VW+G L WP+W   LL    L+ P  W+    P G    + P+IKF+ +L SH+ ++++ +L V +    P     + P+  EW+L  WL GL L+EL     R  +A +R+L+L LS  +++ H   +++   +  L E +  RN +L  +   C V  LDFLSFHHLFGPW II+ +L++DL +F +   IF  AF   L+   QP+  Q     +  T           +  +D+ +LL+FS+FG    + LP+   +P     L    F   L++ +IVL+NLLIAMM+DTYQRIQA+SD +WKFGR  L+R     T  P+P  ++ Q  WL       K   ++P ESL +  +EVD
Sbjct:  173 VYDLMVCGRQCEFRVIDEFVLLAPAPLEAAVKLTRAFGAAALREKERSVDLDLAARHCQALATDLLSLAVGSQSAGAAALLQAVDERGLSLLDVLIECHQRAVAAHPAVQHHLSDVWRGGLRWPSWCPALLLLGFLVCPPLWVAFSLPLGHRFTRIPIIKFLCHLASHLFLLSLFVLTVVWPPITPIAEGHLLPSWNEWLLLTWLLGLLLAELRQGGSRFGLAWIRLLVLGLSGLALLCHLSALAFPAGSHALLECLCARNVLLAKALAFCCVQLLDFLSFHHLFGPWAIIISDLMKDLARFGMVLGIFHVAFTLHLTALCQPVYPQGDPVGNSSTAAAAWDPSTAAQTTLDVTVLLFFSLFGMGDQNSLPDVSRSPSIVSTLVNATFGVYLIVTLIVLINLLIAMMSDTYQRIQAQSDTQWKFGRVVLVREATRRTTPPAPLNVVTQLLWLLQRCACRKGTVDLPSESLADGGEEVD 650          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007332.1 (pep scaffold:Pmarinus_7.0:GL483392:1130:9476:1 gene:ENSPMAG00000006613.1 transcript:ENSPMAT00000007332.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 246.899 bits (629), Expect = 2.965e-73
Identity = 185/546 (33.88%), Postives = 303/546 (55.49%), Query Frame = 3
Query:   54 LYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALA--AYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFF-ILIFPVSWLYAMFPKGKILFKSPVIKFVVYLFSHI-IMTILLLIVAYD--QPYNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHF--MSYFIKTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPIILQSKTSNSEET----------NKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQ-FWLY---------------SSILYYKIRNIPIESLLEDEVDDPEHKSRRK---SQVSPNILEASKTSRHGSE----KLEEVVNWSDIINKYLAIRGN 1568
            +YDLM+C +   ++ I+EF+ ++PAP E A KL++ +   + +EKERS DL + +++C+A+ TDL++LA  +  +GA  LL++ D+ G+  LD+LIE  Q+ V +H +VQ +LS VW+G L WP+W   LL    L+ P  W+    P G    + P+IKF+ +L SH+ ++++ +L V +    P     + P+  EW+L  WL GL L+EL     R  +A +R+L+L LS  +++ H   +++   +  L E +  RN +L  +   C V  LDFLSFHHLFGPW II+ +L++DL +F +   IF  AF   L+   QP+  Q     +  T           +  +D+ +LL+FS+FG    + LP+   +P     L    F   L++ +IVL+NLLIAMM+DTYQRIQA+SD +WKFGR  L+R     T  P+P  ++ Q  WL                 S+  +K+     +++ +    D    SR +      S +++  +++ R G      ++E+V++W  +  +Y A++G 
Sbjct:  173 VYDLMVCGRQCEFRVIDEFVLLAPAPLEAAVKLTRAFGAAALREKERSVDLDLAARHCQALATDLLSLAVGSQSAGAAALLQAVDERGLSLLDVLIECHQRAVAAHPAVQHHLSDVWRGGLRWPSWCPALLLLGFLVCPPLWVAFSLPLGHRFTRIPIIKFLCHLASHLFLLSLFVLTVVWPPITPIAEGHLLPSWNEWLLLTWLLGLLLAELRQGGSRFGLAWIRLLVLGLSGLALLCHLSALAFPAGSHALLECLCARNVLLAKALAFCCVQLLDFLSFHHLFGPWAIIISDLMKDLARFGMVLGIFHVAFTLHLTALCQPVYPQGDPVGNSSTAAAAWDPSTAAQTTLDVTVLLFFSLFGMGDQNSLPDVSRSPSIVSTLVNATFGVYLIVTLIVLINLLIAMMSDTYQRIQAQSDTQWKFGRVVLVREATRRTTPPAPLNVVTQLLWLLQRCACRKACKKIQQPCSVTLFKVG----QTITQGSSLDSAWISRERYNGVSFSIHLVVLAESQRVGERLQPCRIEDVLDWRAVAQRYRAMKGT 714          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO45311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ7])

HSP 1 Score: 60.8474 bits (146), Expect = 8.385e-10
