slc6a-5

Overview
Nameslc6a-5 (AKN21425.1)
Smed IDSMED30034376
Length (bp)1999
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc6a-5 (SMED30034376) t-SNE clustered cells

Violin plots show distribution of expression levels for slc6a-5 (SMED30034376) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc6a-5 (SMED30034376) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc6a-5 (SMED30034376) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034376

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30034376SMESG000042443.1 Contig4940GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034376SMESG000042091.1 PL08004B1D01ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034376SMESG000042091.1 Contig4940GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30034376SMESG000042091.1 dd_Smed_v4_4290_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30034376SMESG000042091.1 dd_Smed_v4_4290_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30034376SMESG000042091.1 dd_Smed_v4_4290_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034376SMESG000042091.1 dd_Smed_v4_4290_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034376SMESG000042091.1 dd_Smed_v4_4290_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034376SMESG000042091.1 dd_Smed_v4_4290_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30034376SMESG000042091.1 Contig45795newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30034376SMESG000042091.1 Contig45795uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30034376SMESG000042091.1 Contig45795newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30034376SMESG000042091.1 Contig45795uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
collecting ductSMED30034376SMESG000042091.1 Smed-slc6a-5smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
proximal tubuleSMED30034376SMESG000042091.1 Smed-slc6a-5smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc6a-5 vs. Ensembl Human
Match: SLC6A5 (solute carrier family 6 member 5 [Source:HGNC Symbol;Acc:HGNC:11051])

HSP 1 Score: 519.235 bits (1336), Expect = 1.356e-174
Identity = 274/593 (46.21%), Postives = 383/593 (64.59%), Query Frame = 1
Query:   94 VISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC------------LTDFRNKTISN---CST---------LNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFI---YYAIFKGVTK-----TPKDSWGP 1776
            V ++ D Q  +  ARGNWS + DF LS VGYAVGLGN+WRFP+L + +GGGAFL+PY +ML +AG+PIF+ E++LGQF+S GP+S+WK  P  +G G +MLI++ ++++YYNVII ++L+YLFASF S LPW  CNN WN   C            ++D     I N   C T           +Q    +   +E+Y+K  VL +   AG   P     G ++W L LCL LAW+I  A L KG+K+SGKVVYFTA FPYVV++I+++ G  L G+  GI Y++ PKW+KL    VW+DAATQIF+SL  A+GGL+T+SSYNKF+NNCYRD L+V+  N  TS  AGF IFSV+G+MA++    IE     G G+AFV Y ++L+ + ++P W+I+FFLMLLTLG+D+ F  +E I T + DEFP   +TH     F +   I  F +G   +++GGIYMF ++D Y+ ++ L IIAIFEL+ I Y+YG++ F +DI+MM+GF+P  +W  CW  VTP  + FIL  SF    P  +G+Y  P W+ VLG+LM    VI I + F+   + A  + + +     +P+  WGP
Sbjct:  177 VATQEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKIS--AGIEYP-----GEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTH--KPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMHLAPGRFIERLKLVCSPQPDWGP 760          
BLAST of slc6a-5 vs. Ensembl Human
Match: SLC6A7 (solute carrier family 6 member 7 [Source:HGNC Symbol;Acc:HGNC:11054])

HSP 1 Score: 482.641 bits (1241), Expect = 1.243e-162
Identity = 256/535 (47.85%), Postives = 368/535 (68.79%), Query Frame = 1
Query:  103 EVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINI 1707
            +VD        RGNW+G+ DF LSC+GY VGLGN+WRFP+  Y +GGGAFLVPYF+ML I GIP+F+ EL+LGQFSS GP+++WK+ P+FKG G +ML++  +V++YYN+IIA+ L+YLFAS TS LPW  C N WN E CL    +K  +    LN    +     +E+YW + VL ++   G   P     G ++W+LCLCLLLAW+I   C++KGVKSSGKVVYFTA FPY+++++++V G  L G+  GIQ+YL P++  LLS +VW +AA QIFYSLGV FGGL+T +SYN F+ N YRD  +V++ N +TS LAGFAIFSVLGYM+ + G  ++Q   +G GLAFV Y Q+++ + ++P WS LFF MLLTLG+DSQF  +E I T + DEFP   +       F   + + ++ +G+   + GG+Y   ++D+YS +F L ++ I   + +  +YG++ F +DI MMLGFKPG Y+ ACW+ ++P T++ +++ S + + P+++G+Y  P WA +LG LM L+  + I
Sbjct:   26 DVDLDVDFAAHRGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSDLPWEHCGNWWNTELCLEHRVSKDGNGALPLNLTCTVS---PSEEYWSRYVLHIQGSQGIGSP-----GEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLRPK--KAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRACWLFLSPATLLALMVYSIVKYQPSEYGSYRFPPWAELLGILMGLLSCLMI 550          
BLAST of slc6a-5 vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 482.256 bits (1240), Expect = 3.609e-162
Identity = 270/630 (42.86%), Postives = 383/630 (60.79%), Query Frame = 1
Query:   52 RMAS----VEDSSKTNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC--LTDFRNKT--------ISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPME-PFLG--PVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFP---ILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAI----------FKGVTKTPKDSWGPGNKADWEIDDRYAVKSSPCDNDKMD 1851
            RMA+    V  SS      +    ++  +   RGNW  + +F L+ VGYAVGLGN+WRFP+LCY +GGGAF+ PYFIML+  GIP+F+ EL+ GQF+S G + +W++ PMFKG+GY M++V+T + +YYNV+I  + YY F+S T  LPW+ CNN WN   C  + D  N T         SN S L   + ++    +E+YW+  VL + D  GN   +  P LG   V W          ++   CLI+GVKSSGKVVYFTA FPYVV+ I+ V G  L G+  GI YYL P+W K+L  +VW DAA+QIFYSLG A+GGL+TM+SYNKF+NNCYRD++++S+ NC TS  AGF IFS+LG+MA+  G  + +    G GLAFVAY ++L+ + ++PLWS+LFF ML+ LG+ +QF  +E + T + DE     IL+K  ++     + V +  F LGI   S+ GIY   +MD Y+ +F+L +I+    + IMY+YG +N+ +DI+MMLGF P  ++  CW  V+P  I FIL+ + + + P  + +Y  P WA  +G+LM L  V+ I +Y ++              K  TK  +D WGP          RYA   +P   D  +
Sbjct:   14 RMAAAHGPVAPSSPEQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHL-LNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSW----------LVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYV----TLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRD-WGPALLE--HRTGRYAPTIAPSPEDGFE 625          
BLAST of slc6a-5 vs. Ensembl Human
Match: SLC6A7 (solute carrier family 6 member 7 [Source:HGNC Symbol;Acc:HGNC:11054])

HSP 1 Score: 482.641 bits (1241), Expect = 3.871e-162
Identity = 256/535 (47.85%), Postives = 368/535 (68.79%), Query Frame = 1
Query:  103 EVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINI 1707
            +VD        RGNW+G+ DF LSC+GY VGLGN+WRFP+  Y +GGGAFLVPYF+ML I GIP+F+ EL+LGQFSS GP+++WK+ P+FKG G +ML++  +V++YYN+IIA+ L+YLFAS TS LPW  C N WN E CL    +K  +    LN    +     +E+YW + VL ++   G   P     G ++W+LCLCLLLAW+I   C++KGVKSSGKVVYFTA FPY+++++++V G  L G+  GIQ+YL P++  LLS +VW +AA QIFYSLGV FGGL+T +SYN F+ N YRD  +V++ N +TS LAGFAIFSVLGYM+ + G  ++Q   +G GLAFV Y Q+++ + ++P WS LFF MLLTLG+DSQF  +E I T + DEFP   +       F   + + ++ +G+   + GG+Y   ++D+YS +F L ++ I   + +  +YG++ F +DI MMLGFKPG Y+ ACW+ ++P T++ +++ S + + P+++G+Y  P WA +LG LM L+  + I
Sbjct:   26 DVDLDVDFAAHRGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSDLPWEHCGNWWNTELCLEHRVSKDGNGALPLNLTCTVS---PSEEYWSRYVLHIQGSQGIGSP-----GEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLRPK--KAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRACWLFLSPATLLALMVYSIVKYQPSEYGSYRFPPWAELLGILMGLLSCLMI 550          
BLAST of slc6a-5 vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 478.404 bits (1230), Expect = 6.036e-161
Identity = 268/615 (43.58%), Postives = 379/615 (61.63%), Query Frame = 1
Query:   85 NEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC--LTDFRNKT--------ISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPME-PFLG--PVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFP---ILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAI----------FKGVTKTPKDSWGPGNKADWEIDDRYAVKSSPCDNDKMD 1851
            N  V SE  ++  +   RGNW  + +F L+ VGYAVGLGN+WRFP+LCY +GGGAF+ PYFIML+  GIP+F+ EL+ GQF+S G + +W++ PMFKG+GY M++V+T + +YYNV+I  + YY F+S T  LPW+ CNN WN   C  + D  N T         SN S L   + ++    +E+YW+  VL + D  GN   +  P LG   V W          ++   CLI+GVKSSGKVVYFTA FPYVV+ I+ V G  L G+  GI YYL P+W K+L  +VW DAA+QIFYSLG A+GGL+TM+SYNKF+NNCYRD++++S+ NC TS  AGF IFS+LG+MA+  G  + +    G GLAFVAY ++L+ + ++PLWS+LFF ML+ LG+ +QF  +E + T + DE     IL+K  ++ +     V +  F LGI   S+ GIY   +MD Y+ +F+L +I+    + IMY+YG +N+ +DI+MMLGF P  ++  CW  V+P  I FIL+ + + + P  + +Y  P WA  +G+LM L  V+ I +Y ++              K  TK  +D WGP          RYA   +P   D  +
Sbjct:   11 NGAVPSEA-TKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHL-LNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSW----------LVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYVTLG----VAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRD-WGPALLE--HRTGRYAPTIAPSPEDGFE 606          
BLAST of slc6a-5 vs. Ensembl Celegans
Match: dat-1 (Sodium-dependent dopamine transporter [Source:UniProtKB/Swiss-Prot;Acc:Q03614])

HSP 1 Score: 466.077 bits (1198), Expect = 8.245e-157
Identity = 249/543 (45.86%), Postives = 346/543 (63.72%), Query Frame = 1
Query:  112 SQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIW-KVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLT-DFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGV-EDYAGNLRPMEPF--LGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIY 1725
            +  PK  AR  WSG+ DF LS VG+AV LGN+WRFP+LC+ +GGG FL+PY IM+L+ G+P+FY EL LGQ+   G I+ W ++ P+FKGIGY +++ A  V  +YNVI+AW L+YL+ SF+  LPW+ CNN++N   C    +     + C + N     E   AAE+Y+ K  LG+ E  A N   +     LG V+W + L L + ++IC   + KG+ +SGKVV+FTA+FPYVV+ I+ + G  L G + GI+YYL P ++ L    VW+DAATQ+F+SLG  FG LM  SSYN F+NN Y DAL  S INC TSFL+GF IFSVLGYM+ ++G+ IE     G GL FV Y ++LSTM  AP WS+LFFLML+TLG+DS FGG EAI TGL DEFPILKK   + +    +  ++   +GI   ++GGI +   +  Y  T+ L I    E + I Y+YG++ F+ D+K M+GF+PG YW  CW    P  ++ ++  +F+ +    + +Y  P  ANV+G +  L G   I +  IY
Sbjct:   32 NTEPKDPAREQWSGKLDFLLSVVGFAVDLGNIWRFPYLCFKNGGGVFLIPYSIMVLLTGVPLFYMELCLGQYYRKGAITTWGRICPLFKGIGYCVILTAFYVDFFYNVILAWGLHYLYTSFSFNLPWASCNNSYNSPACYEPHWSEDGTAMCRSANQSVSAEKISAAEEYFYKGFLGLHEANAPNSHVIRSVTDLGNVRWDIALSLFVVYLICYFSMWKGIHTSGKVVWFTALFPYVVLGILFIRGVTLPGWQNGIEYYLRPNFEMLKRPSVWQDAATQVFFSLGPGFGVLMAYSSYNDFHNNVYVDALFTSFINCATSFLSGFVIFSVLGYMSCKSGKPIEAVAQEGPGLVFVVYPEALSTMPYAPFWSVLFFLMLMTLGLDSSFGGSEAIITGLSDEFPILKKNREVFVGCLFAFYMV---IGIAMCTEGGILIMEWLIIYGTTWGLLIAVFCEAMVIAYIYGLRQFVHDVKEMMGFRPGNYWKFCWSCAAPFILLSMITSNFINYQALTYQDYTYPTAANVIGIIFALSGASFIPLVGIY 571          
BLAST of slc6a-5 vs. Ensembl Celegans
Match: mod-5 (Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7])

HSP 1 Score: 426.402 bits (1095), Expect = 1.253e-140
Identity = 237/566 (41.87%), Postives = 345/566 (60.95%), Query Frame = 1
Query:   55 MASVEDSSKTNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIW-KVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFT----SKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTT-TSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTP--LTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYY 1728
            +A++   + T E  ++ +  ++  +  R  W+ + +F L+ VGYAV LGN+WRFP +CY HGGGAFL+PYFIML+I G+P+FY EL LGQF  SG +SIW KV P+F+GIGY +  + T ++++YN IIA ++Y+   S +    S++PW+ C N WN  RC  D  N TIS       +N       +E+Y+   VL V+   G        LG V+  + +CLL  +I+    L KG +SSGK+V+ TA  PY+++ I+++ G LL G+K G+ YY+ P ++KL    VW  AATQIF+SLG  FG L+ +SSYN FNNNCYRDA+  S+INC TSF +G  +FS LGYM+  T + I +      + L F+ Y Q+L+TM  +  WS +FF+ML+TLGIDS F G+EA  TG  DE   L K       F + + II +FL    +S GG ++   +DEY  + ++  I   E+I + + YGV  F KDI+ MLGF PG YW  CW   +P  +++IFI+ +      P +  +Y  P W+ +LG+ + L+ V+ I V+ I Y
Sbjct:   75 IAALGGLTPTKEGRVAALRRRS--SMVRDKWATKMEFLLAVVGYAVDLGNIWRFPSVCYKHGGGAFLIPYFIMLMIGGLPMFYMELVLGQFHRSGCVSIWRKVCPLFRGIGYGICCICTFIAIFYNAIIAQAVYFAIVSLSKIWDSEVPWASCGNPWNTPRCSDDL-NVTIS-------RNGTPLTTPSEEYYLYKVLEVQKSTGFDD-----LGGVKTSMAVCLLAVFIMVYFALWKGPQSSGKIVWVTATAPYIILSILLIRGLLLPGAKNGLYYYVTPDFEKLKDPAVWSAAATQIFFSLGPGFGVLLALSSYNDFNNNCYRDAVTTSIINCATSFFSGCVVFSTLGYMSLLTNKPINEVVGEHDASLIFIVYPQALATMDYSCFWSFIFFVMLITLGIDSTFAGIEAFITGFCDESRFLSKNR---KWFVLVICIIYYFLSFPAISYGGQFVIPFLDEYGVSLSVLFIVTCEMIAVCWFYGVDQFSKDIRAMLGFYPGIYWRVCW-TCSPVFISVIFIMTVYNSSFKPIQMASYTFPWWSVILGWFLRLLSVLAIPVFAIIY 621          
BLAST of slc6a-5 vs. Ensembl Celegans
Match: snf-3 (Sodium- and chloride-dependent betaine transporter [Source:UniProtKB/Swiss-Prot;Acc:G5EBN9])

HSP 1 Score: 393.275 bits (1009), Expect = 1.094e-128
Identity = 218/579 (37.65%), Postives = 330/579 (56.99%), Query Frame = 1
Query:   82 TNEQVISEVD-SQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKT-ISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFF---LGITCVSKGGIYMFSIMDEYSGT-FTLQIIAIFELITIMYLYGVKNFMKDIKMMLG--FKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGN-YILPVWANVLGYLMTLVGVINIVVYFIYYAIFKGVTKTPKDSWGPGNKAD 1791
            T+E    E++ SQ  +   RG W+G+FDF +S V YAVGLGN+WRFP+LCY +GGG+FLV Y I   +A +PIF  E+ +GQ+   G + +W + P+F+G+G   +++A +   Y+ VI+AW+++Y+ +S     PW  CNN WND  C+T   N T ++    L        + + EQ+W+K VL      G++       G +QW L   +  AW+I    L KG+  + K VYF A+FPYV+I I+++ G  L G+  GI +YL P   +LL   VW+DA TQ+FYS GV FG L+ + S+NKFN+NC++DA+ +  IN  TS  AGFA+FS+LGYM+H   + I +    G GLAF+AY +  S + +  ++++LFFLM+  LG+DSQ   ME +FT L+D FPIL+K        K S+ I   F   +GI  V+  G +  ++ D Y  + + L  +  FE++ + Y +G  N  K +  M+G     G  +V  W    P T + + +   +Y+ P K+ +    P WAN  G+ ++   ++ I  Y IYY  F     T K+    G   D
Sbjct:   11 TDEAKAKELEQSQHSEEPDRGQWTGKFDFLMSMVAYAVGLGNVWRFPYLCYKNGGGSFLVVYMIFFCLAAVPIFLMEVTVGQYLQKGAMEMWLMCPLFRGVGIGNVVIAFMCIAYFCVIVAWAMFYMISSIAWVFPWETCNNYWNDATCVTGKENFTELARIKALVASAGGHTQTSVEQFWEKRVL---HDTGDISE----FGGIQWELFFIMAAAWLIVYFALWKGITQARKFVYFCALFPYVLIFILLIRGLTLEGAGTGIYFYLKPNATRLLDTAVWKDAGTQVFYSYGVGFGALIALGSHNKFNHNCFKDAITMCFINGCTSITAGFAVFSILGYMSHVAQKDISEIVKPGVGLAFLAYPEVASNLPMKQVFAVLFFLMITILGLDSQVCMMEGLFTALEDAFPILRKYK------KQSLGIFCLFFFCIGIPMVTHSGSHWLTLFDAYGASGYALLFVVFFEVVGLAYGFGAHNIRKALHEMIGVTLPKGIEYV--WKFCAPATSLVLFVFCVVYYHPVKYPDGKDFPFWANAFGWFLSSCSMVVIPGYAIYYLFFTNKHLTLKERVRKGLNLD 574          
BLAST of slc6a-5 vs. Ensembl Celegans
Match: snf-11 (Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43])

HSP 1 Score: 383.259 bits (983), Expect = 8.785e-125
Identity = 214/572 (37.41%), Postives = 334/572 (58.39%), Query Frame = 1
Query:  115 QTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFT-SKLPWSDCNNAWNDERCLTDF------RNKTIS---NCSTLNTQNCIEYE----------------------VAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGT-FTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFG--NYILPVWANVLGYLMTLVGVINIVVYFIY 1725
            +      R  WS   DF +SC+GYA+GLGN+WRFP+LCY +GGGAFL+PY I L+  G P+F  E + GQ  S G + ++K+ P+FKG+G +  ++A  +++YY V+++W+  YL+ SFT S +PW +C++AWN   C +++       N+TI+   N   L   +  EY+                         +++W   VLG+   +G   P     G ++W L L LLL WIIC  C+ KGVK +GKVVY TA FPY+++  +++ G  L G+ +G+++YL P + KLL  +VW DA TQ+F+S G+  G L+ + SYNKFNNN Y+ AL V  +N  TS  AGF IFS +G+MA Q  +++ +   +G GL F+AY   +  +     WS LFFLM+L LG+DSQF  ME  FT + DEFP +++  +    F   + +I + +G+T V++GG Y+F + D Y+ + + L  +  FE I I +  G+  + + +K M+G+ P  +W  CW+  TP     +L+   + + P +    NY  PVW ++ G+ ++L  ++ I  Y I+
Sbjct:    3 EATSVAEREQWSSWADFIMSCIGYAIGLGNVWRFPYLCYQNGGGAFLIPYCISLVFCGAPLFILETSWGQLMSVGGLGMFKICPIFKGVGIAAAVMAFWLNIYYIVVLSWAATYLYNSFTMSDVPWKNCDHAWNTPNCRSEYVKIPCDSNRTIAEFFNVKVLTHDHIHEYKKQFFVGEKMNWTVCSAADLSVVSPVKEFWNHRVLGIS--SGLENP-----GGIRWDLALFLLLVWIICYLCIFKGVKWTGKVVYITASFPYMMLFCLLIRGLTLEGAGVGLEFYLKPDFSKLLESKVWVDAVTQVFFSYGLGLGALVALGSYNKFNNNVYKQALTVCFVNSGTSVFAGFVIFSFIGFMATQQEKSVAEVAQAGPGLLFLAYPSGILQLPYTQFWSCLFFLMVLFLGVDSQFCTMEGFFTAIIDEFPQIRRKKYGREIFVGVICVISYLIGLTTVTEGGFYVFQLFDFYAASGWALLWLLFFECIAISWSLGIDRWYEHMKSMIGYYPSAWWKFCWVFATPSVCFGVLLFGLIKYQPLRIDAYNYDYPVWGHIFGWFLSLSSMLCIPGYAIW 567          
BLAST of slc6a-5 vs. Ensembl Celegans
Match: snf-6 (Sodium-dependent acetylcholine transporter [Source:UniProtKB/Swiss-Prot;Acc:O76689])

