SMED30034375

Overview
NameSMED30034375
Smed IDSMED30034375
Length (bp)2337
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30034375 (SMED30034375) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30034375 (SMED30034375) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30034375 (SMED30034375) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30034375 (SMED30034375) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034375

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30034375SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 Contig45405uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034375SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 Contig45405newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034375SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 Contig41392uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034375SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 Contig41392newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034375SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017519.1 Contig14476uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034375SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017519.1 Contig14476newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30034375SMESG000045684.1 SMESG000017522.1 dd_Smed_v4_18010_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034375SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017519.1 Contig14354uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034375SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017519.1 Contig14354newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30034375SMESG000045684.1 SMESG000017522.1 dd_Smed_v6_18010_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
intestinal phagocyteSMED30034375SMESG000029570.1 SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017517.1 SMESG000017519.1 dd_Smed_v6_6577_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30034375SMESG000029570.1 SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017517.1 SMESG000017519.1 dd_Smed_v6_6577_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30034375SMESG000029570.1 SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017517.1 SMESG000017519.1 dd_Smed_v6_6577_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30034375 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.013837:3978..9878 -11459
v31.013837:9879..15906 -4935
Homology
BLAST of SMED30034375 vs. Planmine SMEST
Match: SMESG000045684.1 (SMESG000045684.1)

HSP 1 Score: 1422.53 bits (3681), Expect = 0.000e+0
Identity = 750/779 (96.28%), Postives = 752/779 (96.53%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIKEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNNFNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETXXXXXXXXXXXXXXXXAFLLNTVNKEVNKEQAFYIQNLKLKIDQAKERLEEIQEIIGNDQWNKWFNVWFRRRESNISPPAKEENRSILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2337
            IVQRKPTDPEIEELCEDSSNKEVNMKIL KAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIKEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNNFNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETIKSILKDKIKIIDDVDAFLLNTVNKEVNKEQAFYIQNLKLKIDQAKERLEE                        ISPPAKEENRSILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENK+EMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIE KILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKN+EEETNPKCFA
Sbjct: 1235 IVQRKPTDPEIEELCEDSSNKEVNMKILYKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIKEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNNFNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETIKSILKDKIKIIDDVDAFLLNTVNKEVNKEQAFYIQNLKLKIDQAKERLEE------------------------ISPPAKEENRSILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKEEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIERKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNMEEETNPKCFA 1989          

HSP 2 Score: 741.88 bits (1914), Expect = 0.000e+0
Identity = 435/789 (55.13%), Postives = 566/789 (71.74%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKI---KEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNN---FNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETXXXXXXXXXXXXXXXXAFLLNTVNK----EVNKEQAFYIQNLKLKIDQAKERLEEIQEIIGNDQWNKWFNVWFRRRESNISPPAKEENRSILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2337
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEK+SI   F+KG I  E + + L  +KD+F G ++E +++   G++I EA+   +  +   E L+ID+K FTI +VSKI    E   Y T I   +++  LNQL+  + +G++T   ++  KN+++   F +TIFE++MNG L+ DEL I+D    EMCS++  VERGL+DV+ A ++LD +ES++F ELI   I+D+ NN F   LSL+EA+E  L+RPE+VYL+L KENK++NLSKMIE GMLN   N ++ + S+ EII MKLNEA+  EN IL++ +N +++K++ P  + + +D ++I+   +++ F  S+I+ + I++AL++ L+  E LV      ++N++  I Y G      L+N LNE  K +  Y+  L     +I          IL++K++ +   D   + TV +    ++   +   ++NLK+K ++ +E ++E++    ND  + WF V F  R  +I          +     IS + ++ TII+GVK   +D+I+ I +A+K  +I++E QT + +    D+MSWK AI E  MIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSK LIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  460 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCKENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIV-FKESEIQQMTINDALEQNLVNEECLV-----CYDNKLAAISYYGDKNLLHLLNMLNELAKALKEYIFALDTDKDDI------KAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEEVEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCE--AISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKDLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 1234          