Identity = 55/203 (27.09%), Postives = 96/203 (47.29%), Query Frame = 3
Query:  120 SPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLV--ALAAYES-------GADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNL-NWPTWKFC-----LLFFILIFPV-SWLYAMFP---KGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQPYNRKRVFPTHLEWILFIWLTGLFLSE 671
            S  P  TA +LS    +++ +E E  KD   +S+ C      L+     + E        G +  ++ Y +N +  ++  I   QKE ++H   Q  +     G++  W T  F      +L  ++IFPV + +Y   P    G+ + K P +KF+ +  S ++  ILL + ++ Q   R R  P+ LEW++F W+ G+  SE
Sbjct:   65 SNDPFLTAFELSSELEVIARREDEYEKDYLQLSQQCSQFTIGLLDECRTSREQRCILNYPGENGSVEDYAENSLGLVNSAISYNQKEFVAHPFCQHLVMQHIFGDITGWRTNHFLYRIAYVLTQVIIFPVLAVIYFFMPFLEVGRKI-KRPFVKFINHTSSFVVFLILLAVSSHHQFEIRFRKMPSGLEWLIFSWILGVAWSE 266          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: trpc4a (transient receptor potential cation channel subfamily C member 4 [Source:NCBI gene;Acc:101170611])

HSP 1 Score: 54.6842 bits (130), Expect = 2.730e-7
Identity = 60/229 (26.20%), Postives = 101/229 (44.10%), Query Frame = 3
Query:   75 SKLNNYKTIEE---FIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYD---------KNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWK--------FCLLFFILIFPV-SWLYAMFPKGKI--LFKSPVIKFVVYLFSHIIMTILLL-----IVAYDQP-YNRKRVFPTHLEWILFIWLTGLFLSEL 674
            S+LN YK +         S  P  TA +LS     LS  E E   + + +S+ C+    DL+         + +L   D          N +  L + I+  QKE ++  + Q+ L+  W     +P W+           +F  L+FP+ ++ Y + PK +     + P IKF+ +  S++    LLL     IVA +Q   NR+   PT +EW++  W+ G   +E+
Sbjct:  195 SRLNIYKALSSPSLIALSSEDPFLTAFRLSWELQELSKVENEFKSEYEELSQQCKQFAKDLLDQTRSSRELEMILNYRDDINLLDDEGNNELARLKLAIKYHQKEFVAQPNCQQLLASRWYDE--FPGWRRRHWAGKLITCVFIGLLFPLFAFCYLIAPKSRYGNFIRKPFIKFICHTASYLTFLFLLLLASQHIVATEQDRQNRQGPAPTTVEWMILPWVLGFIWAEI 421          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: trpc5a (short transient receptor potential channel 5 [Source:NCBI gene;Acc:101169488])

HSP 1 Score: 52.7582 bits (125), Expect = 1.083e-6
Identity = 61/230 (26.52%), Postives = 101/230 (43.91%), Query Frame = 3
Query:   75 SKLNNYKTIEE---FIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLD-----------ILIETEQKEVISHASVQKYLSVVWKGNLNWPTW-------KFCLLFFI-LIFPV-SWLYAMFPKGKI--LFKSPVIKFVVYLFSHIIMTILLLIVAYDQPYNRKRVF-----PTHLEWILFIWLTGLFLSEL 674
            S+LN YK +         S  P  TA +L      LS  E E  ++ + +S+ C+    DL+  A      + +L   D +  + LD           + I+  QKE ++  + Q+ L+ +W     +P W       K    F I L+FPV S +Y + PK  +    K P IKF+ +  S++    LLL+ +  Q   R  +      PT +EW++  W+ G   +E+
Sbjct:  195 SRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKRFAKDLLDQARSSRELETILNHRDSDQSEELDPRQCHDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDG--FPGWRRHHWAVKLVTCFIIGLLFPVFSMIYLLAPKSALGRFIKKPFIKFICHTASYLTFLFLLLLAS--QHIARTNLHMQGPPPTVVEWMILPWVLGFIWAEI 420          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: trpc5a (short transient receptor potential channel 5 [Source:NCBI gene;Acc:101169488])