HSP 1 Score: 314.694 bits (805), Expect = 3.232e-97
Identity = 192/596 (32.21%), Postives = 327/596 (54.87%), Query Frame = 1
Query:   88 EQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCL--TDFRNKTISNCSTLNTQNCIEYEVAAE---------------QYWKKVVL----GVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQ-TTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYY--WVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIY-YAIFKGVTKT-------PKDSWGPG 1779
            E    E+     +   RGNWS + D+ L+ +G+  G+G+ W+FP L + HGG AFLVPY  ML +A +P+F+ E+ LGQFSSS  IS+WKV P+FKGIG++ + ++   +V++N+I AW+L+YL  SF+  +PWS+C N+W+ E C   T  + K ++    +N    +E+  + E               +Y++  VL    GV+D+           G + W+L LC+L  WI    CL +GVKSSGKVVY   I P++++ +++     L GS   + Y+L PKW+ L+ + VW +AA Q FYS+    GGL T++SY++F+NN Y+D  LV +++ + S +     FS +G+  ++   ++++     G  L FV  A++L+ + VAPL++ LFF+M+L +   +Q   +E I + + DE+P   + +   +   +    IL  L I      G++   ++ ++  T+ L +IA  E + I ++YGV N + + K ++G+ P  Y  W   +  + P+  + IL   ++     ++ +Y  P W+ +  + +    +I I +  I+ + I KG           P D+WGP 
Sbjct:   48 EYPFEEITGVGDENRIRGNWSNKSDYLLAVIGFTAGVGSFWKFPFLVFQHGGAAFLVPYLCMLCLASLPMFFMEMVLGQFSSSAAISVWKVVPLFKGIGFAQVTISGFFAVFFNIISAWTLFYLINSFSFSIPWSNCANSWSGENCTLGTRIQCKEMNGTLLVNGSCIVEHASSNETTVIPLHDLGSIPSLKYFQNDVLMLSKGVDDF-----------GTLNWYLGLCVLACWIAVFLCLFQGVKSSGKVVYVAVIVPFIILTVLLTRLLTLDGSLAAVFYFLTPKWEILMDLHVWGEAAVQAFYSVSCCSGGLFTIASYSRFHNNIYKDIWLVLIVDVIVSLVGCLLTFSAIGFTCYEFAISLDKFHIRDGFHLVFVFLAEALAGVSVAPLYAGLFFIMILLVVHATQMFVVETIVSSICDEYPERLRRNRRHVLTTVCALFIL--LSIPFCLSSGLFWMELLTQFVLTWPLVVIAFLECMAINWVYGVDNMLDNAKWIVGYWPPCYIFWKILFKFICPMVYLAILCFLWLDWNSIQYESYQFPYWSILTAWCIASFPLILIPIVGIWQFCIAKGTITQKWWRVLYPDDAWGPA 630          
BLAST of slc6a-5 vs. Ensembl Fly
Match: DAT (gene:FBgn0034136 transcript:FBtr0087125)

HSP 1 Score: 476.093 bits (1224), Expect = 2.357e-160
Identity = 251/580 (43.28%), Postives = 361/580 (62.24%), Query Frame = 1
Query:   55 MASVEDSSKTNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIW-KVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCL-------------------------TDFRNKTISNCSTLNTQ---NCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINI 1707
            M+     SK+      + D+ +  +  R  WSG+ DF LS +G+AV L N+WRFP+LCY +GGGAFLVPY IML++ GIP+FY ELALGQ +  G I+ W ++ P+FKGIGY+++++A  V  YYNVIIAWSL + FASFT+ LPW+ CNN WN   C                          +   N+T  N S+L+T    +   ++ AA +Y+ + +L +    G        LG ++W + LCLL+ ++IC   L KG+ +SGKVV+FTA+FPY V++I+++ G  L GS +GIQYYL P +  +   +VW DAATQ+F+SLG  FG L+  +SYNK++NN Y+DALL S IN  TSF+AGF IFSVLGYMAH  G  IE   T G GL FV Y  +++TM  +  W+++FF+MLLTLG+DS FGG EAI T L DEFP +K+   + +A   S   + F +G+   ++GG Y F ++D Y+  +++ +   FE I + ++YG   F +DI+ M+GF PG YW  CW  V P+ ++FI +   + + P  + +Y+ P WAN LG+ +    V+ I
Sbjct:    1 MSPTGHISKSKTPTPHDNDNNS-ISDERETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFESQNASRVPVIGNYSDLYAMGNQSLLYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNRSEGIHD-----LGAIKWDMALCLLIVYLICYFSLWKGISTSGKVVWFTALFPYAVLLILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFVIFSVLGYMAHTLGVRIEDVATEGPGLVFVVYPAAIATMPASTFWALIFFMMLLTLGLDSSFGGSEAIITALSDEFPKIKRNRELFVAGLFS---LYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFPPGRYWQVCWRFVAPIFLLFITVYGLIGYEPLTYADYVYPSWANALGWCIAGSSVVMI 571          
BLAST of slc6a-5 vs. Ensembl Fly
Match: DAT (gene:FBgn0034136 transcript:FBtr0330002)

HSP 1 Score: 476.093 bits (1224), Expect = 3.472e-160
Identity = 251/580 (43.28%), Postives = 361/580 (62.24%), Query Frame = 1
Query:   55 MASVEDSSKTNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIW-KVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCL-------------------------TDFRNKTISNCSTLNTQ---NCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINI 1707
            M+     SK+      + D+ +  +  R  WSG+ DF LS +G+AV L N+WRFP+LCY +GGGAFLVPY IML++ GIP+FY ELALGQ +  G I+ W ++ P+FKGIGY+++++A  V  YYNVIIAWSL + FASFT+ LPW+ CNN WN   C                          +   N+T  N S+L+T    +   ++ AA +Y+ + +L +    G        LG ++W + LCLL+ ++IC   L KG+ +SGKVV+FTA+FPY V++I+++ G  L GS +GIQYYL P +  +   +VW DAATQ+F+SLG  FG L+  +SYNK++NN Y+DALL S IN  TSF+AGF IFSVLGYMAH  G  IE   T G GL FV Y  +++TM  +  W+++FF+MLLTLG+DS FGG EAI T L DEFP +K+   + +A   S   + F +G+   ++GG Y F ++D Y+  +++ +   FE I + ++YG   F +DI+ M+GF PG YW  CW  V P+ ++FI +   + + P  + +Y+ P WAN LG+ +    V+ I
Sbjct:    1 MSPTGHISKSKTPTPHDNDNNS-ISDERETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFESQNASRVPVIGNYSDLYAMGNQSLLYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNRSEGIHD-----LGAIKWDMALCLLIVYLICYFSLWKGISTSGKVVWFTALFPYAVLLILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFVIFSVLGYMAHTLGVRIEDVATEGPGLVFVVYPAAIATMPASTFWALIFFMMLLTLGLDSSFGGSEAIITALSDEFPKIKRNRELFVAGLFS---LYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFPPGRYWQVCWRFVAPIFLLFITVYGLIGYEPLTYADYVYPSWANALGWCIAGSSVVMI 571          
BLAST of slc6a-5 vs. Ensembl Fly
Match: SerT (gene:FBgn0010414 transcript:FBtr0072362)

HSP 1 Score: 450.284 bits (1157), Expect = 2.011e-150
Identity = 246/576 (42.71%), Postives = 363/576 (63.02%), Query Frame = 1
Query:   82 TNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWK-VQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVA-AEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFP--ILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIY---YAIFKGVTKTPKDSWGPGNKA 1788
             NE+++  V S T +T  R  W  + +F L+ +G+AV LGN+WRFP++CY +GGGAFLVPY + L+  G+P+FY ELALGQF   G +SIWK + P  KG+GY++ ++   + +YYN II W++YYLFASFTSKLPW+ C+N WN E            NC  + ++N  E   + A++++++ VL  E Y GN      F+GPV+  L LC+   +++    L KGV+S+GKVV+ TA+ PYVV+II++V G  L G+  GI+YYL P+W KL + +VW DAA+QIF+SLG  FG L+ +SSYNKFNNNCYRDAL+ S INCLTSFLAGF IFSVLGYMA+    +I++    G GL F+ Y ++++TM  +  WSI+FFLML+TLG+DS FGG+EA+ T L DE+P  I ++       F + +   +F   +  ++ GG+ + + ++ Y     +  +   E   + + YGV  F  D++ MLG KPG +W  CW  ++P+ ++ I I S M +       Y  P W+  +G+ +T   V+ I +Y IY   +A   G  +  ++S+ P +  
Sbjct:   60 NNERIL--VVSVTERT--RETWGQKAEFLLAVIGFAVDLGNVWRFPYICYQNGGGAFLVPYCLFLIFGGLPLFYMELALGQFHRCGCLSIWKRICPALKGVGYAICLIDIYMGMYYNTIIGWAVYYLFASFTSKLPWTSCDNPWNTE------------NCMQVTSENFTELATSPAKEFFERKVL--ESYKGN---GLDFMGPVKPTLALCVFGVFVLVYFSLWKGVRSAGKVVWVTALAPYVVLIILLVRGVSLPGADEGIKYYLTPEWHKLKNSKVWIDAASQIFFSLGPGFGTLLALSSYNKFNNNCYRDALITSSINCLTSFLAGFVIFSVLGYMAYVQKTSIDKVGLEGPGLVFIVYPEAIATMSGSVFWSIIFFLMLITLGLDSTFGGLEAMITALCDEYPRVIGRRREL----FVLLLLAFIFLCALPTMTYGGVVLVNFLNVYGPGLAILFVVFVEAAGVFWFYGVDRFSSDVEQMLGSKPGLFWRICWTYISPVFLLTIFIFSIMGYKEMLGEEYYYPDWSYQVGWAVTCSSVLCIPMYIIYKFFFASKGGCRQRLQESFQPEDNC 610          
BLAST of slc6a-5 vs. Ensembl Fly
Match: SerT (gene:FBgn0010414 transcript:FBtr0343316)

HSP 1 Score: 450.284 bits (1157), Expect = 2.011e-150
Identity = 246/576 (42.71%), Postives = 363/576 (63.02%), Query Frame = 1
Query:   82 TNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWK-VQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVA-AEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFP--ILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIY---YAIFKGVTKTPKDSWGPGNKA 1788
             NE+++  V S T +T  R  W  + +F L+ +G+AV LGN+WRFP++CY +GGGAFLVPY + L+  G+P+FY ELALGQF   G +SIWK + P  KG+GY++ ++   + +YYN II W++YYLFASFTSKLPW+ C+N WN E            NC  + ++N  E   + A++++++ VL  E Y GN      F+GPV+  L LC+   +++    L KGV+S+GKVV+ TA+ PYVV+II++V G  L G+  GI+YYL P+W KL + +VW DAA+QIF+SLG  FG L+ +SSYNKFNNNCYRDAL+ S INCLTSFLAGF IFSVLGYMA+    +I++    G GL F+ Y ++++TM  +  WSI+FFLML+TLG+DS FGG+EA+ T L DE+P  I ++       F + +   +F   +  ++ GG+ + + ++ Y     +  +   E   + + YGV  F  D++ MLG KPG +W  CW  ++P+ ++ I I S M +       Y  P W+  +G+ +T   V+ I +Y IY   +A   G  +  ++S+ P +  
Sbjct:   60 NNERIL--VVSVTERT--RETWGQKAEFLLAVIGFAVDLGNVWRFPYICYQNGGGAFLVPYCLFLIFGGLPLFYMELALGQFHRCGCLSIWKRICPALKGVGYAICLIDIYMGMYYNTIIGWAVYYLFASFTSKLPWTSCDNPWNTE------------NCMQVTSENFTELATSPAKEFFERKVL--ESYKGN---GLDFMGPVKPTLALCVFGVFVLVYFSLWKGVRSAGKVVWVTALAPYVVLIILLVRGVSLPGADEGIKYYLTPEWHKLKNSKVWIDAASQIFFSLGPGFGTLLALSSYNKFNNNCYRDALITSSINCLTSFLAGFVIFSVLGYMAYVQKTSIDKVGLEGPGLVFIVYPEAIATMSGSVFWSIIFFLMLITLGLDSTFGGLEAMITALCDEYPRVIGRRREL----FVLLLLAFIFLCALPTMTYGGVVLVNFLNVYGPGLAILFVVFVEAAGVFWFYGVDRFSSDVEQMLGSKPGLFWRICWTYISPVFLLTIFIFSIMGYKEMLGEEYYYPDWSYQVGWAVTCSSVLCIPMYIIYKFFFASKGGCRQRLQESFQPEDNC 610          
BLAST of slc6a-5 vs. Ensembl Fly
Match: GlyT (gene:FBgn0034911 transcript:FBtr0301162)

HSP 1 Score: 454.521 bits (1168), Expect = 1.102e-145
Identity = 243/580 (41.90%), Postives = 371/580 (63.97%), Query Frame = 1
Query:  136 RGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKV-QPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNT----QNCIEYEVAAEQYWKKVVLGV------EDYAGN----LRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKP---GYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYA---------IFKGVTK---TPKDSWGPGNK 1785
            RG W+GRFDF LS +GY+VGLGN+WRFP+LCY +GGGAFL+P+ IML+IAG+P+ + EL+ GQ+++ GP+++++   P+F+G+G  M++V+ IV +YYN+IIAW+++Y+FASF   LPW +C  AW+ + C   F       C   N     + C     AAE     + LG       E+Y  N    L       G ++  L  CL LAW I   CL KGV+SSGKVVYFTA+FPYVV++I+ V G  L G+  GI +YL P WK+L + QVW DAA QIF++L  A+GGL+T+SSYNKF+NNCY+D+L+V+  N  TSF AG  IFS++G++AH+    +E+    G+GLAF+ Y + ++ + V+P+W++LFF+MLLTLG+DSQF  ME + T + D FP L++     I   +SV I  +  G+   +  G+Y   +MD+Y+  +++ +IAI E I I ++YG + F+ DI+ M+G +     ++W   W  +TP T++FIL  +++ + P K+G+Y+ P+WA+ +G+++ L+ V  +V++ + +           F+   K    P   WGP  +
Sbjct:   57 RGTWTGRFDFLLSLLGYSVGLGNVWRFPYLCYNNGGGAFLIPFTIMLVIAGLPLMFMELSFGQYAALGPVAVYRRFCPLFRGLGTGMILVSAIVMLYYNLIIAWTIFYMFASFAPVLPWQNCEPAWSTKYC---FSYAQADQCEATNGTYYLRTCHNATSAAENNITTLALGALKRPPAEEYFNNFVLGLSKGIEETGSIKLSLAACLFLAWTIVFLCLCKGVQSSGKVVYFTALFPYVVLVILFVRGVTLPGASTGILFYLTPDWKQLANAQVWGDAAVQIFFALSPAWGGLITLSSYNKFSNNCYKDSLIVAFCNIATSFFAGLVIFSIIGFLAHELNVDVEKVVDQGAGLAFIVYPEVVTRLPVSPVWAVLFFVMLLTLGLDSQFALMETVTTAILDRFPNLRQ---YKIWVVLSVAIFGYIGGLGFTTNSGMYWLQLMDKYAANWSVLLIAISECILIAWIYGSQRFLNDIQGMIGKRSWFWNFFWGIMWRYITPATLLFILFFNWVEYKPAKYGHYVYPMWADAVGWIVGLLPV--LVIFLVAFQEIWRAPMSLSFRDRIKHLLQPTAEWGPAGR 628          
BLAST of slc6a-5 vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 498.819 bits (1283), Expect = 3.501e-167
Identity = 267/590 (45.25%), Postives = 373/590 (63.22%), Query Frame = 1
Query:  124 KTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC------LTD---FRNKTISNCSTLNTQNCIEYEV-------------------AAEQYWKKVVLGVE---DYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYF-IYYAIFKG-------VTKTPKDSWGP 1776
            +  ARGNWS + DF LS VGYAVGLGN+WRFP+L + +GGGAFL+PY IML +AGIPIF  E++LGQF+S GP+S+WK  P  +G G +MLI++ ++++YYN+I+ W+LYYLFAS    LPW+ C N WN   C      L D    R++ I+  S  NT  C+   V                    +E+Y+K  VL +    +Y G++R          W L  CL LAW+I  A L KG+KSSGKVVYFTA FPYVV++I+++ G  L G+  GI Y++ PKW+KL   +VW+DAATQIF+SL  A+GGL+T+SSYNKF+NNCYRD L+V+  N  TS  AGF IFSV+G+MAH+    IE     G G+AFV Y ++L+ + ++P W+I+FFLMLLTLG+D+ F  +E I T + DEFP   + H     F +   +  F LG   +++ G+YM  ++D ++ +++L IIAIFEL+ I Y+YG++ F +DI+MM+GF+P  +W  CW  VTP  + FIL LS        + +Y  P W+ VLG+LM +  VI I + F I   +  G       +  +P+  WGP
Sbjct:  165 ENKARGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLGLAGIPIFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPWATCKNEWNTVECKDKDMLLLDTCILRDRNIT--SIKNTTFCLSANVVGNLSKLLNVTVDNKTYVSPSEEYFKYNVLHISKGIEYPGDIR----------WPLAACLFLAWLIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGSGILYFITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYLRKH--KPQFTLVCCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIGFQPNKFWRVCWAFVTPTILTFILALSLYQWKVMTYEDYTYPNWSMVLGWLMVICSVIWIPIMFAIKMHLAPGSLIERLKLVCSPQPDWGP 740          
BLAST of slc6a-5 vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 498.819 bits (1283), Expect = 3.899e-167
Identity = 267/590 (45.25%), Postives = 373/590 (63.22%), Query Frame = 1
Query:  124 KTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC------LTD---FRNKTISNCSTLNTQNCIEYEV-------------------AAEQYWKKVVLGVE---DYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYF-IYYAIFKG-------VTKTPKDSWGP 1776
            +  ARGNWS + DF LS VGYAVGLGN+WRFP+L + +GGGAFL+PY IML +AGIPIF  E++LGQF+S GP+S+WK  P  +G G +MLI++ ++++YYN+I+ W+LYYLFAS    LPW+ C N WN   C      L D    R++ I+  S  NT  C+   V                    +E+Y+K  VL +    +Y G++R          W L  CL LAW+I  A L KG+KSSGKVVYFTA FPYVV++I+++ G  L G+  GI Y++ PKW+KL   +VW+DAATQIF+SL  A+GGL+T+SSYNKF+NNCYRD L+V+  N  TS  AGF IFSV+G+MAH+    IE     G G+AFV Y ++L+ + ++P W+I+FFLMLLTLG+D+ F  +E I T + DEFP   + H     F +   +  F LG   +++ G+YM  ++D ++ +++L IIAIFEL+ I Y+YG++ F +DI+MM+GF+P  +W  CW  VTP  + FIL LS        + +Y  P W+ VLG+LM +  VI I + F I   +  G       +  +P+  WGP
Sbjct:  173 ENKARGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLGLAGIPIFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPWATCKNEWNTVECKDKDMLLLDTCILRDRNIT--SIKNTTFCLSANVVGNLSKLLNVTVDNKTYVSPSEEYFKYNVLHISKGIEYPGDIR----------WPLAACLFLAWLIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGSGILYFITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYLRKH--KPQFTLVCCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIGFQPNKFWRVCWAFVTPTILTFILALSLYQWKVMTYEDYTYPNWSMVLGWLMVICSVIWIPIMFAIKMHLAPGSLIERLKLVCSPQPDWGP 748          
BLAST of slc6a-5 vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 498.819 bits (1283), Expect = 4.390e-167
Identity = 267/590 (45.25%), Postives = 373/590 (63.22%), Query Frame = 1
Query:  124 KTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC------LTD---FRNKTISNCSTLNTQNCIEYEV-------------------AAEQYWKKVVLGVE---DYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYF-IYYAIFKG-------VTKTPKDSWGP 1776
            +  ARGNWS + DF LS VGYAVGLGN+WRFP+L + +GGGAFL+PY IML +AGIPIF  E++LGQF+S GP+S+WK  P  +G G +MLI++ ++++YYN+I+ W+LYYLFAS    LPW+ C N WN   C      L D    R++ I+  S  NT  C+   V                    +E+Y+K  VL +    +Y G++R          W L  CL LAW+I  A L KG+KSSGKVVYFTA FPYVV++I+++ G  L G+  GI Y++ PKW+KL   +VW+DAATQIF+SL  A+GGL+T+SSYNKF+NNCYRD L+V+  N  TS  AGF IFSV+G+MAH+    IE     G G+AFV Y ++L+ + ++P W+I+FFLMLLTLG+D+ F  +E I T + DEFP   + H     F +   +  F LG   +++ G+YM  ++D ++ +++L IIAIFEL+ I Y+YG++ F +DI+MM+GF+P  +W  CW  VTP  + FIL LS        + +Y  P W+ VLG+LM +  VI I + F I   +  G       +  +P+  WGP
Sbjct:  173 ENKARGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLGLAGIPIFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPWATCKNEWNTVECKDKDMLLLDTCILRDRNIT--SIKNTTFCLSANVVGNLSKLLNVTVDNKTYVSPSEEYFKYNVLHISKGIEYPGDIR----------WPLAACLFLAWLIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGSGILYFITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYLRKH--KPQFTLVCCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIGFQPNKFWRVCWAFVTPTILTFILALSLYQWKVMTYEDYTYPNWSMVLGWLMVICSVIWIPIMFAIKMHLAPGSLIERLKLVCSPQPDWGP 748          
BLAST of slc6a-5 vs. Ensembl Zebrafish
Match: slc6a2 (solute carrier family 6 member 2 [Source:ZFIN;Acc:ZDB-GENE-110408-4])