HSP 3 Score: 429.098 bits (1102), Expect = 3.364e-130
Identity = 231/456 (50.66%), Postives = 322/456 (70.61%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIK---EEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNN---FNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGE 1350
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEK+SI   F+KG I  E + + L  +KD+F G ++E +++   G++I EA+   +  +   E L+ID+K FTI +VSKI    E   Y T I   +++  LNQL+  + +G++T   ++  KN+++   F +TIFE++MNG L+ DEL I+D    EMCS++  VERGL+DV+ A ++LD +ES++F ELI   I+D+ NN F   LSL+EA+E  L+RPE+VYL+L +ENK++NLSKMIE GMLN   N ++ + S+ EII MKLNEA+  EN IL++ +N +++K  FP  L + ++ + ++ ++D+I F   KI+P+ I + LK +LL  ES VKL   + E  +  +EYCG +E A L+N+LNE    +   L  +++ +GE
Sbjct: 1990 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELL--MSLKNGE 2443          

HSP 4 Score: 394.815 bits (1013), Expect = 2.006e-118
Identity = 211/228 (92.54%), Postives = 219/228 (96.05%), Query Frame = 1
Query: 1654 SGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2337
            S +E++ T+I G + Q ++EIL I EAIKENLINVEYQTCRC+RENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  232 SENEDSRTVIFGWQNQMNNEILGINEAIKENLINVEYQTCRCDRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 459          
BLAST of SMED30034375 vs. Planmine SMEST
Match: SMESG000045684.1 (SMESG000045684.1)

HSP 1 Score: 1421.37 bits (3678), Expect = 0.000e+0
Identity = 750/779 (96.28%), Postives = 752/779 (96.53%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIKEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNNFNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETXXXXXXXXXXXXXXXXAFLLNTVNKEVNKEQAFYIQNLKLKIDQAKERLEEIQEIIGNDQWNKWFNVWFRRRESNISPPAKEENRSILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2337
            IVQRKPTDPEIEELCEDSSNKEVNMKIL KAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIKEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNNFNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETIKSILKDKIKIIDDVDAFLLNTVNKEVNKEQAFYIQNLKLKIDQAKERLEE                        ISPPAKEENRSILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENK+EMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIE KILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKN+EEETNPKCFA
Sbjct: 1191 IVQRKPTDPEIEELCEDSSNKEVNMKILYKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIKEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNNFNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETIKSILKDKIKIIDDVDAFLLNTVNKEVNKEQAFYIQNLKLKIDQAKERLEE------------------------ISPPAKEENRSILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKEEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIERKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNMEEETNPKCFA 1945          

HSP 2 Score: 741.11 bits (1912), Expect = 0.000e+0
Identity = 435/789 (55.13%), Postives = 566/789 (71.74%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKI---KEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNN---FNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETXXXXXXXXXXXXXXXXAFLLNTVNK----EVNKEQAFYIQNLKLKIDQAKERLEEIQEIIGNDQWNKWFNVWFRRRESNISPPAKEENRSILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2337
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEK+SI   F+KG I  E + + L  +KD+F G ++E +++   G++I EA+   +  +   E L+ID+K FTI +VSKI    E   Y T I   +++  LNQL+  + +G++T   ++  KN+++   F +TIFE++MNG L+ DEL I+D    EMCS++  VERGL+DV+ A ++LD +ES++F ELI   I+D+ NN F   LSL+EA+E  L+RPE+VYL+L KENK++NLSKMIE GMLN   N ++ + S+ EII MKLNEA+  EN IL++ +N +++K++ P  + + +D ++I+   +++ F  S+I+ + I++AL++ L+  E LV      ++N++  I Y G      L+N LNE  K +  Y+  L     +I          IL++K++ +   D   + TV +    ++   +   ++NLK+K ++ +E ++E++    ND  + WF V F  R  +I          +     IS + ++ TII+GVK   +D+I+ I +A+K  +I++E QT + +    D+MSWK AI E  MIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSK LIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  416 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCKENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIV-FKESEIQQMTINDALEQNLVNEECLV-----CYDNKLAAISYYGDKNLLHLLNMLNELAKALKEYIFALDTDKDDI------KAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEEVEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCE--AISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKDLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 1190          