HSP 1 Score: 52.7582 bits (125), Expect = 1.096e-6
Identity = 61/230 (26.52%), Postives = 101/230 (43.91%), Query Frame = 3
Query:   75 SKLNNYKTIEE---FIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLD-----------ILIETEQKEVISHASVQKYLSVVWKGNLNWPTW-------KFCLLFFI-LIFPV-SWLYAMFPKGKI--LFKSPVIKFVVYLFSHIIMTILLLIVAYDQPYNRKRVF-----PTHLEWILFIWLTGLFLSEL 674
            S+LN YK +         S  P  TA +L      LS  E E  ++ + +S+ C+    DL+  A      + +L   D +  + LD           + I+  QKE ++  + Q+ L+ +W     +P W       K    F I L+FPV S +Y + PK  +    K P IKF+ +  S++    LLL+ +  Q   R  +      PT +EW++  W+ G   +E+
Sbjct:  198 SRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKRFAKDLLDQARSSRELETILNHRDSDQSEELDPRQCHDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDG--FPGWRRHHWAVKLVTCFIIGLLFPVFSMIYLLAPKSALGRFIKKPFIKFICHTASYLTFLFLLLLAS--QHIARTNLHMQGPPPTVVEWMILPWVLGFIWAEI 423          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: trpc2b (short transient receptor potential channel 2-like [Source:NCBI gene;Acc:101167976])

HSP 1 Score: 51.2174 bits (121), Expect = 2.752e-6
Identity = 62/237 (26.16%), Postives = 101/237 (42.62%), Query Frame = 3
Query:   57 YDLM--ICSKLNNYKTIEEFIHVSPAPAE---TAAKLSKLYFILSGKEKE-RSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYD------------KNGI---QFLDILIETEQKEVISHASVQKYLSVVWKGNL-NW----PTWKFCL---LFFI--LIFPVSWLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQPYNRKRVFPTHLE---------WILFIW 647
            YDL+    S++N Y+ I    ++S    +   +A  LSK    LS KE E +      + + C+    +L+ +   +S    +L S              + GI     L + +   QK+ ++H   Q+ LS +W GNL  W      WK  +   +FF   L+  V W+      GKIL K PVIKF+++  S++   I LL  +      R +    H +         W++F W
Sbjct:  181 YDLLKFSLSRINTYRGIASRAYLSITSEDAMLSAFSLSKELRKLSQKEPEFKQPQYLSLEQLCQEFAFELLGMCRNQSEVTTILNSCGDETQEALHEQAFEEGIPNLSRLRLAVNYNQKQFVAHPICQQVLSSIWCGNLAGWRGSRTAWKLLVSVGIFFTMPLLCLVYWIAPKSKVGKIL-KIPVIKFLLHAASYLWFLITLLGESITMEMYRDKFASRHQDILHSSFHMVWVVFFW 416          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020707.1 (SMESG000020707.1)

HSP 1 Score: 864.374 bits (2232), Expect = 0.000e+0
Identity = 482/515 (93.59%), Postives = 482/515 (93.59%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFILIFPVSWLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQPYNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSYFIKTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPIILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLYSSILYYKIRNIPIESLLEDEVDDPEHKSRRKSQVSPNILEASKTSRHGSEKLEEVVNWSDIINKYLAIRGNKSGEKNHN 1592
            KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFILIFPVSWLYAMFPKGKI    P                             KRVFPTHLEWILFIWLTGLFLSELINPVDRSNVAVLRILILILSIASVMVHFMSYFIKTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDLFKFLVFFIIFLFAFACMLSGTYQPIILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCALMIIIIVLVNLLIAMMTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLYSSILYYKIRNIPIESLLEDEVDDPEHKSRRKSQVSPNILEASKTSRHGSEKLEEVVNWSDIINKYLAIRGNKSGEKNHN