HSP 1 Score: 482.641 bits (1241), Expect = 5.952e-163
Identity = 252/554 (45.49%), Postives = 358/554 (64.62%), Query Frame = 1
Query:   82 TNEQVISEVDSQTPKTTA-----RGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYE-VAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIY 1725
            TN  V++   S+   + +     R  W  + DF LS +G+AV L N+WRFP+LCY +GGGAFL+PY + L IAG+P+FY ELALGQ++  G  ++WK+ P+FKG+GY+++++A  V  YYNVIIAWSLYYL+AS TS+LPW  CNN WN   C      K I+     N  +  +Y+   A +++++ VL   +  G        LG  +W L +CL++   I    L KGVKSSGKVVY TA  PY+V++++++ G  L G+  GI+ YL    KKL + QVW DAATQIF+SLG  FG L+  SSYNKFNNNCYRDA+L S INC+TSF +GFAIFSVLGYMA Q    I+   T G+GL FV Y +++ST+  A  ++I+FF+MLLTLGIDS  GGMEA+ TGL D+F ILK+   +   F  +  +  F + + CV+ GGIY+ +++D+Y+   ++    +FE I + + YGV  F +DI+ M+GFKPG YW  CW  V+P  ++ ++I S +      +  Y+ P WA++LG+ + L  ++ +  Y IY
Sbjct:   41 TNSSVVASPSSRACTSASGEEIERETWGKKMDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLIPYVLFLFIAGMPLFYMELALGQYNREGAATLWKICPVFKGVGYTVIVIALYVGFYYNVIIAWSLYYLYASLTSELPWLHCNNPWNSPNCT---EPKDINGTVLGNGTSYAKYKNTPAAEFYERGVLHSHESKGIGD-----LGLPRWELTICLVVVAFILYFSLWKGVKSSGKVVYITATMPYIVLLVLLIRGITLPGAMNGIRAYLHIDLKKLNNPQVWIDAATQIFFSLGAGFGVLIAFSSYNKFNNNCYRDAILTSTINCVTSFFSGFAIFSVLGYMAEQHKVNIKDVATEGAGLVFVIYPEAISTLPGATFFAIVFFIMLLTLGIDSSMGGMEAVLTGLSDDFKILKRNRKL---FTFATVVGTFLMALLCVTNGGIYVLTLLDKYAAGTSILFGVLFEAIGVSWFYGVDRFSEDIERMMGFKPGIYWRLCWKFVSPAFLLLVVIASIVTSGRLTYDEYVFPYWADMLGWSIALSSMLFVPFYAIY 583          
BLAST of slc6a-5 vs. Ensembl Zebrafish
Match: slc6a2 (solute carrier family 6 member 2 [Source:ZFIN;Acc:ZDB-GENE-110408-4])

HSP 1 Score: 482.641 bits (1241), Expect = 5.952e-163
Identity = 252/554 (45.49%), Postives = 358/554 (64.62%), Query Frame = 1
Query:   82 TNEQVISEVDSQTPKTTA-----RGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYE-VAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIY 1725
            TN  V++   S+   + +     R  W  + DF LS +G+AV L N+WRFP+LCY +GGGAFL+PY + L IAG+P+FY ELALGQ++  G  ++WK+ P+FKG+GY+++++A  V  YYNVIIAWSLYYL+AS TS+LPW  CNN WN   C      K I+     N  +  +Y+   A +++++ VL   +  G        LG  +W L +CL++   I    L KGVKSSGKVVY TA  PY+V++++++ G  L G+  GI+ YL    KKL + QVW DAATQIF+SLG  FG L+  SSYNKFNNNCYRDA+L S INC+TSF +GFAIFSVLGYMA Q    I+   T G+GL FV Y +++ST+  A  ++I+FF+MLLTLGIDS  GGMEA+ TGL D+F ILK+   +   F  +  +  F + + CV+ GGIY+ +++D+Y+   ++    +FE I + + YGV  F +DI+ M+GFKPG YW  CW  V+P  ++ ++I S +      +  Y+ P WA++LG+ + L  ++ +  Y IY
Sbjct:   41 TNSSVVASPSSRACTSASGEEIERETWGKKMDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLIPYVLFLFIAGMPLFYMELALGQYNREGAATLWKICPVFKGVGYTVIVIALYVGFYYNVIIAWSLYYLYASLTSELPWLHCNNPWNSPNCT---EPKDINGTVLGNGTSYAKYKNTPAAEFYERGVLHSHESKGIGD-----LGLPRWELTICLVVVAFILYFSLWKGVKSSGKVVYITATMPYIVLLVLLIRGITLPGAMNGIRAYLHIDLKKLNNPQVWIDAATQIFFSLGAGFGVLIAFSSYNKFNNNCYRDAILTSTINCVTSFFSGFAIFSVLGYMAEQHKVNIKDVATEGAGLVFVIYPEAISTLPGATFFAIVFFIMLLTLGIDSSMGGMEAVLTGLSDDFKILKRNRKL---FTFATVVGTFLMALLCVTNGGIYVLTLLDKYAAGTSILFGVLFEAIGVSWFYGVDRFSEDIERMMGFKPGIYWRLCWKFVSPAFLLLVVIASIVTSGRLTYDEYVFPYWADMLGWSIALSSMLFVPFYAIY 583          
BLAST of slc6a-5 vs. Ensembl Xenopus
Match: mxd4 (MAX dimerization protein 4 [Source:Xenbase;Acc:XB-GENE-6257573])

HSP 1 Score: 497.664 bits (1280), Expect = 1.616e-168
Identity = 265/620 (42.74%), Postives = 382/620 (61.61%), Query Frame = 1
Query:   64 VEDSSKTNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC---LTDFRNKTISNCS-------TLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPME-PFLG--PVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFP---ILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYA----------IFKGVTKTPKDSWGPGNKADWEIDDRYA-VKSSPCDND 1842
            ++ ++++    +    ++  +   RGNW  + +F L+ VGYAVGLGN+WRFP+LCY +GGGAF+ PYFIML+  GIP+F+ EL+ GQF+S G + +W+V P+FKG+GY M++V+T + +YYNV+I  + YY FAS    LPW+ CNN WN E C   L+   + T +  S       T+     ++    +E+YW++ VL +    G+   +  P LG   V W          ++   CLI+GVKSSGKVVYFTA FPYVV+ I+ + G  L G+  GI YYL P+W K+L  +VW DAA+QIFYSLG A+GGL+TM+SYNKF+NNCYRD++++S+ NC TS  AGF IFS+LG+MA   G  + +    G GLAFVAY ++L+ + ++PLWSILFF ML+ LG+ +QF  +E + T + DE     I++    + +     V II F LGI   ++ GIY   +MD Y+ +F+L II+    I +MY+YG +N+ KDI+MMLGF P  ++  CW   +P  I FILI + + + P K+ +Y+ P WA  +G+LM L  VI I +Y ++              K   K  KD WGP          RYA + SS CD++
Sbjct:    1 IKSANRSTNGAVPGEATKKDENPKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRILPWTYCNNLWNTENCAGVLSPNSSATFNISSQHSLLNLTMGLNQTLKRTSPSEEYWRRHVLNISGDIGDFGEVRLPLLGCLGVSW----------LVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGILYYLTPQWDKILHAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAIVDEIGSDWIIRWKTLVTLG----VAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGHRNYFKDIEMMLGFPPPLFFQFCWRFFSPAIIFFILIFTVIQYRPIKYNDYVYPDWALTIGFLMALSSVICIPLYAVFRVWRSEGHTFLQRLKNAVKPSKD-WGPALLE--HRTGRYAQISSSRCDSN 603          
BLAST of slc6a-5 vs. Ensembl Xenopus
Match: lrrc4c (leucine rich repeat containing 4C [Source:Xenbase;Acc:XB-GENE-5772259])

HSP 1 Score: 494.967 bits (1273), Expect = 3.083e-167
Identity = 267/578 (46.19%), Postives = 389/578 (67.30%), Query Frame = 1
Query:   85 NEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAIFKGV---------TKTPKDSWGPGNKAD 1791
            +++  +E+D + P+   RGNWSG+ DF LSC+GY VGLGN+WRFP+  Y +GGGAFL+PYFIML I GIP+F+ EL+LGQFSS GP+++WK+ P+FKG+G  ML++  +V++YYN+IIA+ L+YLFAS TS LPW  C N WN + CL     +  ++   +N  N +     +E+YW + VL ++  +G   P     G ++W LCLCLLL+W I   C++KGVKSSGKVVYFTA FPY++++++++ G  L G+ IGI++YL P+++ LL+ +VW +AA QIFYSLGV FGGL+T +SYN F+ N YRD  +V++ N  TS LAGFAIFSVLGYM+ + G  ++Q   +G GLAFV Y Q+++ + ++P WS LFF MLLTLG+DSQF  ME I T + DEFP   +       F   + + LF LG+   + GG+Y   ++D+YS  F L +I I   +++  +YG+KNF +DI+MMLGFKPG Y+ ACW+ ++P+T++ +L  S + + P+++G+Y  P+W+  LG LM L+  + I +  +  AI K              P   WGP  + +
Sbjct:   21 SDRDDTELDIEYPED--RGNWSGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLIPYFIMLAICGIPLFFMELSLGQFSSLGPLAVWKISPLFKGVGMGMLLIVALVAIYYNMIIAYVLFYLFASLTSSLPWEHCGNWWNTDLCLDHHVIRASNSALLVNISNTVS---PSEEYWSRYVLHIQGSSGIGDP-----GQLRWKLCLCLLLSWTIVYLCILKGVKSSGKVVYFTATFPYIILVMLLIRGVTLEGAWIGIKFYLTPQFEHLLTSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAFTSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFMETIVTAITDEFPYYLRPK--KAVFSAIICVALFLLGLILATDGGMYWLVLLDDYSAGFGLLVIVITFGLSVSRVYGIKNFCRDIQMMLGFKPGLYFKACWIFLSPVTLMCLLAYSILKYQPSQYGSYKFPLWSEALGILMGLLSCMMIPIGML-VAILKEEGSLWERIRQASRPAMDWGPSMEEN 585          
BLAST of slc6a-5 vs. Ensembl Xenopus
Match: lrrc4c (leucine rich repeat containing 4C [Source:Xenbase;Acc:XB-GENE-5772259])

HSP 1 Score: 494.197 bits (1271), Expect = 3.282e-167
Identity = 267/578 (46.19%), Postives = 389/578 (67.30%), Query Frame = 1
Query:   85 NEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAIFKGV---------TKTPKDSWGPGNKAD 1791
            +++  +E+D + P+   RGNWSG+ DF LSC+GY VGLGN+WRFP+  Y +GGGAFL+PYFIML I GIP+F+ EL+LGQFSS GP+++WK+ P+FKG+G  ML++  +V++YYN+IIA+ L+YLFAS TS LPW  C N WN + CL     +  ++   +N  N +     +E+YW + VL ++  +G   P     G ++W LCLCLLL+W I   C++KGVKSSGKVVYFTA FPY++++++++ G  L G+ IGI++YL P+++ LL+ +VW +AA QIFYSLGV FGGL+T +SYN F+ N YRD  +V++ N  TS LAGFAIFSVLGYM+ + G  ++Q   +G GLAFV Y Q+++ + ++P WS LFF MLLTLG+DSQF  ME I T + DEFP   +       F   + + LF LG+   + GG+Y   ++D+YS  F L +I I   +++  +YG+KNF +DI+MMLGFKPG Y+ ACW+ ++P+T++ +L  S + + P+++G+Y  P+W+  LG LM L+  + I +  +  AI K              P   WGP  + +
Sbjct:   18 SDRDDTELDIEYPED--RGNWSGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLIPYFIMLAICGIPLFFMELSLGQFSSLGPLAVWKISPLFKGVGMGMLLIVALVAIYYNMIIAYVLFYLFASLTSSLPWEHCGNWWNTDLCLDHHVIRASNSALLVNISNTVS---PSEEYWSRYVLHIQGSSGIGDP-----GQLRWKLCLCLLLSWTIVYLCILKGVKSSGKVVYFTATFPYIILVMLLIRGVTLEGAWIGIKFYLTPQFEHLLTSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAFTSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFMETIVTAITDEFPYYLRPK--KAVFSAIICVALFLLGLILATDGGMYWLVLLDDYSAGFGLLVIVITFGLSVSRVYGIKNFCRDIQMMLGFKPGLYFKACWIFLSPVTLMCLLAYSILKYQPSQYGSYKFPLWSEALGILMGLLSCMMIPIGML-VAILKEEGSLWERIRQASRPAMDWGPSMEEN 582          
BLAST of slc6a-5 vs. Ensembl Xenopus
Match: lrrc4c (leucine rich repeat containing 4C [Source:Xenbase;Acc:XB-GENE-5772259])

HSP 1 Score: 494.197 bits (1271), Expect = 3.897e-167
Identity = 267/578 (46.19%), Postives = 389/578 (67.30%), Query Frame = 1
Query:   85 NEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAIFKGV---------TKTPKDSWGPGNKAD 1791
            +++  +E+D + P+   RGNWSG+ DF LSC+GY VGLGN+WRFP+  Y +GGGAFL+PYFIML I GIP+F+ EL+LGQFSS GP+++WK+ P+FKG+G  ML++  +V++YYN+IIA+ L+YLFAS TS LPW  C N WN + CL     +  ++   +N  N +     +E+YW + VL ++  +G   P     G ++W LCLCLLL+W I   C++KGVKSSGKVVYFTA FPY++++++++ G  L G+ IGI++YL P+++ LL+ +VW +AA QIFYSLGV FGGL+T +SYN F+ N YRD  +V++ N  TS LAGFAIFSVLGYM+ + G  ++Q   +G GLAFV Y Q+++ + ++P WS LFF MLLTLG+DSQF  ME I T + DEFP   +       F   + + LF LG+   + GG+Y   ++D+YS  F L +I I   +++  +YG+KNF +DI+MMLGFKPG Y+ ACW+ ++P+T++ +L  S + + P+++G+Y  P+W+  LG LM L+  + I +  +  AI K              P   WGP  + +
Sbjct:   21 SDRDDTELDIEYPED--RGNWSGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLIPYFIMLAICGIPLFFMELSLGQFSSLGPLAVWKISPLFKGVGMGMLLIVALVAIYYNMIIAYVLFYLFASLTSSLPWEHCGNWWNTDLCLDHHVIRASNSALLVNISNTVS---PSEEYWSRYVLHIQGSSGIGDP-----GQLRWKLCLCLLLSWTIVYLCILKGVKSSGKVVYFTATFPYIILVMLLIRGVTLEGAWIGIKFYLTPQFEHLLTSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAFTSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFMETIVTAITDEFPYYLRPK--KAVFSAIICVALFLLGLILATDGGMYWLVLLDDYSAGFGLLVIVITFGLSVSRVYGIKNFCRDIQMMLGFKPGLYFKACWIFLSPVTLMCLLAYSILKYQPSQYGSYKFPLWSEALGILMGLLSCMMIPIGML-VAILKEEGSLWERIRQASRPAMDWGPSMEEN 585          
BLAST of slc6a-5 vs. Ensembl Xenopus
Match: mxd4 (MAX dimerization protein 4 [Source:Xenbase;Acc:XB-GENE-6257573])