HSP 3 Score: 428.713 bits (1101), Expect = 4.097e-130
Identity = 231/456 (50.66%), Postives = 322/456 (70.61%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIK---EEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNN---FNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGE 1350
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEK+SI   F+KG I  E + + L  +KD+F G ++E +++   G++I EA+   +  +   E L+ID+K FTI +VSKI    E   Y T I   +++  LNQL+  + +G++T   ++  KN+++   F +TIFE++MNG L+ DEL I+D    EMCS++  VERGL+DV+ A ++LD +ES++F ELI   I+D+ NN F   LSL+EA+E  L+RPE+VYL+L +ENK++NLSKMIE GMLN   N ++ + S+ EII MKLNEA+  EN IL++ +N +++K  FP  L + ++ + ++ ++D+I F   KI+P+ I + LK +LL  ES VKL   + E  +  +EYCG +E A L+N+LNE    +   L  +++ +GE
Sbjct: 1946 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELL--MSLKNGE 2399          

HSP 4 Score: 394.43 bits (1012), Expect = 2.695e-118
Identity = 211/228 (92.54%), Postives = 219/228 (96.05%), Query Frame = 1
Query: 1654 SGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2337
            S +E++ T+I G + Q ++EIL I EAIKENLINVEYQTCRC+RENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  188 SENEDSRTVIFGWQNQMNNEILGINEAIKENLINVEYQTCRCDRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 415          
BLAST of SMED30034375 vs. Planmine SMEST
Match: SMESG000017522.1 (SMESG000017522.1)

HSP 1 Score: 1414.44 bits (3660), Expect = 0.000e+0
Identity = 746/775 (96.26%), Postives = 748/775 (96.52%), Query Frame = 1
Query:   13 KPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIKEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNNFNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETXXXXXXXXXXXXXXXXAFLLNTVNKEVNKEQAFYIQNLKLKIDQAKERLEEIQEIIGNDQWNKWFNVWFRRRESNISPPAKEENRSILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2337
            KPTDPEIEELCEDSSNKEVNMKIL KAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIF+GVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIKEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNNFNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETIKSILKDKIKIIDDVDAFLLNTVNKEVNKEQAFYIQNLKLKIDQAKERLEE                        ISPPAKEENRSILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENK+EMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIE KILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct: 1520 KPTDPEIEELCEDSSNKEVNMKILYKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFIGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIKEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNNFNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETIKSILKDKIKIIDDVDAFLLNTVNKEVNKEQAFYIQNLKLKIDQAKERLEE------------------------ISPPAKEENRSILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKEEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIERKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 2270          

HSP 2 Score: 696.812 bits (1797), Expect = 0.000e+0
Identity = 414/768 (53.91%), Postives = 544/768 (70.83%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKI---KEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNN---FNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETXXXXXXXXXXXXXXXXAFLLNTVNK----EVNKEQAFYIQNLKLKIDQAKERLEEIQEIIGNDQWNKWFNVWFRRRESNISPPAKEENRSILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIM 2274
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEK+SI   F+KG I  E + + L  +KD+F G ++E +++   G++I EA+   +  +   E L+ID+K FTI +VSKI    E   Y T I   +++  LNQL+  + +G++T   ++  KN+++   F +TIFE++MNG L+ DEL I+D    EMCS++  VERGL+DV+ A ++LD +ES++F ELI   I+D+ NN F   LSL+EA+E  L+RPE+VYL+L KENK++NLSKMIE GMLN   N ++ + S+ EII MKLNEA+  EN IL++ +N +++K++ P  + + +D ++I+   +++ F  S+I+ + I++AL++ L+  E LV      ++N++  I Y        L+N LNE  K +  Y+  L     +I          IL++K++ +   D   + TV +    ++   +   ++NLK+K ++A+E + E++    ND  + WF V F  R  +I          +     IS + ++ TII+GVK   +D+I+ I +A+K  +I++E QT + +    D+MSWK AI E  MIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSK LIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIM
Sbjct:  766 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCKENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIV-FKESEIQQMTINDALEQNLVNEECLV-----CYDNKLAAISYYADKNLLHLLNMLNELAKALKEYIFALDTDKDDI------KAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEEAEELMNEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCE--AISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKDLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIM 1519          