Sbjct:  612 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFILIFPVSWLYAMFPKGKIFSSLP-----------------------------KRVFPTHLEWILFIWLTGLFLSELINPVDRSNVAVLRILILILSIASVMVHFMSYFIKTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDLFKFLVFFIIFLFAFACMLSGTYQPIILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCALMIIIIVLVNLLIAMMTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLYSSILYYKIRNIPIESLLEDEVDDPEHKSRRKSQVSPNILEASKTSRHGSEKLEEVVNWSDIINKYLAIRGNKSGEKNHN 1097          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020709.1 (SMESG000020709.1)

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 331/507 (65.29%), Postives = 412/507 (81.26%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFILIFPVSWLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQPYNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSYFIKTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPIILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQF-WLYSSILYYKIRNIPIESLLEDEVDDPEHKSRRKSQVSPNILEASKTSRHGSEKLEEVVNWSDIINKYLAIRG 1565
            K LYD+MICSK+NN+KTIEEFI +SPAPAE AAKLSKL+  LS KEKERSKDL +IS+YCE MCTDLVALAAYE GADKLLKSYD++G+QFLDILIETEQKEVISH SV +Y+S VW+G++ WP WKF LL   L FP+SWL AM PK K LFK PVIKF+VYLFSHI +  LL+ V  ++P  R  V P +LEWIL IWL GLF+SEL+NPVDRS++AVLRI +L+ S  +++VH  S FI    LPEMIYIRNQILGA+TFLCFVV+LDFLSFHHLFGPWT+I+R+LI DL +FLVFFI+FLFAFACML+GT+Q +    K    E+   DIID+ ILLYF +FG V+P+D+P+P+++P Y +KL++F+F  AL+++IIVL+NLLIAMM+DTYQRIQ +SD+EWK+GRAKLIRNMK+TTP+ SPFIII QF  L ++ LYYKI+  PI  + +DE D+ E + RR+S+++PN+LE+S   + G +K+EEVVNW DI  KYL IRG
Sbjct: 1252 KFLYDIMICSKINNFKTIEEFILLSPAPAEIAAKLSKLFIYLSEKEKERSKDLTVISEYCENMCTDLVALAAYEKGADKLLKSYDRHGVQFLDILIETEQKEVISHPSVHQYMSNVWRGDIKWPIWKFLLLMIFLSFPLSWLTAMLPKTKNLFKLPVIKFIVYLFSHIYLMGLLVYVTIEKPAERSEVLPNYLEWILLIWLAGLFISELVNPVDRSSIAVLRIFVLVFSCVAILVHVSSCFINESYLPEMIYIRNQILGAATFLCFVVTLDFLSFHHLFGPWTVIIRDLIGDLVRFLVFFIVFLFAFACMLAGTFQSV----KQPEPEDVIPDIIDVIILLYFCLFGLVSPEDMPDPNLSPPYGNKLSKFVFGFALLMMIIVLINLLIAMMSDTYQRIQDQSDVEWKYGRAKLIRNMKNTTPIASPFIIISQFIILVTTGLYYKIKRKPITQISDDEKDEIESRLRRRSELNPNLLESSSLFKFGPDKVEEVVNWPDIARKYLEIRG 1754          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020709.1 (SMESG000020709.1)

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 331/507 (65.29%), Postives = 412/507 (81.26%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWKFCLLFFILIFPVSWLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAYDQPYNRKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSYFIKTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPIILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQF-WLYSSILYYKIRNIPIESLLEDEVDDPEHKSRRKSQVSPNILEASKTSRHGSEKLEEVVNWSDIINKYLAIRG 1565
            K LYD+MICSK+NN+KTIEEFI +SPAPAE AAKLSKL+  LS KEKERSKDL +IS+YCE MCTDLVALAAYE GADKLLKSYD++G+QFLDILIETEQKEVISH SV +Y+S VW+G++ WP WKF LL   L FP+SWL AM PK K LFK PVIKF+VYLFSHI +  LL+ V  ++P  R  V P +LEWIL IWL GLF+SEL+NPVDRS++AVLRI +L+ S  +++VH  S FI    LPEMIYIRNQILGA+TFLCFVV+LDFLSFHHLFGPWT+I+R+LI DL +FLVFFI+FLFAFACML+GT+Q +    K    E+   DIID+ ILLYF +FG V+P+D+P+P+++P Y +KL++F+F  AL+++IIVL+NLLIAMM+DTYQRIQ +SD+EWK+GRAKLIRNMK+TTP+ SPFIII QF  L ++ LYYKI+  PI  + +DE D+ E + RR+S+++PN+LE+S   + G +K+EEVVNW DI  KYL IRG