HSP 1 Score: 494.197 bits (1271), Expect = 4.284e-167
Identity = 268/621 (43.16%), Postives = 381/621 (61.35%), Query Frame = 1
Query:   73 SSKTNEQVISEV----DSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC---LTDFRNKTISNCS-------TLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPME-PFLG--PVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFP---ILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYA----------IFKGVTKTPKDSWGPGNKADWEIDDRYA-VKSSPCDND 1842
            S K  E +++       ++  +   RGNW  + +F L+ VGYAVGLGN+WRFP+LCY +GGGAF+ PYFIML+  GIP+F+ EL+ GQF+S G + +W+V P+FKG+GY M++V+T + +YYNV+I  + YY FAS    LPW+ CNN WN E C   L+   + T +  S       T+     ++    +E+YW++ VL +    G+   +  P LG   V W          ++   CLI+GVKSSGKVVYFTA FPYVV+ I+ + G  L G+  GI YYL P+W K+L  +VW DAA+QIFYSLG A+GGL+TM+SYNKF+NNCYRD++++S+ NC TS  AGF IFS+LG+MA   G  + +    G GLAFVAY ++L+ + ++PLWSILFF ML+ LG+ +QF  +E + T + DE     I++    + +     V II F LGI   ++ GIY   +MD Y+ +F+L II+    I +MY+YG +N+ KDI+MMLGF P  ++  CW   +P  I FILI + + + P K+ +Y+ P WA  +G+LM L  VI I +Y ++              K   K  KD WGP          RYA + SS CD++
Sbjct:    2 SEKCGEGILNGAVPGEATKKDENPKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRILPWTYCNNLWNTENCAGVLSPNSSATFNISSQHSLLNLTMGLNQTLKRTSPSEEYWRRHVLNISGDIGDFGEVRLPLLGCLGVSW----------LVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGILYYLTPQWDKILHAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAIVDEIGSDWIIRWKTLVTLG----VAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGHRNYFKDIEMMLGFPPPLFFQFCWRFFSPAIIFFILIFTVIQYRPIKYNDYVYPDWALTIGFLMALSSVICIPLYAVFRVWRSEGHTFLQRLKNAVKPSKD-WGPALLE--HRTGRYAQISSSRCDSN 605          
BLAST of slc6a-5 vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 519.62 bits (1337), Expect = 4.248e-175
Identity = 274/591 (46.36%), Postives = 379/591 (64.13%), Query Frame = 1
Query:  109 DSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC---------------------------LTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFI---YYAIFKGVTK-----TPKDSWGP 1776
            D Q  +  ARGNWS + DF LS VGYAVGLGN+WRFP+L + +GGGAFL+PY +ML +AG+PIF+ E++LGQF+S GP+S+WK  P  +G G +MLI++ ++++YYNVII ++L+YLFASF S LPW  CNN WN   C                           +T + N T+ N     +Q    +   +E+Y+K  VL +   AG   P     G ++W L  CL LAW+I  A L KG+KSSGKVVYFTA FPYVV++I+++ G  L G+  GI Y++ PKW+KL    VW+DAATQIF+SL  A+GGL+T+SSYNKF+NNCYRD L+V+  N  TS  AGF IFSV+G+MA++    IE     G G+AFV Y ++L+ + ++P W+I+FFLMLLTLG+D+ F  +E I T + DEFP   +TH     F +   I  F +G   +++GGIYMF ++D Y+ ++ L IIAIFEL+ I Y+YG++ F +DI+MM+GFKP  +W  CW  VTP  + FIL  SF    P  +G+Y  P W+ VLG+LM    VI I + F+   Y A  + + +     +P+  WGP
Sbjct:  176 DEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVN---FTSQTNKTFVSGSEEYFKYFVLKIS--AGIEYP-----GEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTH--KPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIERLKLVCSPQPDWGP 754          
BLAST of slc6a-5 vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 519.62 bits (1337), Expect = 4.248e-175
Identity = 274/591 (46.36%), Postives = 379/591 (64.13%), Query Frame = 1
Query:  109 DSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC---------------------------LTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFI---YYAIFKGVTK-----TPKDSWGP 1776
            D Q  +  ARGNWS + DF LS VGYAVGLGN+WRFP+L + +GGGAFL+PY +ML +AG+PIF+ E++LGQF+S GP+S+WK  P  +G G +MLI++ ++++YYNVII ++L+YLFASF S LPW  CNN WN   C                           +T + N T+ N     +Q    +   +E+Y+K  VL +   AG   P     G ++W L  CL LAW+I  A L KG+KSSGKVVYFTA FPYVV++I+++ G  L G+  GI Y++ PKW+KL    VW+DAATQIF+SL  A+GGL+T+SSYNKF+NNCYRD L+V+  N  TS  AGF IFSV+G+MA++    IE     G G+AFV Y ++L+ + ++P W+I+FFLMLLTLG+D+ F  +E I T + DEFP   +TH     F +   I  F +G   +++GGIYMF ++D Y+ ++ L IIAIFEL+ I Y+YG++ F +DI+MM+GFKP  +W  CW  VTP  + FIL  SF    P  +G+Y  P W+ VLG+LM    VI I + F+   Y A  + + +     +P+  WGP
Sbjct:  176 DEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVN---FTSQTNKTFVSGSEEYFKYFVLKIS--AGIEYP-----GEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTH--KPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIERLKLVCSPQPDWGP 754          
BLAST of slc6a-5 vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 519.62 bits (1337), Expect = 4.248e-175
Identity = 274/591 (46.36%), Postives = 379/591 (64.13%), Query Frame = 1
Query:  109 DSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC---------------------------LTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFI---YYAIFKGVTK-----TPKDSWGP 1776
            D Q  +  ARGNWS + DF LS VGYAVGLGN+WRFP+L + +GGGAFL+PY +ML +AG+PIF+ E++LGQF+S GP+S+WK  P  +G G +MLI++ ++++YYNVII ++L+YLFASF S LPW  CNN WN   C                           +T + N T+ N     +Q    +   +E+Y+K  VL +   AG   P     G ++W L  CL LAW+I  A L KG+KSSGKVVYFTA FPYVV++I+++ G  L G+  GI Y++ PKW+KL    VW+DAATQIF+SL  A+GGL+T+SSYNKF+NNCYRD L+V+  N  TS  AGF IFSV+G+MA++    IE     G G+AFV Y ++L+ + ++P W+I+FFLMLLTLG+D+ F  +E I T + DEFP   +TH     F +   I  F +G   +++GGIYMF ++D Y+ ++ L IIAIFEL+ I Y+YG++ F +DI+MM+GFKP  +W  CW  VTP  + FIL  SF    P  +G+Y  P W+ VLG+LM    VI I + F+   Y A  + + +     +P+  WGP
Sbjct:  176 DEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVN---FTSQTNKTFVSGSEEYFKYFVLKIS--AGIEYP-----GEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTH--KPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIERLKLVCSPQPDWGP 754          
BLAST of slc6a-5 vs. Ensembl Mouse
Match: Slc6a7 (solute carrier family 6 (neurotransmitter transporter, L-proline), member 7 [Source:MGI Symbol;Acc:MGI:2147363])

HSP 1 Score: 488.804 bits (1257), Expect = 4.804e-165
Identity = 258/535 (48.22%), Postives = 370/535 (69.16%), Query Frame = 1
Query:  103 EVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINI 1707
            +VD        RGNW+G+ DF LSC+GY VGLGN+WRFP+  Y +GGGAFLVPYF+ML I GIP+F+ EL+LGQFSS GP+++WK+ P+FKG G +ML++  +V++YYN+IIA+ L+YLFAS TS LPW  C N WN E CL     K+ +    LN  + +     +E+YW + VL ++   G  RP     G ++W+LCLCLLLAW+I   C++KGVKSSGKVVYFTA FPY+++++++V G  L G+  GIQ+YL P++  LLS +VW +AA QIFYSLGV FGGL+T +SYN F+ N YRD  +V++ N +TS LAGFAIFSVLGYM+ + G  ++Q   +G GLAFV Y Q+++ + ++P WS LFF MLLTLG+DSQF  +E I T + DEFP   +       F   + + ++ +G+   + GG+Y   ++D+YS +F L ++ I   + +  +YG++ F +DI MMLGFKPG Y+ ACW+ ++P T++ +L+ S + + P+++G+Y  P WA +LG LM L+  + I
Sbjct:   26 DVDLDVDFAADRGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSNLPWEHCGNWWNTELCLEHRGPKSGNGVLPLNLSSTVS---PSEEYWSRYVLHIQGSQGIGRP-----GEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLRPK--KAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRACWLFLSPATLLALLVYSIVKYQPSEYGSYRFPAWAELLGILMGLLSCLMI 550          
BLAST of slc6a-5 vs. Ensembl Mouse
Match: Slc6a9 (solute carrier family 6 (neurotransmitter transporter, glycine), member 9 [Source:MGI Symbol;Acc:MGI:95760])

HSP 1 Score: 482.256 bits (1240), Expect = 1.517e-162
Identity = 268/614 (43.65%), Postives = 378/614 (61.56%), Query Frame = 1
Query:   85 NEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCS-----TLNTQNCIEYEV----AAEQYWKKVVLGVEDYAGNLRPME-PFLG--PVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFP---ILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAI----------FKGVTKTPKDSWGPGNKADWEIDDRYAVKSSPCDNDKMD 1851
            N  V SE   +    T RGNW  + +F L+ VGYAVGLGN+WRFP+LCY +GGGAF+ PYFIML+  GIP+F+ EL+ GQF+S G + +W++ PMFKG+GY M++V+T + +YYNV+I  + YY F+S T  LPW+ CNN WN   C        ++N S     + N  +   Y +     +E+YW+  VL + D  GN   +  P LG   V W          ++   CLI+GVKSSGKVVYFTA FPYVV+ I+ V G  L G+  GI YYL P+W K+L  +VW DAA+QIFYSLG A+GGL+TM+SYNKF+NNCYRD++++S+ NC TS  AGF IFS+LG+MA+  G  + +    G GLAFVAY ++L+ + ++PLWS+LFF ML+ LG+ +QF  +E + T + DE     IL+K  ++ +     V +  F LGI   S+ GIY   +MD Y+ +F+L +I+    ++IMY+YG +N+ +DI+MMLGF P  ++  CW  V+P  I FILI + + + P  + +Y  P WA  +G+LM L  VI I +Y ++              K  TK  +D WGP          RYA  ++P   D  +
Sbjct:   11 NGAVPSEATKKDQNLT-RGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTPDCAGVLDASNLTNGSRPAALSGNLSHLFNYTLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSW----------VVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFTGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYVTLG----VAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVSIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILIFTVIQYRPITYNHYQYPGWAVAIGFLMALSSVICIPLYALFQLCRTDGDTLLQRLKNATKPSRD-WGPALLE--HRTGRYAPTTTPSPEDGFE 606          
BLAST of slc6a-5 vs. UniProt/SwissProt
Match: sp|Q761V0|SC6A5_MOUSE (Sodium- and chloride-dependent glycine transporter 2 OS=Mus musculus OX=10090 GN=Slc6a5 PE=1 SV=1)

HSP 1 Score: 519.62 bits (1337), Expect = 4.441e-174
Identity = 274/591 (46.36%), Postives = 379/591 (64.13%), Query Frame = 1
Query:  109 DSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC---------------------------LTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFI---YYAIFKGVTK-----TPKDSWGP 1776
            D Q  +  ARGNWS + DF LS VGYAVGLGN+WRFP+L + +GGGAFL+PY +ML +AG+PIF+ E++LGQF+S GP+S+WK  P  +G G +MLI++ ++++YYNVII ++L+YLFASF S LPW  CNN WN   C                           +T + N T+ N     +Q    +   +E+Y+K  VL +   AG   P     G ++W L  CL LAW+I  A L KG+KSSGKVVYFTA FPYVV++I+++ G  L G+  GI Y++ PKW+KL    VW+DAATQIF+SL  A+GGL+T+SSYNKF+NNCYRD L+V+  N  TS  AGF IFSV+G+MA++    IE     G G+AFV Y ++L+ + ++P W+I+FFLMLLTLG+D+ F  +E I T + DEFP   +TH     F +   I  F +G   +++GGIYMF ++D Y+ ++ L IIAIFEL+ I Y+YG++ F +DI+MM+GFKP  +W  CW  VTP  + FIL  SF    P  +G+Y  P W+ VLG+LM    VI I + F+   Y A  + + +     +P+  WGP
Sbjct:  184 DEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVN---FTSQTNKTFVSGSEEYFKYFVLKIS--AGIEYP-----GEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTH--KPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIERLKLVCSPQPDWGP 762          
BLAST of slc6a-5 vs. UniProt/SwissProt
Match: sp|Q9Y345|SC6A5_HUMAN (Sodium- and chloride-dependent glycine transporter 2 OS=Homo sapiens OX=9606 GN=SLC6A5 PE=1 SV=3)

HSP 1 Score: 519.235 bits (1336), Expect = 6.510e-174
Identity = 274/593 (46.21%), Postives = 383/593 (64.59%), Query Frame = 1
Query:   94 VISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC------------LTDFRNKTISN---CST---------LNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFI---YYAIFKGVTK-----TPKDSWGP 1776
            V ++ D Q  +  ARGNWS + DF LS VGYAVGLGN+WRFP+L + +GGGAFL+PY +ML +AG+PIF+ E++LGQF+S GP+S+WK  P  +G G +MLI++ ++++YYNVII ++L+YLFASF S LPW  CNN WN   C            ++D     I N   C T           +Q    +   +E+Y+K  VL +   AG   P     G ++W L LCL LAW+I  A L KG+K+SGKVVYFTA FPYVV++I+++ G  L G+  GI Y++ PKW+KL    VW+DAATQIF+SL  A+GGL+T+SSYNKF+NNCYRD L+V+  N  TS  AGF IFSV+G+MA++    IE     G G+AFV Y ++L+ + ++P W+I+FFLMLLTLG+D+ F  +E I T + DEFP   +TH     F +   I  F +G   +++GGIYMF ++D Y+ ++ L IIAIFEL+ I Y+YG++ F +DI+MM+GF+P  +W  CW  VTP  + FIL  SF    P  +G+Y  P W+ VLG+LM    VI I + F+   + A  + + +     +P+  WGP
Sbjct:  177 VATQEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKIS--AGIEYP-----GEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTH--KPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMHLAPGRFIERLKLVCSPQPDWGP 760          
BLAST of slc6a-5 vs. UniProt/SwissProt
Match: sp|P58295|SC6A5_RAT (Sodium- and chloride-dependent glycine transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc6a5 PE=1 SV=2)

HSP 1 Score: 516.538 bits (1329), Expect = 5.979e-173
Identity = 272/591 (46.02%), Postives = 379/591 (64.13%), Query Frame = 1
Query:  109 DSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC---------------------------LTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFI---YYAIFKGVTK-----TPKDSWGP 1776
            D Q  +  ARGNWS + DF LS VGYAVGLGN+WRFP+L + +GGGAFL+PY +ML +AG+PIF+ E++LGQF+S GP+S+WK  P  +G G +MLI++ ++++YYNVII ++L+YLFASF S LPW  CNN WN   C                           +T + N T+ N     +Q    +   +E+Y+K  VL +   AG   P     G ++W L  CL LAW+I  A L KG+K+SGKVVYFTA FPYVV++I+++ G  L G+  GI Y++ PKW+KL    VW+DAATQIF+SL  A+GGL+T+SSYNKF+NNCYRD L+V+  N  TS  AGF IFSV+G+MA++    IE     G G+AFV Y ++L+ + ++P W+I+FFLMLLTLG+D+ F  +E I T + DEFP   +TH     F +   I  F +G   +++GGIYMF ++D Y+ ++ L IIAIFEL+ I Y+YG++ F +DI+MM+GF+P  +W  CW  VTP  + FIL  SF    P  +G+Y  P W+ VLG+LM    VI I + F+   Y A  + + +     +P+  WGP
Sbjct:  184 DEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVN---FTSQANKTFVSGSEEYFKYFVLKIS--AGIEYP-----GEIRWPLAFCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTH--KPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIERLKLVCSPQPDWGP 762          
BLAST of slc6a-5 vs. UniProt/SwissProt
Match: sp|A7Y2X0|SC6A5_XENLA (Sodium- and chloride-dependent glycine transporter 2 OS=Xenopus laevis OX=8355 GN=slc6a5 PE=2 SV=1)

HSP 1 Score: 496.893 bits (1278), Expect = 2.484e-165
Identity = 265/595 (44.54%), Postives = 376/595 (63.19%), Query Frame = 1
Query:  109 DSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC---------------------------LTDFRNKTISNCSTLNTQNCIEYEVAAEQYWK----KVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAIFKGVT--------KTPKDSWGP 1776
            D +  +  ARGNWS + DF LS VGYAVGLGN+WRFP+L + +GGGAFL+PY  ML +AG+PIFY E+ALGQF+S GPIS+WK  P  +G G +MLI++ ++++YYN+I+ ++++YLFAS    LPW+ CNN WN   C                           +T + N T+ N ++   ++ +     +E+Y+K    K+  G+E Y G +R          W L  CL LAWII  A L KG+K+SGKVVY TA FPYVV++I++  G  L G+  GI ++++PKW+KL+   VW+DAATQIF+SL  A+GGL+T+SSYNKF+NN YRD L+V+ IN  TS  AGF IFSV+G+MAH     IE+    G G+AFV Y ++L+ + ++P W+I+FFLMLLTLG+D+ F  +E I T + DEFP L +TH     F +   +  F +G   +++GGIYM  ++D Y+ +++L IIAIFEL+ I Y+YG++ F +DI+MM+GF+P  +W  CW  VTP  + FIL  SF    P  +G+Y  P W+ V+G+LM    VI I + F+        T         +P+  WGP
Sbjct:  175 DEEGDENKARGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFKNGGGAFLIPYLTMLALAGLPIFYLEVALGQFASQGPISVWKAIPALQGCGIAMLIISVLIAIYYNIIMCYTIFYLFASLVYVLPWASCNNPWNTPDCKDKDRLLLDSCIISSQPNIQIKNSTFCMTAYPNLTMVNFTSHGNKSFVS---GSEEYFKYNMLKISAGIE-YPGEIR----------WPLVFCLFLAWIIVYASLAKGIKTSGKVVYSTATFPYVVLVILLFRGVTLPGAGDGIWWFIMPKWEKLMDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNLYRDTLIVTCINSATSIFAGFVIFSVIGFMAHILNVDIEKVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKLLRTH--KPLFTLVCCVAFFIMGFPMITQGGIYMLQLVDNYAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIGFQPSRFWKICWAFVTPTILTFILGFSFYQWEPMTYGSYHYPSWSMVMGWLMLACSVIWIPIMFVIKMFLAPGTFIERLKLVCSPQPDWGP 753          
BLAST of slc6a-5 vs. UniProt/SwissProt
Match: sp|P28573|SC6A7_RAT (Sodium-dependent proline transporter OS=Rattus norvegicus OX=10116 GN=Slc6a7 PE=1 SV=2)

HSP 1 Score: 491.115 bits (1263), Expect = 3.948e-165
Identity = 259/535 (48.41%), Postives = 370/535 (69.16%), Query Frame = 1
Query:  103 EVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINI 1707
            +VD        RGNW+G+ DF LSC+GY VGLGN+WRFP+  Y +GGGAFLVPYF+ML I GIP+F+ EL+LGQFSS GP+++WK+ P+FKG G +ML++  +V++YYN+IIA+ L+YLFAS TS LPW  C N WN ERCL     K  +    LN  + +     +E+YW + VL ++   G  RP     G ++W+LCLCLLLAW+I   C++KGVKSSGKVVYFTA FPY+++++++V G  L G+  GIQ+YL P++  LLS +VW +AA QIFYSLGV FGGL+T +SYN F+ N YRD  +V++ N +TS LAGFAIFSVLGYM+ + G  ++Q   +G GLAFV Y Q+++ + ++P WS LFF MLLTLG+DSQF  +E I T + DEFP   +       F   + + ++ +G+   + GG+Y   ++D+YS +F L ++ I   + +  +YG++ F +DI MMLGFKPG Y+ ACW+ ++P T++ +L+ S + + P+++G+Y  P WA +LG LM L+  + I
Sbjct:   26 DVDLDVDFAADRGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSNLPWEHCGNWWNTERCLEHRGPKDGNGALPLNLSSTVS---PSEEYWSRYVLHIQGSQGIGRP-----GEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVIYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLRPK--KAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRACWLFLSPATLLALLVYSIVKYQPSEYGSYRFPAWAELLGILMGLLSCLMI 550          
BLAST of slc6a-5 vs. TrEMBL
Match: A0A0H3YEX4 (Slc6a-5 OS=Schmidtea mediterranea OX=79327 GN=slc6a-5 PE=2 SV=1)

HSP 1 Score: 1191.02 bits (3080), Expect = 0.000e+0
Identity = 603/603 (100.00%), Postives = 603/603 (100.00%), Query Frame = 1
Query:   55 MASVEDSSKTNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAIFKGVTKTPKDSWGPGNKADWEIDDRYAVKSSPCDNDKMDSTSF 1863
            MASVEDSSKTNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHLCLCLLLAWIICGACLIKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAIFKGVTKTPKDSWGPGNKADWEIDDRYAVKSSPCDNDKMDSTSF
Sbjct:    1 MASVEDSSKTNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHLCLCLLLAWIICGACLIKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAIFKGVTKTPKDSWGPGNKADWEIDDRYAVKSSPCDNDKMDSTSF 603          
BLAST of slc6a-5 vs. TrEMBL
Match: A0A1I8J6K1 (Transporter OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024770g3 PE=3 SV=1)

HSP 1 Score: 594.349 bits (1531), Expect = 0.000e+0
Identity = 300/589 (50.93%), Postives = 403/589 (68.42%), Query Frame = 1
Query:  124 KTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISN-----------------CSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAIFKGVTKTPKDS------WGPGNKADWEIDDRYAVK 1821
            +   RGNW+GRFDF LS +G+AVGLGN+WRFP+LCY +GGGAFL+PY IML +AG+P+FYFEL+ GQF++ GP++IW+  P+ KG G++M+ ++ +V +YYN+IIAWSLYYLFASF S +PW +C+N WND RC    +N T +                  C+   T NC +Y+  +EQY+ +VVLG   Y G  R M  F+G  QWH+ LCLLLAWI+   CL+KG+KSSGKVVYFTA FPYVV+II++V G  L G+  GI +YL P + +L   +VW DAA QIFYSLGVAFGGLMTM+SYN+F+NNCYRDAL+V+VINC TS  AGF IFSV+G+MA +TG A+    T G GLAF+AY + L+ M VAPLWSILFF+M+LTLG+DSQF  ME + T L DE+P LKKT   +  FK+ V +ILF LGI     GG+Y+F++++ YS  + L +++  EL+ + Y+YG+K F++DIKMMLGF PG YW+ CWM VTP+ + FILI     +  + + +     W   L +LM +   + I  + IY +  +G  K  +++      WGP  +  W    RY  K
Sbjct:   34 ENKERGNWTGRFDFILSAIGFAVGLGNVWRFPYLCYSNGGGAFLIPYVIMLAVAGLPLFYFELSFGQFANLGPVTIWRASPILKGTGWAMVSISALVCIYYNIIIAWSLYYLFASFNSAVPWRNCDNEWNDLRCRDLTQNTTNATHNVAGNLKAGFNPNPMPCNATITVNCTKYQTPSEQYFDRVVLGYTSYTGVDRKMTEFIGVPQWHVTLCLLLAWILVYVCLVKGIKSSGKVVYFTATFPYVVLIILLVRGATLEGALDGIIFYLKPDFYRLADSKVWSDAAVQIFYSLGVAFGGLMTMASYNRFHNNCYRDALVVAVINCGTSVFAGFVIFSVVGFMAKKTGLAVADVATQGPGLAFIAYPEGLAAMPVAPLWSILFFIMILTLGLDSQFAMMETVLTALADEWPWLKKTFKREALFKMVVCVILFLLGIPICCPGGMYLFTLLNNYSAYYNLFLVSFAELLGVCYVYGIKKFVRDIKMMLGFYPGPYWIGCWMFVTPVMMGFILIFGLTQYGRSSYADEPFTDWGEALAWLMMISTAMFIPGFAIYESCIRGAKKAMQEAAAEAPEWGPAVEKYWPDSRRYQEK 622          
BLAST of slc6a-5 vs. TrEMBL
Match: A0A267F8N6 (Transporter OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024770g2 PE=3 SV=1)