HSP 3 Score: 427.557 bits (1098), Expect = 9.946e-130
Identity = 231/456 (50.66%), Postives = 322/456 (70.61%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIK---EEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNN---FNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGE 1350
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEK+SI   F+KG I  E + + L  +KD+F G ++E +++   G++I EA+   +  +   E L+ID+K FTI +VSKI    E   Y T I   +++  LNQL+  + +G++T   ++  KN+++   F +TIFE++MNG L+ DEL I+D    EMCS++  VERGL+DV+ A ++LD +ES++F ELI   I+D+ NN F   LSL+EA+E  L+RPE+VYL+L +ENK++NLSKMIE GMLN   N ++ + S+ EII MKLNEA+  EN IL++ +N +++K  FP  L + ++ + ++ ++D+I F   KI+P+ I + LK +LL  ES VKL   + E  +  +EYCG +E A L+N+LNE    +   L  +++ +GE
Sbjct: 2271 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELL--MSLKNGE 2724          

HSP 4 Score: 393.275 bits (1009), Expect = 5.562e-118
Identity = 211/228 (92.54%), Postives = 218/228 (95.61%), Query Frame = 1
Query: 1654 SGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2337
            S +E++ T+I G + Q ++EIL I EAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSK LIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  538 SENEDSRTVIFGWQNQMNNEILGINEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKDLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 765          
BLAST of SMED30034375 vs. Planmine SMEST
Match: SMESG000017522.1 (SMESG000017522.1)

HSP 1 Score: 1414.44 bits (3660), Expect = 0.000e+0
Identity = 746/775 (96.26%), Postives = 748/775 (96.52%), Query Frame = 1
Query:   13 KPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIKEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNNFNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETXXXXXXXXXXXXXXXXAFLLNTVNKEVNKEQAFYIQNLKLKIDQAKERLEEIQEIIGNDQWNKWFNVWFRRRESNISPPAKEENRSILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2337
            KPTDPEIEELCEDSSNKEVNMKIL KAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIF+GVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIKEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNNFNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETIKSILKDKIKIIDDVDAFLLNTVNKEVNKEQAFYIQNLKLKIDQAKERLEE                        ISPPAKEENRSILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENK+EMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIE KILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct: 1425 KPTDPEIEELCEDSSNKEVNMKILYKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFIGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIKEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNNFNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETIKSILKDKIKIIDDVDAFLLNTVNKEVNKEQAFYIQNLKLKIDQAKERLEE------------------------ISPPAKEENRSILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKEEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIERKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 2175          