Sbjct: 1279 KFLYDIMICSKINNFKTIEEFILLSPAPAEIAAKLSKLFIYLSEKEKERSKDLTVISEYCENMCTDLVALAAYEKGADKLLKSYDRHGVQFLDILIETEQKEVISHPSVHQYMSNVWRGDIKWPIWKFLLLMIFLSFPLSWLTAMLPKTKNLFKLPVIKFIVYLFSHIYLMGLLVYVTIEKPAERSEVLPNYLEWILLIWLAGLFISELVNPVDRSSIAVLRIFVLVFSCVAILVHVSSCFINESYLPEMIYIRNQILGAATFLCFVVTLDFLSFHHLFGPWTVIIRDLIGDLVRFLVFFIVFLFAFACMLAGTFQSV----KQPEPEDVIPDIIDVIILLYFCLFGLVSPEDMPDPNLSPPYGNKLSKFVFGFALLMMIIVLINLLIAMMSDTYQRIQDQSDVEWKYGRAKLIRNMKNTTPIASPFIIISQFIILVTTGLYYKIKRKPITQISDDEKDEIESRLRRRSELNPNLLESSSLFKFGPDKVEEVVNWPDIARKYLEIRG 1781          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020707.1 (SMESG000020707.1)

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 330/331 (99.70%), Postives = 331/331 (100.00%), Query Frame = 3
Query:  600 RKRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSYFIKTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPIILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLYSSILYYKIRNIPIESLLEDEVDDPEHKSRRKSQVSPNILEASKTSRHGSEKLEEVVNWSDIINKYLAIRGNKSGEKNHN 1592
            +KRVFPTHLEWILFIWLTGLFLSELINPVDRSNVAVLRILILILSIASVMVHFMSYFIKTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDLFKFLVFFIIFLFAFACMLSGTYQPIILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCALMIIIIVLVNLLIAMMTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLYSSILYYKIRNIPIESLLEDEVDDPEHKSRRKSQVSPNILEASKTSRHGSEKLEEVVNWSDIINKYLAIRGNKSGEKNHN
Sbjct:  722 KKRVFPTHLEWILFIWLTGLFLSELINPVDRSNVAVLRILILILSIASVMVHFMSYFIKTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDLFKFLVFFIIFLFAFACMLSGTYQPIILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCALMIIIIVLVNLLIAMMTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLYSSILYYKIRNIPIESLLEDEVDDPEHKSRRKSQVSPNILEASKTSRHGSEKLEEVVNWSDIINKYLAIRGNKSGEKNHN 1052          

HSP 2 Score: 226.868 bits (577), Expect = 7.203e-64
Identity = 123/164 (75.00%), Postives = 130/164 (79.27%), Query Frame = 3
Query:    3 NNVRLIGAFL*FYHC--------KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWP--TWKFCLLFFILIFPV 464
            N++ ++   +   HC        KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQK    V+  +L W    W   L    LI PV
Sbjct:  589 NHIDVVSYLIHNKHCTETLLNDNKLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQK--KRVFPTHLEWILFIWLTGLFLSELINPV 750          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000020698.1 (SMESG000020698.1)

HSP 1 Score: 455.292 bits (1170), Expect = 3.646e-143
Identity = 271/479 (56.58%), Postives = 341/479 (71.19%), Query Frame = 3
Query:   48 KLLYDLMICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMISKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLDILIETEQKEVISHASVQKYLSVVWKGNLNWPTWK-FCLLFFILIFPVSWLYAMFPKGKILFKSPVIKFVVYLFSHIIMTILLLIVAY--DQPYNR---KRVFPTHLEWILFIWLTGLFLSELINPVDRSNXXXXXXXXXXXXXXXXXXHFMSYFIKTLELPEMIYIRNQILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDXXXXXXXXXXXXXXXXCMLSGTYQPIILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPNPDITPKYSDKLARFIFSCXXXXXXXXXXXXXXXXXTDTYQRIQARSDIEWKFGRAKLIRNMKHTTPVPSPFIIIYQFWLYSSILYYKIRNIPIESLLEDEVDDPEHKSRRKSQVSPN 1466