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 300/597 (50.25%), Postives = 401/597 (67.17%), Query Frame = 1
Query:  124 KTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISN-----------------CSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAIFKG------VTKTPKDSWGPGNKADWEIDDRYAVKSSPCDNDK 1845
            +   RGNW+GRFDF LS +G+AVGLGN+WRFP+LCY +GGGAFL+PY IML +AG+P+FYFEL+ GQF++ GP++IW+  P+ KG G++M+ ++ +V +YYN+IIAWSLYYLFASF S +PW +C+N WND RC    +N T +                  C+   T NC +Y+  +EQY+ +VVLG   Y G  R M  F+G  QWH+ LCLLLAWI+   CL+KG+KSSGKVVYFTA FPYVV+II++V G  L G+  GI +YL P + +L   +VW DAA QIFYSLGVAFGGLMTM+SYN+F+NNCYRDAL+V+VINC TS  AGF IFSV+G+MA +TG A+    T G GLAF+AY + L+ M VAPLWSILFF+M+LTLG+DSQF  ME + T L DE+P LKKT   +  FK+ V +ILF LGI     GG+Y+F++++ YS  + L +++  EL+ + Y+YG+K F++DIKMMLGF PG YW+ CWM VTP+ + FILI     +  + + +     W   L +LM +   + I  + IY +  +G              WGP  +  W    RY  K      D+
Sbjct:   34 ENKERGNWTGRFDFILSAIGFAVGLGNVWRFPYLCYSNGGGAFLIPYVIMLAVAGLPLFYFELSFGQFANLGPVTIWRASPILKGTGWAMVSISALVCIYYNIIIAWSLYYLFASFNSAVPWRNCDNEWNDLRCRDLTQNTTNATHNVAGNLKAGFNPNPMPCNATITVNCTKYQTPSEQYFDRVVLGYTSYTGVDRKMTEFIGVPQWHVTLCLLLAWILVYVCLVKGIKSSGKVVYFTATFPYVVLIILLVRGATLEGALDGIIFYLKPDFYRLADSKVWSDAAVQIFYSLGVAFGGLMTMASYNRFHNNCYRDALVVAVINCGTSVFAGFVIFSVVGFMAKKTGLAVADVATQGPGLAFIAYPEGLAAMPVAPLWSILFFIMILTLGLDSQFAMMETVLTALADEWPWLKKTFKREALFKMVVCVILFLLGIPICCPGGMYLFTLLNNYSAYYNLFLVSFAELLGVCYVYGIKKFVRDIKMMLGFYPGPYWIGCWMFVTPVMMGFILIFGLTQYGRSSYADEPFTDWGEALAWLMMISTAMFIPGFAIYESCIRGAKEAMQAAAAEAPEWGPAVQKYWPDSRRYQEKLDRLIADR 630          
BLAST of slc6a-5 vs. TrEMBL
Match: A0A1I8GER9 (Transporter OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024770g1 PE=3 SV=1)

HSP 1 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 300/597 (50.25%), Postives = 401/597 (67.17%), Query Frame = 1
Query:  124 KTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISN-----------------CSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAIFKG------VTKTPKDSWGPGNKADWEIDDRYAVKSSPCDNDK 1845
            +   RGNW+GRFDF LS +G+AVGLGN+WRFP+LCY +GGGAFL+PY IML +AG+P+FYFEL+ GQF++ GP++IW+  P+ KG G++M+ ++ +V +YYN+IIAWSLYYLFASF S +PW +C+N WND RC    +N T +                  C+   T NC +Y+  +EQY+ +VVLG   Y G  R M  F+G  QWH+ LCLLLAWI+   CL+KG+KSSGKVVYFTA FPYVV+II++V G  L G+  GI +YL P + +L   +VW DAA QIFYSLGVAFGGLMTM+SYN+F+NNCYRDAL+V+VINC TS  AGF IFSV+G+MA +TG A+    T G GLAF+AY + L+ M VAPLWSILFF+M+LTLG+DSQF  ME + T L DE+P LKKT   +  FK+ V +ILF LGI     GG+Y+F++++ YS  + L +++  EL+ + Y+YG+K F++DIKMMLGF PG YW+ CWM VTP+ + FILI     +  + + +     W   L +LM +   + I  + IY +  +G              WGP  +  W    RY  K      D+
Sbjct:   34 ENKERGNWTGRFDFILSAIGFAVGLGNVWRFPYLCYSNGGGAFLIPYVIMLAVAGLPLFYFELSFGQFANLGPVTIWRASPILKGTGWAMVSISALVCIYYNIIIAWSLYYLFASFNSAVPWRNCDNEWNDLRCRDLTQNTTNATHNVAGNLKAGFNPNPMPCNATITVNCTKYQTPSEQYFDRVVLGYTSYTGVDRKMTEFIGVPQWHVTLCLLLAWILVYVCLVKGIKSSGKVVYFTATFPYVVLIILLVRGATLEGALDGIIFYLKPDFYRLADSKVWSDAAVQIFYSLGVAFGGLMTMASYNRFHNNCYRDALVVAVINCGTSVFAGFVIFSVVGFMAKKTGLAVADVATQGPGLAFIAYPEGLAAMPVAPLWSILFFIMILTLGLDSQFAMMETVLTALADEWPWLKKTFKREALFKMVVCVILFLLGIPICCPGGMYLFTLLNNYSAYYNLFLVSFAELLGVCYVYGIKKFVRDIKMMLGFYPGPYWIGCWMFVTPVMMGFILIFGLTQYGRSSYADEPFTDWGEALAWLMMISTAMFIPGFAIYESCIRGAKEAMQAAAAEAPEWGPAVQKYWPDSRRYQEKLDRLIADR 630          
BLAST of slc6a-5 vs. TrEMBL
Match: A0A267EM66 (Transporter OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012780g2 PE=3 SV=1)

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 299/617 (48.46%), Postives = 411/617 (66.61%), Query Frame = 1
Query:   70 DSSKTNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC-----------------LTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAIFK-GVTKTPKDS--WGPGNKADWEIDDRYAVKSSPCDNDKMDSTS 1860
            ++S + E   +       +  ARGNW+G+FDF LSC+GYAVGLGN+WRFP+LCY +GGGAFL+PY IML +A +P+FY E+A GQF + GP++IWK  P+ KG G++M+ ++ +VS+YYNVIIAW+L+YLFASF SK+PW+DCNN WND  C                 L    N     CS     NC +Y+  +EQY+++V+LG     G ++ M   +GP QWH+ LCLLLAWII  ACL+KGVK+SGKVVYFTA FPY+V++I+++ G  L G+K GI +YL P +  LL+ ++W  AA QIFYSLGVAFG L TMSSYNKF NNCY+DAL+V+ IN  TS  AGFAIFSV+G+MAH+TG  + + T SG GLAFVAY + L+ M VAPLWS+LFF+M+LTLG+DSQF  +E + T   DE+P L++       FK  V +++F LGI     GGIY FS++++Y   + L ++A+ E++ I YLYG+KNF+ DI+MMLGF+PG YW+ACW  +TP  I+FI I S + +    + +    +W   + +LM +  V+ I    IY    + G+T   K++  WGP  +A W   D+Y  K    +    D  +
Sbjct:   28 NASNSAEAPQAGEGEAADENEARGNWTGQFDFLLSCIGYAVGLGNVWRFPYLCYKNGGGAFLIPYLIMLGVAALPLFYMEVAFGQFGNLGPVTIWKACPLLKGTGWAMVSISALVSIYYNVIIAWALFYLFASFNSKVPWADCNNYWNDFHCRDLSVNTTNATHNVPGNLRAGFNPNPEACSQDLKTNCTQYQTPSEQYFERVMLGYTSLNGAIKKMSDPIGPPQWHVTLCLLLAWIIIYACLLKGVKTSGKVVYFTATFPYLVLVILLIRGATLEGAKEGIIFYLKPDFSLLLTSEIWSAAAVQIFYSLGVAFGCLTTMSSYNKFRNNCYKDALIVAGINSGTSIFAGFAIFSVIGFMAHKTGLPVAEVTKSGPGLAFVAYPEGLAAMPVAPLWSVLFFIMILTLGVDSQFAMVETVLTACMDEWPWLQENFTKQAIFKSVVCLVMFLLGIPMCCPGGIYYFSMLNDYCAYYNLFVVALVEMLGISYLYGIKNFLNDIQMMLGFRPGPYWIACWFGITPALILFIAIFSLVKYQSPSYNSEPFTIWGEAMCWLMMVGSVLFIPCCGIYEVWRRGGLTAALKETPDWGPPVEAFWLESDKYREKLKQMNTPAKDGVT 644          
BLAST of slc6a-5 vs. Ensembl Cavefish
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:103034591])

HSP 1 Score: 476.863 bits (1226), Expect = 2.259e-160
Identity = 273/619 (44.10%), Postives = 383/619 (61.87%), Query Frame = 1
Query:   49 SRMASVEDSSKT--NEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCL----TDFRNKTISNCSTL-----NTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPME-PFLG--PVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFP---ILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAIFKGVTKT-------------PKDSWGPGNKADWEIDDRYA 1815
            S MA   D +     EQV  + +S+      RGNW  + +F L+ VGYAVGLGN+WRFP+LCY +GGGAF+ PYFIML+  GIP+F+ EL+ GQF+S G + +WKV PMFKG+GY M++V+T + +YYNV+I  + YY F S T+ LPW+ CNN WN   C     +   N +I+N S +        N  +    +E+YW+  VL + D  GN   +  P LG   + W          ++   CLI+GVKSSGKVVYFTA FPYVV+ I+ + G  L G+  GI+YYL P+W+K+L  +VW DAA+QIFYSLG A+GGL+TM+SYNKF+NNC+RD++++SV NC TS  AGF IFS+LG+MAH  G  + Q    G GLAFVAY ++L+ + ++PLWS+LFF ML+ LG+ +QF  +E + T + DE     I++    I       V ++ F LG+   ++ GIY   +MD Y+ +F+L II+    I IMY+YG +N+ KD++MMLGF P  ++  CW  ++PL I FILI + + + P  + +Y+ P W+ V+G+ M L  VI I V    YA+FK  T               P  SWGP  +   +   RYA
Sbjct:    6 STMACRADQNGAVPGEQVKKDENSR------RGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSQRLNASIANISAVVSGVTEVVNRTKRTSPSEEYWRNYVLNISDGIGNFGEVRLPILGCLAISW----------VVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLEGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISVTNCATSVYAGFVIFSILGFMAHHLGVDVSQVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNKTIITFG----VAVVGFLLGVPLTTRAGIYWLLLMDNYAASFSLVIISCIMCICIMYVYGHRNYFKDVEMMLGFPPPIFFRICWRFISPLIISFILIFTVIQYKPITYNDYVYPRWSLVIGFCMALSSVICIPV----YALFKIATSEGSTFLERLKYSLKPHPSWGPALQEHRK--GRYA 598          
BLAST of slc6a-5 vs. Ensembl Cavefish
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:103034591])

HSP 1 Score: 475.707 bits (1223), Expect = 5.502e-160
Identity = 269/616 (43.67%), Postives = 383/616 (62.18%), Query Frame = 1
Query:   52 RMASVEDSSKTNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCL----TDFRNKTISNCSTL-----NTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPME-PFLG--PVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFP---ILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAIFKGVTKT-------------PKDSWGPGNKADWEIDDRYA 1815
            + + + + +   EQV  + +S+      RGNW  + +F L+ VGYAVGLGN+WRFP+LCY +GGGAF+ PYFIML+  GIP+F+ EL+ GQF+S G + +WKV PMFKG+GY M++V+T + +YYNV+I  + YY F S T+ LPW+ CNN WN   C     +   N +I+N S +        N  +    +E+YW+  VL + D  GN   +  P LG   + W          ++   CLI+GVKSSGKVVYFTA FPYVV+ I+ + G  L G+  GI+YYL P+W+K+L  +VW DAA+QIFYSLG A+GGL+TM+SYNKF+NNC+RD++++SV NC TS  AGF IFS+LG+MAH  G  + Q    G GLAFVAY ++L+ + ++PLWS+LFF ML+ LG+ +QF  +E + T + DE     I++    I       V ++ F LG+   ++ GIY   +MD Y+ +F+L II+    I IMY+YG +N+ KD++MMLGF P  ++  CW  ++PL I FILI + + + P  + +Y+ P W+ V+G+ M L  VI I V    YA+FK  T               P  SWGP  +   +   RYA
Sbjct:    5 QFSGILNGAVPGEQVKKDENSR------RGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSQRLNASIANISAVVSGVTEVVNRTKRTSPSEEYWRNYVLNISDGIGNFGEVRLPILGCLAISW----------VVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLEGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISVTNCATSVYAGFVIFSILGFMAHHLGVDVSQVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNKTIITFG----VAVVGFLLGVPLTTRAGIYWLLLMDNYAASFSLVIISCIMCICIMYVYGHRNYFKDVEMMLGFPPPIFFRICWRFISPLIISFILIFTVIQYKPITYNDYVYPRWSLVIGFCMALSSVICIPV----YALFKIATSEGSTFLERLKYSLKPHPSWGPALQEHRK--GRYA 594          
BLAST of slc6a-5 vs. Ensembl Cavefish
Match: slc6a14 (solute carrier family 6 member 14 [Source:NCBI gene;Acc:103047067])

HSP 1 Score: 470.7 bits (1210), Expect = 4.298e-158
Identity = 270/603 (44.78%), Postives = 382/603 (63.35%), Query Frame = 1
Query:   82 TNEQVISEVDSQTP------KTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC---LTDFRNKTISNCS--TLN-------TQNCIE-------YEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPK--WKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWV---ACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMT---LVGVINIVVYFIYYA---IFKGVTKT--PKDSWGP 1776
             +++  + V SQ P      +   RGNWS + ++ LS +GYAVGLGN+WRFP+L Y HGGGAFL+PY IML IAG+P+F+ E + GQF S GPI++WK  P+ +G+G +M++V+T V++YYNVI+A+S+YYLFASF   LPWS+C + W+D  C    T++ N T  N S   LN        Q+C E        +  +EQYW  V L           M+   GPV WHL LCLLL WI+ GA L KG+KSSGKVVYFTA FPY V++I+++ G  L G++ GI+YY+  +    KL   +VW+DAATQIF+SL +A+GGL  ++SYNKF+NNCY+D+++V V NC TS  AGFAIFS+LG+MAH  G+ + +   +G GLAF+AY  +LS + ++PLWSILFF ML+TLG+DSQF G+E I T LQD +P   K+    I   I V  +LF LG+ CV+  GIY  +++D +   + L +  + E+  +  +YG   F+KDI+MM+G K   +W+   +CW  +TP  ++ IL  S    T   +G    P W   LG+ MT   L+ +  + V+ I  A   +++ +  T  P + WGP
Sbjct:   19 ASDEAKNAVKSQDPHVGTEDENAERGNWSSKREYMLSMIGYAVGLGNVWRFPYLAYKHGGGAFLIPYVIMLSIAGLPLFFLESSFGQFCSQGPINVWKAVPILQGVGITMMLVSTFVAIYYNVILAYSIYYLFASFQYPLPWSNC-SGWSDMGCNINATEYCNTTSYNGSLVALNRSAGADGNQSCPEELIVSTPLQTISEQYWDVVAL------QRTSSMDE-TGPVVWHLALCLLLGWIMIGAALFKGIKSSGKVVYFTATFPYAVLLILLIRGVTLEGARNGIEYYIGSQSNLTKLSEAEVWKDAATQIFFSLSIAWGGLTALASYNKFHNNCYKDSIIVCVTNCGTSIFAGFAIFSILGHMAHVYGKPVSEVAQAGFGLAFIAYPDALSKLPISPLWSILFFFMLITLGLDSQFAGIEVITTCLQDAYPKFLKSKRGLITVIICV--VLFLLGLPCVTGAGIYWVNLIDTFVAGWILLVAGLLEVFGLSCIYGGNRFIKDIEMMIGNKSAIFWIWWRSCWFFITPFVLLVILGWSVYTFTAPTYGTVEYPEWGIALGWCMTAFCLMWIPIVAVWRIAKASGGLWQRIKSTCVPTEDWGP 611          
BLAST of slc6a-5 vs. Ensembl Cavefish
Match: slc6a3 (solute carrier family 6 member 3 [Source:NCBI gene;Acc:103026128])

HSP 1 Score: 468.774 bits (1205), Expect = 8.719e-158
Identity = 234/550 (42.55%), Postives = 356/550 (64.73%), Query Frame = 1
Query:   82 TNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQ--NCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIY 1725
            T+  +++      P    R  W  + DF LS +G+AV L N+WRFP+LCY +GGGAFLVPY + ++IAG+P+FY ELALGQ++  G   +WK+ P+FKG+G+++++++  V  YYNVIIAW+L+YLF+SF+ +LPW +CNN WN             +NCS LN    N       A +Y+++ VL ++D  G        LG  +W L  CL +  ++    L KGVK+SGKVV+ TA  PYVV+ ++++ G  L G+  GI+ YL   + +L   QVW +AATQI +SLGV FG L+  SSYNKF+NNCYRDA++ S IN LTSF +GF IFS LGYM+ +   A+++  T G GL F+ Y ++++T+  + +W+++FF+MLLTLGIDS  GGME++ TGL DEF  L +   +   F + + ++ F + + CV+ GGIY+F+++D ++   ++    + E I I + YGV  F  DI+ M+G +PG YW  CW  V+P  ++F++++SF    P K+G+Y  P WAN++G+ +++  +I + +Y IY
Sbjct:   43 TSSALVTSTGQTHPSGEQRETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELALGQYNREGAAGVWKICPVFKGVGFTVILISLYVGFYYNVIIAWALFYLFSSFSGELPWVNCNNTWNS------------ANCSDLNATLLNDSHKVTPALEYFERGVLHMQDSRGIDD-----LGLPRWQLTCCLAVVIVVLYFSLWKGVKTSGKVVWITATMPYVVLTVLLLRGVTLPGAIDGIKAYLSVDFLRLCDAQVWIEAATQICFSLGVGFGVLIAFSSYNKFSNNCYRDAIITSSINSLTSFFSGFVIFSFLGYMSQKHNVALDKVATDGPGLVFIIYPEAIATLPGSSVWAVIFFIMLLTLGIDSAMGGMESVITGLIDEFKFLHRHREL---FTLFIVVLTFLISLFCVTNGGIYVFTLLDHFAAGTSILFGVLIEAIGIAWFYGVDRFSDDIQEMIGHRPGLYWRLCWKFVSPCFLLFMVVVSFATFNPPKYGSYYFPTWANMVGWCLSISSMIMVPLYAIY 572          
BLAST of slc6a-5 vs. Ensembl Cavefish
Match: slc6a7 (sodium-dependent proline transporter-like [Source:NCBI gene;Acc:103039122])