HSP 2 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 414/768 (53.91%), Postives = 544/768 (70.83%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKI---KEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNN---FNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETXXXXXXXXXXXXXXXXAFLLNTVNK----EVNKEQAFYIQNLKLKIDQAKERLEEIQEIIGNDQWNKWFNVWFRRRESNISPPAKEENRSILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIM 2274
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEK+SI   F+KG I  E + + L  +KD+F G ++E +++   G++I EA+   +  +   E L+ID+K FTI +VSKI    E   Y T I   +++  LNQL+  + +G++T   ++  KN+++   F +TIFE++MNG L+ DEL I+D    EMCS++  VERGL+DV+ A ++LD +ES++F ELI   I+D+ NN F   LSL+EA+E  L+RPE+VYL+L KENK++NLSKMIE GMLN   N ++ + S+ EII MKLNEA+  EN IL++ +N +++K++ P  + + +D ++I+   +++ F  S+I+ + I++AL++ L+  E LV      ++N++  I Y        L+N LNE  K +  Y+  L     +I          IL++K++ +   D   + TV +    ++   +   ++NLK+K ++A+E + E++    ND  + WF V F  R  +I          +     IS + ++ TII+GVK   +D+I+ I +A+K  +I++E QT + +    D+MSWK AI E  MIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSK LIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIM
Sbjct:  671 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCKENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIV-FKESEIQQMTINDALEQNLVNEECLV-----CYDNKLAAISYYADKNLLHLLNMLNELAKALKEYIFALDTDKDDI------KAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEEAEELMNEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCE--AISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKDLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIM 1424          

HSP 3 Score: 427.943 bits (1099), Expect = 7.731e-130
Identity = 231/456 (50.66%), Postives = 322/456 (70.61%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIK---EEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNN---FNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGE 1350
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEK+SI   F+KG I  E + + L  +KD+F G ++E +++   G++I EA+   +  +   E L+ID+K FTI +VSKI    E   Y T I   +++  LNQL+  + +G++T   ++  KN+++   F +TIFE++MNG L+ DEL I+D    EMCS++  VERGL+DV+ A ++LD +ES++F ELI   I+D+ NN F   LSL+EA+E  L+RPE+VYL+L +ENK++NLSKMIE GMLN   N ++ + S+ EII MKLNEA+  EN IL++ +N +++K  FP  L + ++ + ++ ++D+I F   KI+P+ I + LK +LL  ES VKL   + E  +  +EYCG +E A L+N+LNE    +   L  +++ +GE
Sbjct: 2176 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELL--MSLKNGE 2629          

HSP 4 Score: 393.275 bits (1009), Expect = 5.548e-118
Identity = 211/228 (92.54%), Postives = 218/228 (95.61%), Query Frame = 1
Query: 1654 SGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2337
            S +E++ T+I G + Q ++EIL I EAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSK LIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  443 SENEDSRTVIFGWQNQMNNEILGINEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKDLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 670          
BLAST of SMED30034375 vs. Planmine SMEST
Match: SMESG000017520.1 (SMESG000017520.1)

HSP 1 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 469/788 (59.52%), Postives = 585/788 (74.24%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIK---EEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNN---FNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGE---ILPNNEETXXXXXXXXXXXXXXXXAFLLNTVNKEVNKEQAFYIQNLKLKIDQAKERLEEIQEIIGNDQWNKWFNVWFRRRESNISPPAKEENRSILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2337
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEK+SI   F+KG I  E + + L  +KD+F G ++E +++   G++I EA+   +  +   E L+ID+K FTI +VSKI    E   Y T I   +++  LNQL+  + +G++T   ++  KN+++   F +TIFE++MNG L+ DEL I+D    EMCS++  VERGL+DV+ A ++LD +ES++F ELI   I+D+ NN F   LSL+EA+E  L+RPE+VYL+L +ENK++NLSKMIE GMLN   N ++ + S+ EII MKLNEA+  EN IL++ +N +++K  FP  L + ++ + ++ ++D+I F   KI+P+ I + LK +LL  ES+VKL   + E  +  +EYCG +E A L+N+LNE    +   L  +++ +GE   ++   E ++ S L  ++ + D ++A L    +     E    ++ L  K DQ K  L EI +    D++   F V       N+          ++    +SG+E  +TIII VKLQ+DD+ILCI+EAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  886 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESMVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELL--MSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKFLLSEINDQKNCDKFQNLFAVHIGANFQNLLENVG--ITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIKEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 1669          