            K LYDLMICSKLNN K+IEEF+ +SPAPAETAAKLS  Y  LS KEKERSKDL ++  YCE MCTDLVALA  E GADKLL S D  G+QFLD+LIE EQKEVISH SVQ+YLS VW GNLNWP WK   L   +   P+ WL AMFP G+ LFKSPVIKF++YL SH+ +T L++ VA   D PY R    +  P   EW+L I L+G  +SELINP+DR ++A+L+ +I+  S A+VM H     + +    EMIYIRNQ+L  STF+C VV+LDFLS HHLFGPWTII+R+L+ DLF+FLV  +IFL  FACML+ T QP  + +   N       I DM  + YF +FG V P D+P    +  YS+KL++ +F   L+I+IIVL+NLLIAMM DTY RIQ + D EWKFGRAKLIRNMK T+P+PSPFI++ Q  L+  I+YYK+RN+P+    ++ + D +   RRKSQ++P+
Sbjct: 1378 KFLYDLMICSKLNNLKSIEEFVLLSPAPAETAAKLSNEYRELSEKEKERSKDLLLVGDYCENMCTDLVALAVVERGADKLLCSIDDRGVQFLDLLIEMEQKEVISHPSVQQYLSDVWIGNLNWPIWKFLLLFLVLFSLPILWLLAMFPFGRNLFKSPVIKFILYLISHLYLTGLIMYVAILGDNPYVRTQSNQYSPLWFEWLLLICLSGQLVSELINPIDRYSLAILKYVIIFFSTAAVMTHLFGTAVTSKSAAEMIYIRNQLLAVSTFMCLVVTLDFLSIHHLFGPWTIIIRDLMGDLFRFLVILLIFLCGFACMLTVTCQPTSVPTAIDNIPS----IWDMTFIFYFCLFGLVNPTDIPIVAPSTSYSNKLSQMVFGLGLLILIIVLINLLIAMMADTYDRIQEQCDTEWKFGRAKLIRNMKKTSPIPSPFILLSQLVLHVMIIYYKMRNLPMPKYSDENIADKDQILRRKSQIAPS 1852          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TRPC61.099e-625.26transient receptor potential cation channel subfam... [more]
TRPC61.361e-625.26transient receptor potential cation channel subfam... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trp-41.275e-8036.97TRP (Transient receptor potential) channel family ... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nompC1.116e-8941.47gene:FBgn0016920 transcript:FBtr0300012[more]
nompC1.010e-8740.83gene:FBgn0016920 transcript:FBtr0304843[more]
nompC1.134e-8740.61gene:FBgn0016920 transcript:FBtr0343224[more]
nompC1.142e-8639.55gene:FBgn0016920 transcript:FBtr0347408[more]
nompC1.693e-6748.48gene:FBgn0016920 transcript:FBtr0347409[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01073736.15.547e-7734.69pep chromosome:GRCz11:19:1465004:1479740:1 gene:EN... [more]
trpc2a4.793e-1424.34transient receptor potential cation channel subfam... [more]
trpc2b1.593e-1224.80transient receptor potential cation channel subfam... [more]
trpc5a2.341e-626.20transient receptor potential cation channel, subfa... [more]
trpc5a3.128e-626.20transient receptor potential cation channel, subfa... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx142.041e-9539.22sorting nexin 14 [Source:Xenbase;Acc:XB-GENE-98418... [more]
snx142.492e-9343.24sorting nexin 14 [Source:Xenbase;Acc:XB-GENE-98418... [more]
nup1881.798e-622.73nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-593... [more]
nup1882.120e-622.73nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-593... [more]
nup1882.141e-622.73nucleoporin 188kDa [Source:Xenbase;Acc:XB-GENE-593... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Xntrpc3.437e-727.35Xndc1-transient receptor potential cation channel,... [more]
Trpc22.792e-627.32transient receptor potential cation channel, subfa... [more]