HSP 1 Score: 467.618 bits (1202), Expect = 1.273e-156
Identity = 251/535 (46.92%), Postives = 345/535 (64.49%), Query Frame = 1
Query:  136 RGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGY------YWVACWMVVTPLTIIFILILSF--MYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVY 1716
            R  W G+++F LSC+GY VGLGN+WRFP+LCY +GGG FL+PYFIML   G+P+F  EL+LGQ+ ++GPI++WK  P+ KGIG  ML V+T+V +YYNVIIAW+ YYL +SF S LPWS C+   N + C    RN T    S             +E +W + VLGV    G   P     GPV+W L LCLL AW+I   C++KG++SSGKVVY TA FPY+V++++++ G  L GS  G+ +YL P W +L + QVW DAA+QIFYSLG+  GGL++M+SYNKF+NN  RD L++++ NC TSF AGFAIFS+LG+MA + G  +E+   SG GLAFVAY ++L+ +  +  W+ILFFLML  LG+D+ FG ME I T + DEFP L+        F   +    + +G+  V+ GGIY F+++D  S +F L II +F  + I + YGV  F +DI  M+   P +      Y+ ACW+  TP  ++FIL   F  MY TP K+G YI P+W   LG  M     + I+++
Sbjct:   79 REQWGGKYEFLLSCIGYCVGLGNVWRFPYLCYRNGGGVFLIPYFIMLFFTGMPLFLMELSLGQYGAAGPITVWKCCPLLKGIGIGMLCVSTLVCLYYNVIIAWTFYYLGSSFQSPLPWS-CDAIANAKLC----RNNTNGTLS------------PSEFFWNERVLGVSHSTGLSNP-----GPVRWQLALCLLAAWVIIFLCMLKGIRSSGKVVYVTATFPYLVLVVLIIRGATLEGSLQGVAFYLTPVWGRLANAQVWNDAASQIFYSLGIGVGGLLSMASYNKFDNNVIRDTLVITIGNCATSFFAGFAIFSILGHMAWRKGVPVEKVAISGPGLAFVAYPEALALLPGSVFWAILFFLMLFMLGVDTLFGNMEGITTAVLDEFPQLRSNMKYKTLFLGLLCFGFYLMGLLLVTNGGIYWFTLIDSSSTSFGLIIITLFMCLGISFFYGVNQFCQDIVDMICLCPPWCTKVLLYFKACWVFFTPFLLLFILTYIFIEMYRTPLKYGQYIYPLWGKALGVCMGAFCCLQILIW 591          
BLAST of slc6a-5 vs. Ensembl Sea Lamprey
Match: slc6a1a (solute carrier family 6 member 1a [Source:ZFIN;Acc:ZDB-GENE-060519-23])

HSP 1 Score: 438.343 bits (1126), Expect = 1.199e-147
Identity = 230/551 (41.74%), Postives = 352/551 (63.88%), Query Frame = 1
Query:  109 DSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCY-RDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGT-FTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIY-YAIFKGVTK 1752
            +++  +   RG W GRFDF +SCVGYA+GLGN+WRFP+LC  +GGGAFL+PYF+ L+ AGIP+F  E +LGQ++S G + +WK+ PMFKG+G + ++++  +++YY VII+W++YYL+ SFTS LPW DCNN WN ++C         SN S L+T N     V   ++W++    +   +  L   EP  G V+  L + L ++W++   C+ KGV  +GKVVYF+A FPYV++ ++   G  L G+K GI +Y+ P +++L    VW DAATQIF+S G+  G L+ + SYN F+NN Y RD+++V  IN +TS  AGF IFS++G+M+H T + +++   SG GLAF+AY Q+++ + ++PLWSILFF MLL LG+DSQF  +E   T L DE+P   + H     F   + +I + +G+  +++GG+Y+F + D YS +  +L  +  FE I I + YGV  F  +I  M+G K   +W  CW+  TPL ++ + + S +  TP   G+Y  P+W   +G+ M L  ++ I  Y +Y + + KG  +
Sbjct:    1 EAKKKELPVRGAWKGRFDFLMSCVGYAIGLGNVWRFPYLCGKNGGGAFLIPYFLTLVFAGIPLFLLETSLGQYTSVGGLGVWKLAPMFKGVGLASVVISFYLNIYYIVIISWAIYYLYNSFTSMLPWQDCNNPWNTDKCF--------SNYSILDTTNLTSTVV---EFWER---NMHQLSSGLD--EP--GQVRGPLAITLAISWVMVYFCIWKGVAWTGKVVYFSATFPYVMLFVLFFRGITLPGAKEGILFYITPDFRRLTDSAVWLDAATQIFFSYGLGLGSLVALGSYNPFHNNVYNRDSIIVCCINSVTSVFAGFVIFSIVGFMSHITKKPVKELAASGPGLAFLAYPQAVTQLPISPLWSILFFSMLLMLGLDSQFCTVEGFVTALSDEYPQYLRGH--KEIFIAVICVISYIIGLANITQGGLYVFKMFDYYSASGMSLLFLVFFETIAISWCYGVDRFNDNICEMIGHKVHKWWNICWVFFTPLVVVGVFMFSVVEMTPLTLGSYTYPMWGQGMGWFMALSSMLLIPGYMVYLFLVSKGTLR 531          
BLAST of slc6a-5 vs. Ensembl Sea Lamprey
Match: slc6a4b (solute carrier family 6 member 4b [Source:ZFIN;Acc:ZDB-GENE-060314-2])

HSP 1 Score: 397.127 bits (1019), Expect = 8.512e-132
Identity = 213/498 (42.77%), Postives = 313/498 (62.85%), Query Frame = 1
Query:  244 GAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWK-VQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTS-GSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPIL--KKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIY 1725
            GAFL+PY +M +  GIP+FY ELALGQF  +G ISIW+ + P+FKG+G+++ I+   V+ YYN IIAW+LYYL++SFTS LPW+ C+N WN   C + F    ++                AE+++ + VL ++ Y+  L      +G ++W L LCL L + I    L KGVK+SGKVV+ TA FPYVV+ I+++ G  L G+  G+ +YL P WKKLL+ +VW DAA QIF+SLG  FG L+ ++SYNKFNNNCYRDAL+ S +NC TSF++GF IF+VLGYMA      +E      G  L F+ Y ++++ M  +  W+ILFF+M++TLG+DS FGG+EAI T + DE+P L  K+  +    F + +  I F   ++ ++ GG Y+  +++E+    ++  I + E I + + YGVK F  DI  MLGF PGY+W  CW+ ++PL + FI++       P K  +Y  P W+ +LGY +     + + +Y  Y
Sbjct:    1 GAFLIPYCLMAVFGGIPLFYMELALGQFHRNGAISIWRRICPIFKGVGFAICIINFYVAFYYNTIIAWALYYLYSSFTSTLPWTKCDNPWNTVNCTSYFDTTGVAWGK--------HSRSPAEEFYTRNVLEIQ-YSKGLGG----VGGLRWQLLLCLFLIFTIVYFSLWKGVKTSGKVVWVTATFPYVVLFILLIRGATLPGAWRGVLFYLKPNWKKLLTTEVWVDAAAQIFFSLGPGFGVLLALASYNKFNNNCYRDALVTSSVNCFTSFMSGFVIFTVLGYMAEMRNVEVEDVAKDMGPSLLFITYPEAIANMMGSTFWAILFFMMMITLGLDSTFGGLEAIITAVMDEYPSLFSKRREY----FVLGLVTICFMGALSTLTYGGAYIVKLLEEFGSGCSIIGIVLLEAIAVSWFYGVKRFCADIHSMLGFSPGYFWRLCWVAISPLFLSFIVVSFLTGSKPLKLFDYDFPDWSMILGYFIAASSFMFVPLYMAY 481          
BLAST of slc6a-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008631.1 (pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 gene:ENSPMAG00000007785.1 transcript:ENSPMAT00000008631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 327.405 bits (838), Expect = 4.793e-105
Identity = 194/497 (39.03%), Postives = 295/497 (59.36%), Query Frame = 1
Query:  244 GAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTS-KLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGT-FTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKF-GNYILPVWANVLGYLMTLVGVINIVVYFIY 1725
            GAFLVPY + ++  GIP+F+ E+ALGQ +  G I +WK+ P+F G+G + ++V  +  +YY V++AWSLYYL  S T+ +LPW+ C   W    C         ++ ++     C +    A ++W++ VL V     +L       G V W + LCLL  W++    + KG+K SGKVVY T   PYV++++++V G +L G+  GI YYL P W KL + QVW +A+TQ+FY  GV FG L  + SYNKF+NNCYRD++++++IN  TSF +GF +FS LG+MA + G  I     +G GL FV Y +++S + V  LW+ L F+MLL LG+DS+F GME   TGL D FP          AF     ++ F L +T V++GGIY+F + D Y+ +  ++  +  +E I + ++YG   FM+D+  MLGF+P  +   CW VV+P   + I +   +++    + G Y  P WA  LG+L+ L  ++ I    +Y
Sbjct:    1 GAFLVPYGLTVVCVGIPLFFLEVALGQLTQQGTIGVWKIVPLFTGVGVASMVVVFLSDLYYIVVLAWSLYYLLHSLTTAQLPWTHCQGWWATAACSDTLGTSRAASNASEGASACQDTTSPAVEFWERNVLRVSSGMHDL-------GSVNWEMLLCLLAVWLLVYFSVWKGIKFSGKVVYVTGSVPYVLLLVLLVQGVMLPGALDGITYYLQPDWAKLATPQVWVEASTQVFYCYGVGFGVLPALGSYNKFHNNCYRDSIILTIINSATSFFSGFVVFSFLGFMAQEQGVDISHVAETGPGLVFVVYPRAISLLPVPALWATLLFIMLLLLGVDSEFAGMEGFVTGLTDLFPSQLSGKRRREAFTGLCCLVSFLLSVTMVTQGGIYVFQLFDSYAASGISMLWLMGWECIAVAWVYGANRFMQDLTAMLGFRPHAWVWWCWSVVSPAVCLGIFVFHLVHYERLVYNGRYEYPGWAEALGWLLALSSMLCIPAVALY 490          
BLAST of slc6a-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004857.1 (pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 gene:ENSPMAG00000004412.1 transcript:ENSPMAT00000004857.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 259.61 bits (662), Expect = 1.171e-80
Identity = 139/321 (43.30%), Postives = 194/321 (60.44%), Query Frame = 1
Query:  772 KVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGT-FTLQIIAIFELITIMYLY-GVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGN-YILPVWANVLGYLMTLVGVINIVVYFIY 1725
            +VVYFTA FPY+V+II+ +NG  L GS  GI YYL P W KL   QVW DA TQIF+S  +  G L  + SYN+FNNNCYRD  +++++N  TSF AGF +FS LG+MA + G  I Q   SG GLAF+AY +++S M +APLW+ LFF ML+ LG+DSQF G+E   TG+ D FP      +    F        F + I+ V++GG+Y+F + D YS +  TL   A +E I + ++Y G   FM +I +M+G++P  +   CW  VTP     I + + + + P  +   Y+ P W   LG+ M L  ++ I V  IY
Sbjct:    1 QVVYFTATFPYLVLIILFINGMTLPGSYDGIMYYLKPDWSKLGQPQVWIDAGTQIFFSYAIGLGALSALGSYNRFNNNCYRDTFILALVNSGTSFFAGFVVFSTLGFMAAEQGVDISQVAESGPGLAFIAYPKAVSLMPMAPLWAALFFFMLILLGLDSQFVGVEGFVTGISDLFPAALTGGYRREVFVGVCCFTSFLIAISMVTEGGMYVFQLFDYYSASGMTLLWQAGWECIVVAWVYAGGDRFMDNIALMIGYRPFPWMRWCWAFVTPCVCTGIFLFNLLNYKPLTYNKGYVYPWWGEALGWCMALSSMLCIPVVAIY 321          
BLAST of slc6a-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001684.1 (pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 gene:ENSPMAG00000001516.1 transcript:ENSPMAT00000001684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 239.58 bits (610), Expect = 1.163e-74
Identity = 128/255 (50.20%), Postives = 178/255 (69.80%), Query Frame = 1
Query:  124 KTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWN-DERCLT-DFRNKTIS--NCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYL 876
            +   RGNW+ + ++ LS +G AVGLGNLWRFP+L Y +GGGAFL+PY IML   G+P+F+ E ++GQF+S GPI+IWKV P+ KG+G+ M+I ++++++YYN IIA+ L+YLFASFTS+LPWS C   W  DE C      N +++  NCS++N+      +  +EQYW K  L   +            G V WHL L LLL+WI+  A L+KG+KSSGKVVYFTAIFPYVV+II+++ G  L G+ +GI+YY+
Sbjct:    2 ENAERGNWASKSEYMLSMIGNAVGLGNLWRFPYLAYKNGGGAFLIPYIIMLAFVGLPLFFLECSIGQFASLGPITIWKVVPLLKGLGWMMVITSSLIALYYNSIIAYGLFYLFASFTSELPWSSCKKWWGADENCFDRSVCNSSLAEGNCSSVNSSK----QTPSEQYWNKYALRRSESMDE-------TGDVVWHLALTLLLSWIVTCAALVKGIKSSGKVVYFTAIFPYVVLIILLIRGATLPGAILGIEYYI 245          
BLAST of slc6a-5 vs. Ensembl Nematostella
Match: EDO39707 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977])

HSP 1 Score: 459.914 bits (1182), Expect = 7.824e-155
Identity = 236/553 (42.68%), Postives = 358/553 (64.74%), Query Frame = 1
Query:   76 SKTNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWK-VQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLN-TQNCIEYEVAAE-QYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIY 1725
            S ++ +   ++D +  +T  R  WS + +F LS +GY VG GN+WRFP+LCY +GG  FL+PYFIML++ GIP+F+ ELA+GQ+ SSG I +WK + P+ KGIGY++ +++ +  +YY VI+AW+ YYLF SF + +PW  C+N WN + C        + NC+ L+  QNC     +   ++W   VL + +   +        G ++W L    +L+WI+   CL KG+KSSGKVVYFTA FP++V+ I+++ G  L GS  G+ YYL P W++L   QVW  AATQI++SLGV FG L+T  SYNKFNNN ++DAL++S+ NC TSF AGF +FSVLG+MA      + +  TSG GLAFVAY +++S M V+ LW++LFF ML+TLG+DSQF  +EA+ T + DE+P ++ T +    F + + I L  LG+ CV +GG+++F++MD      +L I+A+ E+ITI ++YGV  F  D++ M G +P  ++  CW  V+PL  + I++ + +     K+     P WA ++G+++ L  V+ I  + I+
Sbjct:   21 STSSSEDSPQIDVEEEQT--RDKWSSKAEFMLSSLGYCVGFGNVWRFPYLCYKNGGATFLIPYFIMLIVNGIPLFFLELAIGQWFSSGVIGVWKSICPLLKGIGYAICMISYLCCIYYIVILAWTFYYLFMSFQAVVPWKTCDNPWNTKFCRAKRSGDLLLNCTELDLPQNCTAKPTSPSGEFWSNNVLEMTEDISDF-------GDMRWPLFGTFILSWIVVYFCLFKGIKSSGKVVYFTATFPFIVLFILMIRGATLEGSLDGVIYYLNPDWERLADPQVWIYAATQIYWSLGVGFGALITFGSYNKFNNNVHKDALVISIANCSTSFFAGFVVFSVLGFMALTLDTTVAKVATSGPGLAFVAYPEAISQMPVSTLWAVLFFFMLITLGLDSQFATIEAVITAIVDEYPWVRGTKWRKPVFVLILCISLCILGLPCVFQGGMWIFNLMDYQVAGLSLLIVALLEIITIGWIYGVDRFSDDVEYMTGRRPMRWFRICWKYVSPLCTLAIILANLIQWKGVKYNGKPYPGWAELIGWMLMLSSVLMIPAFAIH 564          
BLAST of slc6a-5 vs. Ensembl Nematostella
Match: EDO31545 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7SXK0])

HSP 1 Score: 453.366 bits (1165), Expect = 1.747e-152
Identity = 241/560 (43.04%), Postives = 350/560 (62.50%), Query Frame = 1
Query:  127 TTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIW-KVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCL-----------------TDFRNKTISNCSTLN------TQNCI--EYEVAAE-QYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIY 1725
            T  R  W  + DF LSC+G+AVGLGN+WRFP+LCY +GGGAFL+PY IML++ G+P+F+ EL+ GQ+ S GPI +W  + P+F+GIG++ ++++ +V VYYNVIIAW LY+L  SF S++ W  C+N WN + C                      N T++N + L       T  C+  E +V+   ++W+  +L + D  G         G ++W + +CL+LAW+    C+ KGVKSSGKVVYFTA FPY+V+ I+ V G  L G+  GI +YL P+W +L   +VW  AATQIFYSLG+ FG L+ M SYNKF+NN ++DA+ +S+INC TS  AGF IFS LG+M+H   + IE+   SG GLAFV Y ++++ M ++PLW+ILFF M+LTLG+DSQFG MEA+ TG+ DE+P+ +K   + IA       + F LGIT V++GG Y+ ++ D  SG  +L  +  FE + + ++YG   F KDI+ M+G +P  +W   W    P  +  I   S ++     +G+Y  P WA   G+++ L  ++ I    IY
Sbjct:    3 TNERETWGKKADFLLSCIGFAVGLGNVWRFPYLCYANGGGAFLLPYLIMLVLCGMPMFFMELSAGQYFSLGPIGVWGAICPLFRGIGFASIVISFLVCVYYNVIIAWCLYFLAVSFRSEVLWKHCDNWWNTDNCYAGRIPESMSCSLGSGSNNSLVNSTLANATVLAANATNATTECLFPENQVSPSLEFWENYILRLSDGIGEA-------GEIRWQILVCLILAWVGVYFCMWKGVKSSGKVVYFTATFPYLVLFILFVRGVTLPGADKGIAFYLKPEWHRLKDPKVWVAAATQIFYSLGIGFGSLVAMGSYNKFHNNIFKDAISISLINCGTSVFAGFVIFSTLGFMSHVLNKPIEEVANSGPGLAFVVYPEAIAQMPISPLWAILFFFMILTLGLDSQFGMMEAVITGIIDEYPVCRKRKELFIAVAC---FLCFLLGITNVTQGGAYVLNLFDYQSGGVSLLFLGFFETVCLAWIYGADRFSKDIEDMVGSRPAAWWRFTWKFCAPTVMAGIFFYSIIFWQGVSYGSYKYPQWAEFFGWVIALSSMLFIPGNAIY 552          
BLAST of slc6a-5 vs. Ensembl Nematostella
Match: EDO49218 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4])

HSP 1 Score: 440.654 bits (1132), Expect = 1.721e-147
Identity = 251/595 (42.18%), Postives = 358/595 (60.17%), Query Frame = 1
Query:   67 EDSSKTNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWK-VQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCI-EYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEF-PILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAIFKGVTKTPKDSWGPGNKADWE----IDDRYAVKSSP 1830
            +++ K + ++I E          R  W  + +FFL+CVGYAVGLGN+WRFP+LC+ +GGGAFL+PY  MLLI G+P+F+ EL+LGQF S GP++ W  + P+ KG+G++ML+V+ +  VYYNVIIAW LYYLF SF   +PW  C+N WN           T +NC++  T   + EY   +++++       E+Y   + P     G ++W L +CL+LAW++   CL KG+KSSGKVVYFTA FPY+V++I+++ G  L G+  G+ +YL P + KL    VW DAATQIFYSLG+ FG L+ M SYNKF+NNC+RDA+ VSVINC TS  AG  IFSVLG+MA   G+ + +  TSG GLAFV Y + ++ M ++P WSI FF MLLTLG+D+QF   EA+ TGL DE+  +L+    +  AF   +    F LG+  VS+ G ++ ++    +G  +L  +A FE+I + + YG   F  DI+ M G K   +W   W  +TP  I  I I S +      + +Y  P WA  +G++M L  ++ I    IY         T  + W    + D E    I+ R  +   P
Sbjct:   24 DENCKIDVEIIGE---------EREKWGRKVEFFLACVGYAVGLGNVWRFPYLCFKNGGGAFLIPYLCMLLICGMPLFFMELSLGQFVSLGPVTSWAAICPISKGVGFAMLVVSFLCCVYYNVIIAWCLYYLFESFAKDVPWKTCDNWWN-----------TATNCTSNLTDTALKEYSSPSKEFY-------ENYVLRITPDIDTFGVMRWQLVVCLILAWVLVYFCLWKGIKSSGKVVYFTATFPYLVLVILLIRGLTLPGAMKGLSFYLKPNFSKLGDAIVWVDAATQIFYSLGIGFGSLIAMGSYNKFHNNCFRDAMTVSVINCSTSVFAGLVIFSVLGFMAEVLGKEVSEVATSGPGLAFVVYPEGIAQMPISPFWSICFFFMLLTLGLDTQFAMFEAVTTGLGDEYVRLLRNRKELFTAF---LCFCCFLLGLPIVSQSGAFIMNLYVWQAGGVSLVFLAFFEVIVVAWGYGADRFALDIETMTGNKVWPWWPIAWKYITPAVITGIFIFSLVQWQGVSYDDYQYPPWAEFVGWVMALSSMLWIPGVAIYK--MSRAKGTFMERWRSLTRPDQEQMSIIELREGIPKRP 586          
BLAST of slc6a-5 vs. Ensembl Nematostella
Match: EDO32356 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7SVA2])