HSP 2 Score: 825.854 bits (2132), Expect = 0.000e+0
Identity = 466/788 (59.14%), Postives = 583/788 (73.98%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIK---EEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNN---FNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGE---ILPNNEETXXXXXXXXXXXXXXXXAFLLNTVNKEVNKEQAFYIQNLKLKIDQAKERLEEIQEIIGNDQWNKWFNVWFRRRESNISPPAKEENRSILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2337
            IVQRKPTD EI+ELCEDSSNKEVNMKILC+AIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEK+SI   F+KG I  E + + L  +KD+F G ++E +++   G++I EA+   +  +   E L+ID+K FTI +VSKI    E   Y T I   +++  LNQL++ + +G++T   ++  KN+++   F +TIFE++MNG L+ DEL I+D    EMCS++  VERGL+DV+ A ++LD +ES++F ELI   I+D+ NN F   LSL+EA+E  L+RPE+VYL+L +ENK++NLSKMIE GMLN   N ++ + S+ EII MKLNEA+  EN IL++ +N +++K  FP  L + ++ + ++ ++D+I F   KI+P+ I + LK +LL  ES VKL   + E  +  +EYCG +E A L+N+LNE    +   L  +++ +GE   ++   E ++ S L  ++ + D ++A L    +     E    ++ L  K DQ K  L EI +    D+    F V       N+          ++    +SG+E  +TIII VKLQ+DD+ILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDEL KGLIPLR+AIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct: 1670 IVQRKPTDLEIKELCEDSSNKEVNMKILCRAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHMKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRFFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELL--MSLKNGENEDVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKLKNLFAVHIGANFQNLLENVG--ITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELLKGLIPLRKAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 2453          

HSP 3 Score: 423.705 bits (1088), Expect = 2.081e-128
Identity = 231/287 (80.49%), Postives = 245/287 (85.37%), Query Frame = 1
Query: 1477 IQNLKLKIDQAKERLEEIQEIIGNDQWNKWFNVWFRRRESNISPPAKEENRSILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2337
            ++ L  K DQ K  L EI +    D++  WF V       N+          ++    +SG+E  +TIII VKLQ+DD+ILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDEL KGLIPLR+AIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  601 VKVLNAKFDQVKSLLAEINDQKNCDKFQNWFAVHIGANFQNLLENVG--ITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELLKGLIPLRKAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 885          

HSP 4 Score: 395.201 bits (1014), Expect = 1.560e-118
Identity = 208/400 (52.00%), Postives = 288/400 (72.00%), Query Frame = 1
Query:   16 PTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIK---EEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNN---FNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRES 1197
            PTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEK+SI   F+KG I  E + + L  +KD+F G ++E +++   G++I EA+   +  +   E L+ID+K FTI +VSKI    E   Y T I   +++  LNQL+  + +G++T   ++  KN+++   F +TIFE++MNG L+ DEL I+D    EMCS++  VERGL+DV+ A ++LD +ES++F ELI   I+D+ NN F   LSL+EA+E  L+RPE+VYL+L +ENK++NLSKMIE GMLN   N ++ + S+ EII MKLNEA+  EN IL++ +N +++K  FP  L + ++ + ++ ++D+I F   KI+P+ I + LK +LL  ES
Sbjct:  170 PTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEES 569          

HSP 5 Score: 394.43 bits (1012), Expect = 2.462e-118
Identity = 211/410 (51.46%), Postives = 290/410 (70.73%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKI---KEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNN---FNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLT 1212
            IVQRKPTD EIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEK+SI   F+KG I  E + + L  +KD+F G ++E +++   G++I EA+   +  +   E L+ID+K FTI +VSKI    E   Y T I   +++  LNQL+  + +G++T   ++  KN+++   F +TIFE++MNG L+ DEL I+D    EMCS++  VERGL+DV+ A ++LD +ES++F ELI   I+D+ NN F   LSL+EA+E  L+RPE+VYL+L +ENK +NLSKMIE GMLN   N ++ + S  EII MKLNEA+  EN IL++ +N +++K  FP  L + ++   ID ++D+I F    +  + + +A+++KL   ES V +T
Sbjct: 2454 IVQRKPTDLEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKEINLSKMIECGMLNASENLVKIEKSNGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLENGEIDVNRDLICFVGKTVLEVNVKDAIEQKLASLESFVMVT 2863          