Trpc64.537e-624.23transient receptor potential cation channel, subfa... [more]
Trpc64.768e-624.23transient receptor potential cation channel, subfa... [more]
Trpc79.281e-623.85transient receptor potential cation channel, subfa... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9R244|TRPC2_MOUSE2.229e-627.35Short transient receptor potential channel 2 OS=Mu... [more]
sp|Q9Y210|TRPC6_HUMAN6.537e-625.26Short transient receptor potential channel 6 OS=Ho... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FPR41.083e-11845.63ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267DZS71.827e-11745.25ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267GWH23.317e-10846.92ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267DZ631.075e-10442.32ANK_REP_REGION domain-containing protein (Fragment... [more]
A0A210QIK21.570e-10444.28Ankyrin-1 OS=Mizuhopecten yessoensis OX=6573 GN=KP... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000048767.12.079e-7639.00serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSAMXT00000016978.21.047e-7438.95serine/threonine-protein phosphatase 6 regulatory ... [more]
trpc2b5.833e-1424.28short transient receptor potential channel 2-like ... [more]
trpc2a3.070e-1324.39transient receptor potential cation channel subfam... [more]
trpc5b2.136e-627.51transient receptor potential cation channel, subfa... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007334.12.016e-7337.45pep scaffold:Pmarinus_7.0:GL483392:1130:8888:1 gen... [more]
ENSPMAT00000007332.12.965e-7333.88pep scaffold:Pmarinus_7.0:GL483392:1130:9476:1 gen... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO453118.385e-1027.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
trpc4a2.730e-726.20transient receptor potential cation channel subfam... [more]
trpc5a1.083e-626.52short transient receptor potential channel 5 [Sour... [more]
trpc5a1.096e-626.52short transient receptor potential channel 5 [Sour... [more]
trpc2b2.752e-626.16short transient receptor potential channel 2-like ... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020707.10.000e+093.59SMESG000020707.1[more]
SMESG000020709.10.000e+065.29SMESG000020709.1[more]
SMESG000020709.10.000e+065.29SMESG000020709.1[more]
SMESG000020707.17.203e-6499.70SMESG000020707.1[more]
SMESG000020698.13.646e-14356.58SMESG000020698.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034378 ID=SMED30034378|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1729bp
ATAACAACGTACGTTTGATTGGTGCTTTCTTGTAATTTTATCATTGCAAA
CTACTTTACGATTTAATGATTTGCAGTAAATTAAACAATTATAAGACAAT
TGAAGAATTTATTCATGTTTCACCGGCACCCGCCGAAACTGCGGCAAAGC
TATCAAAACTGTACTTCATTTTATCGGGAAAAGAGAAAGAACGTTCGAAA
GATTTACAAATGATATCTAAATATTGCGAAGCCATGTGCACAGATCTCGT
GGCTTTGGCTGCATATGAAAGTGGAGCTGATAAATTGTTGAAATCCTACG
ATAAAAATGGGATTCAATTTCTTGATATTCTCATTGAGACAGAACAAAAA
GAAGTGATTTCACATGCGTCAGTTCAGAAGTATTTGTCAGTTGTTTGGAA
AGGAAATTTAAATTGGCCGACTTGGAAATTCTGTCTATTGTTTTTCATTC
TAATATTTCCCGTGTCCTGGTTGTATGCTATGTTTCCTAAGGGGAAAATC