HSP 1 Score: 426.787 bits (1096), Expect = 3.845e-142
Identity = 220/530 (41.51%), Postives = 332/530 (62.64%), Query Frame = 1
Query:  124 KTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGT-FTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFG-NYILPVWANVLGYLMTLVGVINI 1707
            +   R  W G+ DF L+ +G++VGLGN+WRFP+LCY +GGG FL+PY I LL+AG+P+   E+ LGQF S G I+ WK+ P+F+GIGY+ +++   +++YY VI+ W+ YY+F SF + LPWS C+N WN E+C    +  T  N     ++ C  +  + +  WK       DY  N+      +G + W + LCLL AWI+C  C+ KGVKS+G+VVYFTA FPYV++ I+ V    L G++ GI++YL P W +L    VW  AATQ+F+S  +  G L+ + SYNKF NNCYRD ++ + +N  TSF  GF IFSVLG+MA + G  I++   SG GLAF+AY  +++ M ++PLWSILFF M++ LG+DS+F G+E   T + D FP   +  +    F  +     FF+G+  V++GG+Y+F + D YS +   L  I++FE I I ++YG + F +++  M+GF+   Y   CW+  TP+  + + I S + + P  +   Y  PVW + +G+L+ L  ++ I
Sbjct:    5 EVVERETWVGKLDFILALIGFSVGLGNIWRFPYLCYKNGGGCFLIPYLICLLLAGVPLLILEVCLGQFMSQGGITAWKICPLFQGIGYASVVIVQYLNIYYIVILGWAFYYMFHSFQAVLPWSHCDNDWNTEKCHVGRKMITTFNS---GSKCCQLFIKSFKCLWKDAA----DYVLNISGGLDQIGTINWQMALCLLFAWIVCYLCVFKGVKSTGRVVYFTATFPYVLLTIICVRAVTLPGAREGIRFYLEPDWSRLQDGSVWLQAATQVFFSYSIGLGTLIALGSYNKFKNNCYRDCIIFACVNSGTSFYGGFVIFSVLGFMAEKQGVPIQEVAESGPGLAFIAYPAAVAEMPISPLWSILFFFMVILLGLDSEFVGVEGFVTAIVDMFPGYLRRGYRKEIFIAACSTFWFFIGLVMVTEGGMYVFQLFDNYSASGICLLWISLFESIGIGWVYGAERFYQNMTDMIGFRINPYLKVCWIFCTPIFCLAVFIFSLVNYEPLTYNLTYKYPVWGDAIGWLLALSSIVCI 527          
BLAST of slc6a-5 vs. Ensembl Nematostella
Match: EDO39708 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S978])

HSP 1 Score: 416.387 bits (1069), Expect = 8.444e-139
Identity = 231/534 (43.26%), Postives = 342/534 (64.04%), Query Frame = 1
Query:  136 RGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKV-QPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAI 1734
            R  WS + DF LSC+GYAVGLGN+WRFP+LCY +GG +FL+PY + L+  GIPIFY E+ALGQ+++ G ++ W V  P+  GIG++M ++  + SVYYNVI+AWS YY+F ++ + +PW+DCNN WN + C         S    +N  +  E  + +    ++ VL +    G  +P     G V++ L +CLLLAWI+   C+ KG+KS+GKVVYFTA FPY+V+ I+++ G  L G+  G  +Y+ P + KL   +VW DAA QIF+SL V FGGL+T  SYNKFNNNC RD L+VSVINCLTS  AGF IF+++G+MAH+ G  +E    SG GLAF+AY Q +  +  +P W+ LFF ML  LG+DSQF G+E + T L D +   K          +   ++ + LGI+ V++GG+Y+F++ D   G  +L +IA+ E+I I + YGV+ F ++I+ M+G +P  Y++ CW  ++PL I  I I + +  +   +G+Y+ P WA   G+L+    ++ + +  IY  +
Sbjct:    4 REQWSNKIDFLLSCIGYAVGLGNVWRFPYLCYKNGGASFLIPYLVCLVFCGIPIFYLEVALGQYTAQGVVNAWAVVSPIMTGIGFAMTVITFLCSVYYNVIMAWSFYYMFDAWRAVVPWNDCNNEWNTQFC---------SCTHAMNIPSFHENTIISVTLSRRKVLQLSGDVG--KP-----GEVRFELAMCLLLAWIVVYFCVWKGIKSAGKVVYFTATFPYLVLFILLIRGATLPGAANGALFYVKPDFTKLGDPRVWVDAAGQIFFSLSVGFGGLITYGSYNKFNNNCQRDTLIVSVINCLTSVFAGFVIFTMMGFMAHELGVEVEDVVKSGPGLAFIAYPQGIKKIPGSPFWAFLFFFMLFNLGLDSQFVGVETVTTVLSDSY---KGARRYKAHLTLLFCVVSYILGISNVTQGGVYIFTMFDYQGGGISLILIALLEVIAIGWFYGVERFARNIESMIGHRPNIYFLLCWKYISPLIIGVIFIWNCVDWSGISYGDYVFPAWAEFCGWLLCFSSIVCVPICAIYRCV 518          
BLAST of slc6a-5 vs. Ensembl Medaka
Match: slc6a5 (solute carrier family 6 member 5 [Source:NCBI gene;Acc:101158004])

HSP 1 Score: 488.804 bits (1257), Expect = 2.257e-163
Identity = 260/586 (44.37%), Postives = 365/586 (62.29%), Query Frame = 1
Query:  133 ARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC------------LTDFRNKTISNCSTLNTQNCI---------------EYEVAAEQYWKKVVLGVE---DYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAIFKGVT--------KTPKDSWGP 1776
            ARGNWS + DF LS VGYAVGLGN+WRFP+L + +GGGAFL+PY  ML IAGIPIF  E++LGQF+S GP+S+WK  P  +G G +MLI++ ++++YYN+I+ W+LYYLFAS    LPW++C N WN   C            L D    ++ N +   + N +                Y   +E+Y+K  VL +    +Y G++R          W L  CL LAW+I  A L KG+KSSGKVVYFTA FPYVV+II+++ G  L G+  GI Y++ PKW+KL   +VW+DAATQIF+SL  A+GGL+T+SSYNKF+NNCYRD ++V+  N  TS  AGF IFSV+G+MAH+    IE+    G G+AFV Y ++L+ + ++P W+I+FFLMLLTLG+D+ F  +E I T + DEFP   + H     F +      F LG   +++ G+YM  ++D ++ +++L IIAIFEL+ I YLYG++ F  DI+MM+GF+P  +W  CW  VTP  +  IL LS        + +Y  P W+ ++G+LM +  VI I + F+        T         +P+  WGP
Sbjct:  168 ARGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIFLLEVSLGQFASQGPVSVWKCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGSLPWANCRNEWNTVECKDKDMLLLDSCILRDRNAISVKNSTFCLSANAVGNLTKLLNVSIDANKTYVSPSEEYFKYNVLHISKGIEYPGDIR----------WPLAGCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLIILLIRGVTLPGAGDGILYFITPKWEKLSDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIEKVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYLRKH--KPVFTLICCASFFILGFPMITENGMYMLQLVDTFAASYSLVIIAIFELLGISYLYGLQRFCADIEMMIGFQPNRFWRLCWAFVTPTILTGILGLSLYQWKVMTYEDYTYPTWSMIMGWLMVICSVIWIPIMFLIKMYLAPGTIGERLKLVCSPQPDWGP 741          
BLAST of slc6a-5 vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 477.248 bits (1227), Expect = 1.667e-160
Identity = 258/604 (42.72%), Postives = 374/604 (61.92%), Query Frame = 1
Query:   49 SRMASVEDSSKTNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCL----TDFR-NKTISNCSTL------NTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPME-PFLG--PVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFP----ILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYY------AIFKGVTKT---PKDSWGPG 1779
            S   +V  S+      +     +  +   RGNW  + +F L+ VGYAVGLGN+WRFP+LCY +GGGAF++PYFIML+  GIP+F+ EL+ GQF+S G + +WK+ PMFKG+GY M++V+T + +YYNV+I  + YY F S T+ LPW+ CNN WN   C     + ++ N +++N +T          N  +    +E+YWK  VL + D  GN   +  P LG   V W           +   CLI+GVKSSGKVVYFTA FPYVV+ I+ + G  L G+  GI+YYL P+W+K+L  +VW DAA+QIFYSLG A+GGL+TM+SYNKF+NNC+RD++++S+ NC TS  AGF IFS+LG+MAH     + +    G GLAFVAY ++L+ + ++PLWS+LFF ML+ LG+ +QF  +E + T + DE      I  KT        +SV ++ F LG+   ++ GIY   +MD Y+ +F+L +I+    I IMY+YG +N+ +D++MMLGF P  ++  CW  ++PL I FILI + + + P  + +Y+ P W+  +G+ M L  V+ I VY +Y       A F+   K        WGP 
Sbjct:    2 SESNTVAASTADQNGAVPGEPVKKDENLRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMLPYFIMLVFCGIPLFFLELSFGQFASQGCLGVWKISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSGYQINNSLANATTSLVAGVSEVVNRTKRTSPSEEYWKHYVLNISDDIGNFGEVRLPILGCLAVSW----------CVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGIKYYLTPQWQKVLDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISITNCATSVYAGFVIFSILGFMAHNLNVPVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNKT-----VVTLSVAVVGFLLGVPLTTQAGIYWLLLMDNYAASFSLVVISCIMCICIMYIYGHRNYFRDVEMMLGFPPPLFFKVCWRFISPLIISFILIFTVIQYKPITYNDYVYPGWSLAIGFAMALSSVVCIPVYALYKISRSPGATFRERLKAACRAHPKWGPA 590          
BLAST of slc6a-5 vs. Ensembl Medaka
Match: slc6a7 (sodium-dependent proline transporter [Source:NCBI gene;Acc:101168229])

HSP 1 Score: 475.707 bits (1223), Expect = 5.403e-160
Identity = 257/551 (46.64%), Postives = 356/551 (64.61%), Query Frame = 1
Query:  109 DSQTP-----KTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGY------YWVACWMVVTPLTIIFILILSF--MYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFI 1722
            DS  P      TT R  W G+++F LSC+GY VGLGN+WRFP+LCY +GGG FL+PYFIML +AG+P+F  EL+LGQ+ ++GPI++WK  P+ KGIG  ML V+T+V +YYNVIIAW+ YYL +SF S LPWS C+   N   C     N T  N S+   +         E +W + VLG+ +  G   P     GPV+W L LCLL AWII   C++KG++SSGKVVY TA FPY V+I++++ G  L GS  GI +YL P W +L S QVW DAA+QIFYSLG+  GGL++M+SYNKF+NN  RD ++++  NC TSF AGFAIFS+LG+MA + G ++ +   +G GLAFVAY ++L+ +  +  WSI+FFLML  LG+D+ FG ME I T + DEFP L++ +     F  ++    + +G+  V++GGIY F+++D +S +F L II +F  I I + YGV  F +DI  M+   P +      Y+ ACW   TP  ++FIL   F  MY T  K+G+Y+ P+W   LG  M     + I+++ I
Sbjct:   46 DSPGPGPIVANTTPREQWGGKYEFLLSCIGYCVGLGNVWRFPYLCYRNGGGVFLIPYFIMLFVAGVPLFLMELSLGQYGAAGPITVWKCCPLLKGIGIGMLCVSTLVCLYYNVIIAWTFYYLGSSFQSPLPWS-CDAIANAAVC----SNNTAGNSSSGRART------PTEIFWNENVLGLVNSEGLHDP-----GPVRWPLALCLLAAWIIIFLCMLKGIRSSGKVVYVTATFPYFVLIVLIIRGATLEGSLQGIAFYLTPDWARLASAQVWSDAASQIFYSLGIGVGGLLSMASYNKFDNNVIRDTIIITTGNCCTSFFAGFAIFSILGHMAWRKGVSVGEVADTGPGLAFVAYPEALALLPGSVFWSIMFFLMLFMLGVDTLFGNMEGITTAVLDEFPQLRQNNLHKSLFLGTLCFGFYLMGLLLVTEGGIYWFTLIDSFSTSFGLIIITLFMCIGISFFYGVNQFCQDILDMIRHCPPWCSKVLIYFKACWCFFTPFLLMFILAFIFLEMYSTSLKYGSYVFPLWGKALGVCMGATCCLQILIWAI 580          
BLAST of slc6a-5 vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 474.937 bits (1221), Expect = 1.453e-159
Identity = 255/575 (44.35%), Postives = 366/575 (63.65%), Query Frame = 1
Query:  136 RGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCL----TDFR-NKTISNCSTL------NTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPME-PFLG--PVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFP----ILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYY------AIFKGVTKT---PKDSWGPG 1779
            RGNW  + +F L+ VGYAVGLGN+WRFP+LCY +GGGAF++PYFIML+  GIP+F+ EL+ GQF+S G + +WK+ PMFKG+GY M++V+T + +YYNV+I  + YY F S T+ LPW+ CNN WN   C     + ++ N +++N +T          N  +    +E+YWK  VL + D  GN   +  P LG   V W           +   CLI+GVKSSGKVVYFTA FPYVV+ I+ + G  L G+  GI+YYL P+W+K+L  +VW DAA+QIFYSLG A+GGL+TM+SYNKF+NNC+RD++++S+ NC TS  AGF IFS+LG+MAH     + +    G GLAFVAY ++L+ + ++PLWS+LFF ML+ LG+ +QF  +E + T + DE      I  KT        +SV ++ F LG+   ++ GIY   +MD Y+ +F+L +I+    I IMY+YG +N+ +D++MMLGF P  ++  CW  ++PL I FILI + + + P  + +Y+ P W+  +G+ M L  V+ I VY +Y       A F+   K        WGP 
Sbjct:   27 RGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMLPYFIMLVFCGIPLFFLELSFGQFASQGCLGVWKISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSGYQINNSLANATTSLVAGVSEVVNRTKRTSPSEEYWKHYVLNISDDIGNFGEVRLPILGCLAVSW----------CVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGIKYYLTPQWQKVLDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISITNCATSVYAGFVIFSILGFMAHNLNVPVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNKT-----VVTLSVAVVGFLLGVPLTTQAGIYWLLLMDNYAASFSLVVISCIMCICIMYIYGHRNYFRDVEMMLGFPPPLFFKVCWRFISPLIISFILIFTVIQYKPITYNDYVYPGWSLAIGFAMALSSVVCIPVYALYKISRSPGATFRERLKAACRAHPKWGPA 586          
BLAST of slc6a-5 vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 474.937 bits (1221), Expect = 1.453e-159
Identity = 255/575 (44.35%), Postives = 366/575 (63.65%), Query Frame = 1
Query:  136 RGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCL----TDFR-NKTISNCSTL------NTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPME-PFLG--PVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFP----ILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYY------AIFKGVTKT---PKDSWGPG 1779
            RGNW  + +F L+ VGYAVGLGN+WRFP+LCY +GGGAF++PYFIML+  GIP+F+ EL+ GQF+S G + +WK+ PMFKG+GY M++V+T + +YYNV+I  + YY F S T+ LPW+ CNN WN   C     + ++ N +++N +T          N  +    +E+YWK  VL + D  GN   +  P LG   V W           +   CLI+GVKSSGKVVYFTA FPYVV+ I+ + G  L G+  GI+YYL P+W+K+L  +VW DAA+QIFYSLG A+GGL+TM+SYNKF+NNC+RD++++S+ NC TS  AGF IFS+LG+MAH     + +    G GLAFVAY ++L+ + ++PLWS+LFF ML+ LG+ +QF  +E + T + DE      I  KT        +SV ++ F LG+   ++ GIY   +MD Y+ +F+L +I+    I IMY+YG +N+ +D++MMLGF P  ++  CW  ++PL I FILI + + + P  + +Y+ P W+  +G+ M L  V+ I VY +Y       A F+   K        WGP 
Sbjct:   27 RGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMLPYFIMLVFCGIPLFFLELSFGQFASQGCLGVWKISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSGYQINNSLANATTSLVAGVSEVVNRTKRTSPSEEYWKHYVLNISDDIGNFGEVRLPILGCLAVSW----------CVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGIKYYLTPQWQKVLDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISITNCATSVYAGFVIFSILGFMAHNLNVPVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNKT-----VVTLSVAVVGFLLGVPLTTQAGIYWLLLMDNYAASFSLVVISCIMCICIMYIYGHRNYFRDVEMMLGFPPPLFFKVCWRFISPLIISFILIFTVIQYKPITYNDYVYPGWSLAIGFAMALSSVVCIPVYALYKISRSPGATFRERLKAACRAHPKWGPA 586          
BLAST of slc6a-5 vs. Planmine SMEST
Match: SMESG000042091.1 (SMESG000042091.1)

HSP 1 Score: 1187.56 bits (3071), Expect = 0.000e+0
Identity = 601/603 (99.67%), Postives = 601/603 (99.67%), Query Frame = 1
Query:   55 MASVEDSSKTNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAIFKGVTKTPKDSWGPGNKADWEIDDRYAVKSSPCDNDKMDSTSF 1863
            MASVEDSSKTNEQVISEVDSQTPKTT RGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHLCLCLLLAWIICGACLIKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTL GVINIVVYFIYYAIFKGVTKTPKDSWGPGNKADWEIDDRYAVKSSPCDNDKMDSTSF
Sbjct:    1 MASVEDSSKTNEQVISEVDSQTPKTTGRGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHLCLCLLLAWIICGACLIKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLAGVINIVVYFIYYAIFKGVTKTPKDSWGPGNKADWEIDDRYAVKSSPCDNDKMDSTSF 603          
BLAST of slc6a-5 vs. Planmine SMEST
Match: SMESG000042091.1 (SMESG000042091.1)

HSP 1 Score: 1181.01 bits (3054), Expect = 0.000e+0
Identity = 600/603 (99.50%), Postives = 600/603 (99.50%), Query Frame = 1
Query:   55 MASVEDSSKTNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAIFKGVTKTPKDSWGPGNKADWEIDDRYAVKSSPCDNDKMDSTSF 1863
            MASVEDSSKTNEQ ISEVDSQTPKTT RGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHLCLCLLLAWIICGACLIKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTL GVINIVVYFIYYAIFKGVTKTPKDSWGPGNKADWEIDDRYAVKSSPCDNDKMDSTSF
Sbjct:    1 MASVEDSSKTNEQ-ISEVDSQTPKTTGRGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHLCLCLLLAWIICGACLIKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLAGVINIVVYFIYYAIFKGVTKTPKDSWGPGNKADWEIDDRYAVKSSPCDNDKMDSTSF 602          
BLAST of slc6a-5 vs. Planmine SMEST
Match: SMESG000042051.1 (SMESG000042051.1)