HSP 6 Score: 310.842 bits (795), Expect = 7.881e-90
Identity = 169/175 (96.57%), Postives = 172/175 (98.29%), Query Frame = 1
Query: 1801 MSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNP 2325
            MSWKNAIEEKLMIACEINKNIITEEYMKCLIESNT+EYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDC+LHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNV   T+P
Sbjct:    1 MSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTDEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCKLHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNV--PTDP 173          
The following BLAST results are available for this feature:
BLAST of SMED30034375 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034375 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034375 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034375 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034375 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034375 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034375 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034375 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034375 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034375 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034375 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034375 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034375 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034375 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045684.13.364e-13096.28SMESG000045684.1[more]
SMESG000045684.14.097e-13096.28SMESG000045684.1[more]
SMESG000017522.19.946e-13096.26SMESG000017522.1[more]
SMESG000017522.17.731e-13096.26SMESG000017522.1[more]
SMESG000017520.12.081e-12859.52SMESG000017520.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034375 ID=SMED30034375|Name=SMED30034375|organism=Schmidtea mediterranea sexual|type=transcript|length=2337bp
ATTGTACAAAGGAAGCCAACTGATCCAGAAATAGAAGAATTATGTGAAGA
TTCATCAAATAAAGAAGTGAATATGAAAATATTGTGCAAGGCAATTGAAT
GTGATTGCATGAATGAATTCCTGATTTATGACGATGTGAAAGAAAGTATT
GCGAAAAGCATATTCGAAAATCATTTAGAACTTGATCCAATGATTTGTGA
TGTAGACGGAGAAAAAAAAAGCATTTTTATTTCTTTTATTAAAGGCAACA
TAAGCTTAGAAATATTGTATAAGTTTCTCTCTGGCTTAAAAGACATATTT
CTTGGTGTAATAATAGAAAATCTTAATAAACAATTGAAAGGAAGACAAAT
ATTCGAAGCAATTGAGGCATTCAATTTTCCCAATTTGAATAATGAAAGTC
TTGTAATAGATCAAAAAACGTTTACCATTTTAACCGTTTCTAAAATTAAA
GAAGAAATGATTTACTTAACATCTATTGAACCTGCGTCTGTAATAGCTAA
ACTTAATCAACTGAAGTATTTAGAAACTTACGGCATTAATACAAATAATT
TGTCTCTGTCTCCCAAGAATCAGAATAACTTCAACCTAACAATATTCGAA
GCAATAATGAATGGTGATTTGAATTTCGATGAATTAGAGATATATGATTC
CAATAACCATGAAATGTGTTCAATTGTTGATGGCGTGGAGCGAGGATTGG
TAGATGTCCGGACCGCTAGGCACTTGCTAGATCGCATGGAATCATTAACA
TTTGGAGAATTAATTACGGATGGAATCTATGATGTGCACAATAATAGTTT
CGGTGATTTCCTATCATTAGACGAGGCTGTCGAGAATAAACTTATCCGAC
CAGAACTTGTTTATCTTAGTTTACCGAAAGAAAATAAGTTAATGAATCTA
AGTAAAATGATTGAATATGGAATGCTAAATCCATTGACCAATGAAATCAG