CTTTTCAAGTCTCCCGTAATAAAATTTGTTGTTTATTTGTTTTCTCATAT
AATTATGACAATTCTGTTGCTTATTGTGGCCTACGATCAACCGTATAATA
GGAAAAGGGTTTTCCCCACACATTTGGAATGGATTCTGTTTATTTGGTTG
ACTGGATTATTTCTTTCGGAGCTGATAAATCCTGTCGATCGTAGTAATGT
TGCCGTTCTAAGAATCTTAATTTTAATTCTTTCAATTGCGTCAGTTATGG
TGCATTTTATGTCTTATTTCATTAAAACACTTGAACTGCCGGAAATGATT
TATATACGAAACCAAATTCTAGGAGCATCGACATTTCTCTGTTTTGTGGT
GAGTTTAGATTTCCTGTCTTTTCATCATCTATTTGGACCTTGGACAATTA
TTGTTCGAGAGTTAATAAGAGACCTTTTTAAGTTTTTAGTGTTTTTCATT
ATCTTTTTGTTTGCTTTTGCTTGTATGCTTTCTGGAACGTACCAACCAAT
TATTCTTCAGTCCAAAACATCGAATAGTGAAGAAACCAATAAGGATATAA
TTGACATGGCTATTTTACTTTATTTTTCCGTGTTTGGCCAAGTGACTCCA
GATGACCTACCAAATCCGGATATCACTCCGAAGTATTCGGATAAATTAGC
AAGATTTATTTTTTCATGTGCCTTGATGATCATAATCATTGTTCTTGTCA
ATTTGTTAATAGCAATGATGACAGACACTTATCAAAGAATTCAGGCACGG
TCTGACATTGAATGGAAATTCGGGAGGGCTAAGTTAATTAGGAATATGAA
ACATACTACTCCAGTTCCATCACCATTTATAATAATATATCAATTCTGGC
TTTATTCCTCAATACTTTATTATAAAATAAGAAATATACCGATAGAAAGT
TTATTGGAAGATGAGGTTGATGATCCGGAACATAAGTCGAGAAGAAAATC
CCAAGTATCACCCAATATTCTCGAAGCATCTAAAACATCACGACATGGAT
CTGAAAAACTAGAAGAAGTTGTAAACTGGTCGGACATTATAAACAAATAC
CTAGCTATCCGTGGAAATAAGTCTGGGGAGAAAAATCACAACTAGAAATC
ATAACACTTTTGATAGCTATTTACGATATTGTTCTAATCACATTCGTTGA
CTTTATAATGCAATTCTTTACTTGTTATATTTTCATCATATAGAAATGAA
TTGTTATATTTACTACAATTAATTTATGT
back to top

protein sequence of SMED30034378-orf-1

>SMED30034378-orf-1 ID=SMED30034378-orf-1|Name=SMED30034378-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=510bp
MICSKLNNYKTIEEFIHVSPAPAETAAKLSKLYFILSGKEKERSKDLQMI
SKYCEAMCTDLVALAAYESGADKLLKSYDKNGIQFLDILIETEQKEVISH
ASVQKYLSVVWKGNLNWPTWKFCLLFFILIFPVSWLYAMFPKGKILFKSP
VIKFVVYLFSHIIMTILLLIVAYDQPYNRKRVFPTHLEWILFIWLTGLFL
SELINPVDRSNVAVLRILILILSIASVMVHFMSYFIKTLELPEMIYIRNQ
ILGASTFLCFVVSLDFLSFHHLFGPWTIIVRELIRDLFKFLVFFIIFLFA
FACMLSGTYQPIILQSKTSNSEETNKDIIDMAILLYFSVFGQVTPDDLPN
PDITPKYSDKLARFIFSCALMIIIIVLVNLLIAMMTDTYQRIQARSDIEW
KFGRAKLIRNMKHTTPVPSPFIIIYQFWLYSSILYYKIRNIPIESLLEDE
VDDPEHKSRRKSQVSPNILEASKTSRHGSEKLEEVVNWSDIINKYLAIRG
NKSGEKNHN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR002153TRPC_channel
IPR005821Ion_trans_dom
Vocabulary: biological process
TermDefinition
GO:0070588calcium ion transmembrane transport
GO:0006811ion transport
GO:0055085transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005262calcium channel activity
GO:0005216ion channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002153Transient receptor potential channel, canonicalPRINTSPR01097TRNSRECEPTRPcoord: 204..225
score: 40.37
coord: 226..239
score: 56.72
IPR002153Transient receptor potential channel, canonicalPANTHERPTHR10117TRANSIENT RECEPTOR POTENTIAL CHANNELcoord: 4..298
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 5..233
e-value: 3.1E-14
score: 52.8
NoneNo IPR availablePANTHERPTHR10117:SF54TRANSIENT RECEPTOR POTENTIAL-GAMMA PROTEINcoord: 4..298
NoneNo IPR availableTMHMMTMhelixcoord: 51..73
NoneNo IPR availableTMHMMTMhelixcoord: 198..220
NoneNo IPR availableTMHMMTMhelixcoord: 88..110
NoneNo IPR availableTMHMMTMhelixcoord: 22..44
NoneNo IPR availableTMHMMTMhelixcoord: 127..149