HSP 1 Score: 818.15 bits (2112), Expect = 0.000e+0
Identity = 413/589 (70.12%), Postives = 489/589 (83.02%), Query Frame = 1
Query:   55 MASVEDSSKTNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAIFKGVTKTPKDSWGPGNKADWEIDDRYAVK 1821
            MA+VED  +T  +   EV  +  + T RGNWS + DFFLSCVGYAVGLGNLWRFPHLCY +GGGAFL+PYF ML+IAGIP+FYFEL+LGQFSSSG +++WK+QPMFKGIG++ML+++ I S+YYNVIIAWSLYYLFASFTSKLPWSDCNN WNDE CL DF+N T   CS+  T NC +YEVAAEQYW++VVLGV +YAG+ RPMEP+LG VQWHL LCLLLAWIICGA LIKGVKSSGKVVYFTAIFPY VI+IMV+NGCLL GS  GI+YYLIPKW KLL  +VW DAATQIFYSLGVAFGGLMTM+SYNKFNNNCYRDAL+VS+INC TSF+AGFAIF+VLGYM+ +TGR++ +TTTSG+GLAFVAYAQ ++TM  +P+WSILFF MLLTLGIDSQFGGMEAIFTG QD+FPILKKTHF D +FKI  QIILFFLG+ CVSKGGIYMF++MDEY G+F+L IIA  EL  I ++YGVKNF +DI+MML FKPGYYW+ CW  +TP+ IIFILI+S + H P+ +   +LP WAN LG ++    +  + +YF Y+AIFKG T  P + WGPG +  W  D RY+ K
Sbjct:    1 MAAVEDLVQTPNK---EVRFEGDENTYRGNWSSKMDFFLSCVGYAVGLGNLWRFPHLCYKNGGGAFLIPYFTMLIIAGIPLFYFELSLGQFSSSGFLTVWKIQPMFKGIGFAMLVISIICSIYYNVIIAWSLYYLFASFTSKLPWSDCNNEWNDELCLNDFKNVTNVVCSSFRTTNCTKYEVAAEQYWQRVVLGVVNYAGDQRPMEPYLGTVQWHLSLCLLLAWIICGASLIKGVKSSGKVVYFTAIFPYFVIVIMVINGCLLEGSLEGIKYYLIPKWSKLLEARVWGDAATQIFYSLGVAFGGLMTMASYNKFNNNCYRDALMVSIINCATSFVAGFAIFAVLGYMSVKTGRSVAETTTSGTGLAFVAYAQGVATMPYSPIWSILFFGMLLTLGIDSQFGGMEAIFTGFQDQFPILKKTHFHDFSFKIIFQIILFFLGLPCVSKGGIYMFTLMDEYCGSFSLIIIAFLELTIISFIYGVKNFSQDIEMMLKFKPGYYWIICWTFLTPIIIIFILIVSIIQHAPSSYNGVLLPKWANQLGGVIAASSISAVPIYFFYHAIFKGFTFKPNEEWGPGVEKFWRDDIRYSSK 586          
BLAST of slc6a-5 vs. Planmine SMEST
Match: SMESG000042086.1 (SMESG000042086.1)

HSP 1 Score: 785.408 bits (2027), Expect = 0.000e+0
Identity = 400/589 (67.91%), Postives = 484/589 (82.17%), Query Frame = 1
Query:   55 MASVEDSSKTNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVINIVVYFIYYAIFKGVTKTPKDSWGPGNKADWEIDDRYAVK 1821
            MA+VED  +T  ++  EV  +  + T RGNWS + DF LSC+G AVGLGNLWRFP+LCY +GGGAFL+PYF ML++AGIP+FYFEL+LGQFSSSG +++WK+QPMFKGIG++MLI++ I S+YYNVIIAWSLYYLFASFTSKLPWSDCNN WNDE CL +F+N T + CS+  T NC +YEV AEQYW++VVLGV +YAG+ RPMEP+LG VQWHL LCLLLAWIICGA LIKGVKSSGKVVYFTAIFPY VI+IMV+NGCLL GS  GI+YYLIPKW KLL   VW DAATQIFYSL V FGGL+TM+SYNKFNNNCYRDAL+VS+INC TSF+AGFAIFSVLGYM+ +TGR++ +TTTSG+GLAFV YAQ ++TM  +P+WSILFF MLLTLGIDSQFGGMEAIFTG QD+FPILKKTHF D +FKI  QIILFFLG+ CVSKGGIYM ++MDEY G+F+L IIA  EL  I ++YG+KN+++DI+MML FKPGYYW+ CW  +TP+ IIFILI+S + H P+ +   +LP WAN LG ++    +  + +YF Y+AIFKG +  P + WGPG +  W  D RY+ K
Sbjct:    1 MAAVEDLVQTPNKI--EVRFEGDENTYRGNWSNKMDFVLSCIGLAVGLGNLWRFPYLCYKNGGGAFLIPYFTMLIVAGIPLFYFELSLGQFSSSGFLTVWKIQPMFKGIGFAMLIISIISSIYYNVIIAWSLYYLFASFTSKLPWSDCNNEWNDELCLINFKNVTTAVCSSELTINCTKYEVPAEQYWQRVVLGVVNYAGDQRPMEPYLGTVQWHLSLCLLLAWIICGASLIKGVKSSGKVVYFTAIFPYFVIVIMVINGCLLEGSLEGIKYYLIPKWSKLLEAGVWGDAATQIFYSLSVGFGGLLTMASYNKFNNNCYRDALMVSIINCATSFVAGFAIFSVLGYMSVKTGRSVAETTTSGTGLAFVVYAQGVATMPYSPIWSILFFAMLLTLGIDSQFGGMEAIFTGFQDQFPILKKTHFHDFSFKIIFQIILFFLGLPCVSKGGIYMVTLMDEYCGSFSLIIIAFLELTIISFIYGIKNYVQDIEMMLKFKPGYYWIICWTALTPIVIIFILIVSIIQHAPSSYNGVLLPKWANQLGGVIAASSISAVPIYFFYHAIFKGFSFKPDEKWGPGVEKFWHDDIRYSRK 587          
BLAST of slc6a-5 vs. Planmine SMEST
Match: SMESG000042051.1 (SMESG000042051.1)

HSP 1 Score: 672.544 bits (1734), Expect = 0.000e+0
Identity = 337/445 (75.73%), Postives = 388/445 (87.19%), Query Frame = 1
Query:   55 MASVEDSSKTNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHXXXXXXXXXXXXXXXXXKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSK 1389
            MA+VED  +T  +   EV  +  + T RGNWS + DFFLSCVGYAVGLGNLWRFPHLCY +GGGAFL+PYF ML+IAGIP+FYFEL+LGQFSSSG +++WK+QPMFKGIG++ML+++ I S+YYNVIIAWSLYYLFASFTSKLPWSDCNN WNDE CL DF+N T   CS+  T NC +YEVAAEQYW++VVLGV +YAG+ RPMEP+LG VQWHL LCLLLAWIICGA LIKGVKSSGKVVYFTAIFPY VI+IMV+NGCLL GS  GI+YYLIPKW KLL  +VW DAATQIFYSLGVAFGGLMTM+SYNKFNNNCYRDAL+VS+INC TSF+AGFAIF+VLGYM+ +TGR++ +TTTSG+GLAFVAYAQ ++TM  +P+WSILFF MLLTLGIDSQFGGMEAIFTG QD+FPILKKTHF D +FKI  QIILFFLG+ CVSK
Sbjct:    1 MAAVEDLVQTPNK---EVRFEGDENTYRGNWSSKMDFFLSCVGYAVGLGNLWRFPHLCYKNGGGAFLIPYFTMLIIAGIPLFYFELSLGQFSSSGFLTVWKIQPMFKGIGFAMLVISIICSIYYNVIIAWSLYYLFASFTSKLPWSDCNNEWNDELCLNDFKNVTNVVCSSFRTTNCTKYEVAAEQYWQRVVLGVVNYAGDQRPMEPYLGTVQWHLSLCLLLAWIICGASLIKGVKSSGKVVYFTAIFPYFVIVIMVINGCLLEGSLEGIKYYLIPKWSKLLEARVWGDAATQIFYSLGVAFGGLMTMASYNKFNNNCYRDALMVSIINCATSFVAGFAIFAVLGYMSVKTGRSVAETTTSGTGLAFVAYAQGVATMPYSPIWSILFFGMLLTLGIDSQFGGMEAIFTGFQDQFPILKKTHFHDFSFKIIFQIILFFLGLPCVSK 442          
The following BLAST results are available for this feature:
BLAST of slc6a-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC6A51.356e-17446.21solute carrier family 6 member 5 [Source:HGNC Symb... [more]
SLC6A71.243e-16247.85solute carrier family 6 member 7 [Source:HGNC Symb... [more]
SLC6A93.609e-16242.86solute carrier family 6 member 9 [Source:HGNC Symb... [more]
SLC6A73.871e-16247.85solute carrier family 6 member 7 [Source:HGNC Symb... [more]
SLC6A96.036e-16143.58solute carrier family 6 member 9 [Source:HGNC Symb... [more]
back to top
BLAST of slc6a-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dat-18.245e-15745.86Sodium-dependent dopamine transporter [Source:Uni... [more]
mod-51.253e-14041.87Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7][more]
snf-31.094e-12837.65Sodium- and chloride-dependent betaine transporter... [more]
snf-118.785e-12537.41Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43][more]
snf-63.232e-9732.21Sodium-dependent acetylcholine transporter [Sourc... [more]
back to top
BLAST of slc6a-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DAT2.357e-16043.28gene:FBgn0034136 transcript:FBtr0087125[more]
DAT3.472e-16043.28gene:FBgn0034136 transcript:FBtr0330002[more]
SerT2.011e-15042.71gene:FBgn0010414 transcript:FBtr0072362[more]
SerT2.011e-15042.71gene:FBgn0010414 transcript:FBtr0343316[more]
GlyT1.102e-14541.90gene:FBgn0034911 transcript:FBtr0301162[more]
back to top
BLAST of slc6a-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a53.501e-16745.25solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a53.899e-16745.25solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a54.390e-16745.25solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a25.952e-16345.49solute carrier family 6 member 2 [Source:ZFIN;Acc:... [more]
slc6a25.952e-16345.49solute carrier family 6 member 2 [Source:ZFIN;Acc:... [more]
back to top
BLAST of slc6a-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxd41.616e-16842.74MAX dimerization protein 4 [Source:Xenbase;Acc:XB-... [more]
lrrc4c3.083e-16746.19leucine rich repeat containing 4C [Source:Xenbase;... [more]
lrrc4c3.282e-16746.19leucine rich repeat containing 4C [Source:Xenbase;... [more]
lrrc4c3.897e-16746.19leucine rich repeat containing 4C [Source:Xenbase;... [more]
mxd44.284e-16743.16MAX dimerization protein 4 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of slc6a-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc6a54.248e-17546.36solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a54.248e-17546.36solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a54.248e-17546.36solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a74.804e-16548.22solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a91.517e-16243.65solute carrier family 6 (neurotransmitter transpor... [more]
back to top
BLAST of slc6a-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q761V0|SC6A5_MOUSE4.441e-17446.36Sodium- and chloride-dependent glycine transporter... [more]
sp|Q9Y345|SC6A5_HUMAN6.510e-17446.21Sodium- and chloride-dependent glycine transporter... [more]
sp|P58295|SC6A5_RAT5.979e-17346.02Sodium- and chloride-dependent glycine transporter... [more]
sp|A7Y2X0|SC6A5_XENLA2.484e-16544.54Sodium- and chloride-dependent glycine transporter... [more]
sp|P28573|SC6A7_RAT3.948e-16548.41Sodium-dependent proline transporter OS=Rattus nor... [more]
back to top
BLAST of slc6a-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YEX40.000e+0100.00Slc6a-5 OS=Schmidtea mediterranea OX=79327 GN=slc6... [more]
A0A1I8J6K10.000e+050.93Transporter OS=Macrostomum lignano OX=282301 GN=BO... [more]
A0A267F8N60.000e+050.25Transporter OS=Macrostomum lignano OX=282301 GN=BO... [more]
A0A1I8GER90.000e+050.25Transporter OS=Macrostomum lignano OX=282301 GN=BO... [more]
A0A267EM660.000e+048.46Transporter OS=Macrostomum lignano OX=282301 GN=BO... [more]
back to top
BLAST of slc6a-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a92.259e-16044.10solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a95.502e-16043.67solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a144.298e-15844.78solute carrier family 6 member 14 [Source:NCBI gen... [more]
slc6a38.719e-15842.55solute carrier family 6 member 3 [Source:NCBI gene... [more]
slc6a71.273e-15646.92sodium-dependent proline transporter-like [Source:... [more]
back to top
BLAST of slc6a-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a1a1.199e-14741.74solute carrier family 6 member 1a [Source:ZFIN;Acc... [more]
slc6a4b8.512e-13242.77solute carrier family 6 member 4b [Source:ZFIN;Acc... [more]
ENSPMAT00000008631.14.793e-10539.03pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 ... [more]
ENSPMAT00000004857.11.171e-8043.30pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 ... [more]
ENSPMAT00000001684.11.163e-7450.20pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 ge... [more]
back to top
BLAST of slc6a-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc6a-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO397077.824e-15542.68Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977][more]
EDO315451.747e-15243.04Transporter [Source:UniProtKB/TrEMBL;Acc:A7SXK0][more]
EDO492181.721e-14742.18Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4][more]
EDO323563.845e-14241.51Transporter [Source:UniProtKB/TrEMBL;Acc:A7SVA2][more]
EDO397088.444e-13943.26Transporter [Source:UniProtKB/TrEMBL;Acc:A7S978][more]
back to top
BLAST of slc6a-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a52.257e-16344.37solute carrier family 6 member 5 [Source:NCBI gene... [more]
slc6a91.667e-16042.72solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a75.403e-16046.64sodium-dependent proline transporter [Source:NCBI ... [more]
slc6a91.453e-15944.35solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a91.453e-15944.35solute carrier family 6 member 9 [Source:NCBI gene... [more]
back to top
BLAST of slc6a-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042091.10.000e+099.67SMESG000042091.1[more]
SMESG000042091.10.000e+099.50SMESG000042091.1[more]
SMESG000042051.10.000e+070.12SMESG000042051.1[more]
SMESG000042086.10.000e+067.91SMESG000042086.1[more]
SMESG000042051.10.000e+075.73SMESG000042051.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30034376
GenBankAKN21425.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034376 ID=SMED30034376|Name=slc6a-5|organism=Schmidtea mediterranea sexual|type=transcript|length=1999bp
GTTTGTTTGTATGTGAATAACTTCAAATTTAAAAAAATCTATTTTTAATC
GAGAATGGCATCAGTTGAAGATTCTTCTAAAACTAACGAACAAGTGATCA
GTGAAGTGGATTCTCAGACTCCTAAAACTACCGCTCGTGGAAATTGGTCC
GGAAGATTTGATTTTTTTCTTTCTTGTGTTGGGTATGCAGTTGGATTAGG
AAATTTATGGAGATTTCCCCACTTATGTTATATACACGGAGGAGGAGCAT
TTCTTGTTCCGTACTTCATCATGCTTTTAATAGCTGGAATACCAATATTT
TATTTTGAATTAGCACTCGGTCAGTTTTCGAGTTCTGGGCCAATTTCGAT
TTGGAAAGTGCAACCAATGTTTAAAGGAATTGGTTATTCAATGCTAATAG
TTGCAACAATAGTTTCTGTTTATTACAATGTAATTATAGCTTGGTCTCTT
TACTATTTATTTGCTTCATTTACCTCAAAACTACCATGGTCAGACTGTAA
TAATGCTTGGAATGACGAAAGATGTCTCACTGATTTTAGAAACAAAACAA
TTTCAAACTGTTCAACACTAAATACCCAAAACTGCATTGAATATGAAGTA
GCAGCGGAACAGTATTGGAAAAAAGTGGTTTTAGGAGTCGAAGACTACGC
AGGTAATTTAAGACCAATGGAACCTTTTCTTGGCCCCGTTCAGTGGCATT
TATGCTTATGCCTGTTGCTAGCTTGGATAATCTGTGGAGCTTGTTTAATT
AAAGGAGTTAAATCCTCTGGAAAGGTGGTTTACTTTACAGCTATTTTCCC
GTACGTTGTCATCATTATTATGGTGGTAAATGGTTGCTTATTATCTGGGT
CTAAAATAGGGATTCAATATTATTTGATACCAAAATGGAAAAAACTATTA
TCTATACAAGTTTGGAGAGACGCTGCTACTCAGATTTTCTATTCACTTGG
AGTCGCCTTCGGAGGTCTTATGACGATGTCCAGTTACAATAAATTTAATA
ATAATTGTTACAGAGATGCTCTTCTAGTTTCTGTTATCAATTGTTTGACA
AGTTTTCTAGCTGGTTTTGCAATATTTTCTGTTCTTGGATATATGGCACA
TCAGACCGGTAGAGCTATTGAACAAACTACTACCAGTGGAAGTGGTTTAG
CGTTTGTGGCGTATGCTCAAAGTTTGTCAACAATGAAGGTAGCCCCACTG
TGGTCAATTCTATTCTTTCTAATGCTGTTGACGTTGGGCATTGATTCACA
ATTTGGAGGAATGGAGGCAATTTTTACAGGTCTCCAAGACGAATTTCCTA
TATTGAAAAAGACTCATTTTATTGATATTGCTTTTAAAATTTCAGTGCAA
ATTATATTATTCTTCCTTGGTATTACTTGTGTTTCTAAAGGAGGAATATA
TATGTTTTCTATAATGGATGAATACAGTGGGACCTTCACATTACAGATCA
TTGCGATTTTTGAGTTGATTACAATAATGTATTTATATGGTGTTAAAAAT
TTTATGAAAGATATCAAGATGATGCTAGGATTCAAGCCAGGGTATTACTG
GGTAGCGTGCTGGATGGTAGTGACCCCATTAACAATAATATTCATCCTGA
TTTTAAGCTTCATGTATCACACGCCAACAAAATTTGGAAACTATATATTG
CCAGTCTGGGCAAACGTCCTAGGGTATTTGATGACCCTTGTCGGTGTCAT
TAATATTGTTGTATATTTCATATATTATGCAATTTTTAAAGGAGTAACCA
AAACACCAAAAGATAGTTGGGGACCTGGAAATAAAGCTGACTGGGAGATT
GACGACCGGTATGCTGTCAAATCGAGCCCATGCGACAATGATAAAATGGA
TTCAACCAGCTTCTAAAGAAAAAAAATTATAAATACAAGATTTAATATAT
TTCTGAAAATTTAAATATTAACATTAATTTTTATTTTATTATGTTTTTTG
ATCATTATTAATTTATTTAATTAAAAGAAATAAAACATTTCATATTTTG
back to top

protein sequence of SMED30034376-orf-1

>SMED30034376-orf-1 ID=SMED30034376-orf-1|Name=SMED30034376-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=604bp
MASVEDSSKTNEQVISEVDSQTPKTTARGNWSGRFDFFLSCVGYAVGLGN
LWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIW
KVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNN
AWNDERCLTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAG
NLRPMEPFLGPVQWHLCLCLLLAWIICGACLIKGVKSSGKVVYFTAIFPY
VVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGV
AFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQ
TGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQF
GGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYM
FSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLGFKPGYYWV
ACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLVGVIN
IVVYFIYYAIFKGVTKTPKDSWGPGNKADWEIDDRYAVKSSPCDNDKMDS
TSF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015293symporter activity
GO:0005328neurotransmitter:sodium symporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006836neurotransmitter transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000047collecting duct
PLANA:0000070intestinal phagocyte
PLANA:0000087proximal tubule
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR037272SNS_sf
IPR000175Na/ntran_symport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000175Sodium:neurotransmitter symporterPRINTSPR00176NANEUSMPORTcoord: 108..134
score: 44.14
coord: 323..343
score: 52.93
coord: 377..396
score: 56.72
coord: 500..520
score: 29.04
coord: 36..57
score: 66.99
coord: 241..258
score: 53.28
coord: 65..84
score: 54.92
coord: 460..480
score: 30.52
IPR000175Sodium:neurotransmitter symporterPFAMPF00209SNFcoord: 28..558
e-value: 1.1E-201
score: 671.1
IPR000175Sodium:neurotransmitter symporterPANTHERPTHR11616SODIUM/CHLORIDE DEPENDENT TRANSPORTERcoord: 8..565
IPR000175Sodium:neurotransmitter symporterPROSITEPS50267NA_NEUROTRAN_SYMP_3coord: 27..564
score: 96.143
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..25
NoneNo IPR availablePANTHERPTHR11616:SF231SODIUM-DEPENDENT PROLINE TRANSPORTERcoord: 8..565
NoneNo IPR availableTMHMMTMhelixcoord: 497..519
NoneNo IPR availableTMHMMTMhelixcoord: 290..312
NoneNo IPR availableTMHMMTMhelixcoord: 429..451
NoneNo IPR availableTMHMMTMhelixcoord: 212..234
NoneNo IPR availableTMHMMTMhelixcoord: 325..347
NoneNo IPR availableTMHMMTMhelixcoord: 461..480
NoneNo IPR availableTMHMMTMhelixcoord: 108..130
NoneNo IPR availableTMHMMTMhelixcoord: 241..263
NoneNo IPR availableTMHMMTMhelixcoord: 66..88
NoneNo IPR availableTMHMMTMhelixcoord: 37..56
NoneNo IPR availableTMHMMTMhelixcoord: 539..561
NoneNo IPR availableTMHMMTMhelixcoord: 379..396
IPR037272Sodium:neurotransmitter symporter superfamilySUPERFAMILYSSF161070SNF-likecoord: 28..558