AACGCAAAATTCGGAAAATGAAATAATAACAATGAAACTTAATGAAGCAT
TGAATTCGGAAAACAGAATTTTAGCGACTGATTTGAATTGTAAGCAGATT
AAAATGAGATTTCCTGAGAAATTAATAAATTTTGTTGACAAAAAATTAAT
TGATCCCGATCAAGACATGATTCAATTTTCTAATAGTAAAATTGAGCCAA
TTTACATTTCTGAAGCTTTGAAGAAAAAGCTACTGTGCAGGGAGTCACTG
GTGAAGTTGACTGGGGACCACTTTGAAAATGAAATCATTATCATTGAATA
TTGTGGAAGCAATGAACCAGCAAGTTTAATGAATGAACTGAACGAATTTA
TAAAGTATATTGATAATTATCTTTCAATTTTAACCGTAAGCCACGGAGAG
ATTTTACCTAACAATGAAGAAACGATTAAGTCGATTTTGAAAGATAAAAT
AAAAATTATTGATGATGTGGATGCATTTTTGCTCAATACTGTTAACAAAG
AAGTTAATAAAGAACAAGCCTTTTATATTCAAAATCTTAAATTGAAAATT
GATCAAGCTAAAGAGCGATTGGAAGAAATCCAAGAAATAATAGGAAATGA
TCAATGGAATAAATGGTTCAATGTTTGGTTTAGGAGAAGAGAAAGCAATA
TATCCCCACCAGCTAAAGAAGAAAACAGAAGCATTTTAAGATACGGCCCG
ATATCAGGAGATGAAAATAACGAAACAATTATTATTGGCGTCAAACTTCA
AGATGATGATGAAATTCTTTGCATTGAGGAGGCAATTAAAGAGAACTTGA
TCAATGTGGAATATCAAACCTGCAGATGCAACAGAGAAAATAAAGATGAA
ATGAGTTGGAAAAATGCAATCGAAGAGAAACTGATGATTGCATGTGAAAT
TAATAAAAACATAATTACAGAGGAATATATGAAATGTCTCATAGAAAGTA
ACACAAATGAATACATAAATACAGATGAAATGGAAATCCTCGGAGCAGTA
AATACACGGAATAATAAACTATTGGAGACTAATGAAGCAATTGAAGGGAA
AATATTAGATTTGAATGGACATTTATTTATGGATGAATTATCAAAGGGTT
TGATACCATTGAGACAGGCAATTGACAGTGGATATGTGATGGCAAAGAAA
AAGGATTCCGATTGTGAATTGCATCGAGTATTTGTAGGATCTGTAAAAGT
AGGTAAAGATCAACATGAAACGAGCTTGGAAGAAGCGATAAAAGCTAAAG
TTATTGATCAATTAGAAAATGTTTACAGAATCGAAGAAGAAAACATTGAA
ATACGAATAATGGACGCGATAATGTTGGGAATGATAAAGATTGAAGACAA
GAATGTGGAAGAAGAAACAAATCCTAAATGTTTTGCA
back to top

protein sequence of SMED30034375-orf-1

>SMED30034375-orf-1 ID=SMED30034375-orf-1|Name=SMED30034375-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=779bp
IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESI
AKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIF
LGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKIK
EEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNNFNLTIFE
AIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLT
FGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNL
SKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQI
KMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESL
VKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGE
ILPNNEETIKSILKDKIKIIDDVDAFLLNTVNKEVNKEQAFYIQNLKLKI
DQAKERLEEIQEIIGNDQWNKWFNVWFRRRESNISPPAKEENRSILRYGP
ISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKDE
MSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAV
NTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKK
KDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYRIEEENIE
IRIMDAIMLGMIKIEDKNVEEETNPKCFA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000067goblet cell
PLANA:0000070intestinal phagocyte
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR035915Plakin_repeat_sf
IPR001101Plectin_repeat
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 493..513
IPR035915Plakin repeat superfamilySUPERFAMILYSSF75399Plakin repeatcoord: 564..745
IPR035915Plakin repeat superfamilySUPERFAMILYSSF75399Plakin repeatcoord: 196..319