TIR domain-containing protein

Overview
NameTIR domain-containing protein
Smed IDSMED30034374
Length (bp)2681
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TIR domain-containing protein (SMED30034374) t-SNE clustered cells

Violin plots show distribution of expression levels for TIR domain-containing protein (SMED30034374) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TIR domain-containing protein (SMED30034374) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TIR domain-containing protein (SMED30034374) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034374

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30034374SMESG000017428.1 dd_Smed_v4_9315_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034374SMESG000017428.1 dd_Smed_v4_9315_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034374SMESG000017428.1 dd_Smed_v4_9315_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30034374SMESG000017428.1 dd_Smed_v4_9315_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30034374SMESG000017428.1 dd_Smed_v4_9315_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30034374SMESG000017428.1 dd_Smed_v4_9315_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30034374SMESG000017428.1 dd_Smed_v4_9315_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30034374SMESG000017428.1 dd_Smed_v6_9315_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A5J4NUD3 (TIR domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0007574 PE=4 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 2.517e-108
Identity = 239/728 (32.83%), Postives = 367/728 (50.41%), Query Frame = 2
Query:  275 IDIPQSSKSFTAADAEGFLTKAVKIFTSLSELNDLKNIYEMGKQLSRLYFDCAEFRPILCSKLIKLEFPEFVVKMMKKLNNMGIFKHDDIWFSSFYFYNICWNYSESSFEFATALSNASLPSLIVMNLLHKPYLENLSSRNIYFLIKASLSIMHNLCRYPGNRFMFKSDKVKDALIDFTSREEELIRVISILCLAFLLEDDEAGVLIKQWN---NFTFNFIDIITKAKLHDRGRFMGFATWELLQALTIFSSNDSVKK------------AIVDSKGL--------LMVFDILGKASNV--EEVRECLMIVWNFSFD-NDLKSVLIKQHNGLQIVDNFINHEDEDVRNCAAGIKWLLEDHMKSGRLLTEIVPSQPAPVNSSGFHLYVCFAEENREIVQKIVDRLKRANL----------TLVLPKNSNIESAL-----KNQENRFRGIVQSTLFLFVLSEASKSCQQCRSETQY-----AAYLKKPIIPVIVQTKFKPSGWMEKFTDKLFFDFGGKRDFEANIELLKNTLLSECMNDEDLKSVHSMKSANSRPEIIA---QLPVNCRLQLGHSMDSSHRHHFNHSASLNSTQPPLLDSTDQ---------------LPELVPNKVSSNMSSLES---------------------IKKWSKEEVTEWLVSSDLSHLRLKLS-KFNGAMLASLLEIKREAPEYFYKCLEEKLELHFMDTLAFIDALHKL 2200
            +DIPQ  KSFT  +A  F+ + + +F SL ++ DL+++YE GKQLSR YFDC  FR  L   L   E+P F  KMMKKLNNMG+FK+DDIWFSSFYFYN  WN+S++  +FATAL++A LP+L+ +N+ H+PYLENLSS+N+Y+LIKASLSI+HN+ R PGN   F SD V+ AL+    REEE +R +S LCLA ++ + E  ++    +   +     +  I  A+L ++ R  GF   ELL AL+ FS +D+VK             A  + +G         L+   +L   S V   E  E + I+WN   D N + S +  Q      V   +N+     +   A ++ L   H      +   V  +P    S    +   FA  NR  V +I DRL++ANL          +L LP+ S +  ++      ++   F  + QS + +  LS+A +    CR E +Y     +    KP++P+I+Q K KPSGW+ +   +   DF GKRD +A+ E L +  L E ++D       + K A +   ++A      V+ +  +  + D+      N  A++N      +  +                  P + P KV ++ +SL +                     ++ WS   V  WL    L H+   ++   +G +L+ L  ++  APEYF + +  +L L F D+L F++AL +L
Sbjct:   12 MDIPQCRKSFTLEEARTFIDQVMDVFHSLEDMTDLRSMYETGKQLSRAYFDCHSFRAELAQHLTNCEYPAFASKMMKKLNNMGVFKNDDIWFSSFYFYNTTWNFSDTWPDFATALASAGLPNLLNLNIDHQPYLENLSSKNVYYLIKASLSIIHNIARVPGNTHYFTSDSVRQALLHLAQREEEFLRCVSALCLAHIITESETHLVTDSSSGGIDLARVLLGYINSARLSEKRRCHGFQVVELLSALSSFSVHDTVKTNLLSINLSSTGGAAPNDQGASCIGLLKDLIEAALLTSPSTVALREAEEAVRILWNLVIDPNTVPSGVQSQVK--TWVGEVLNNSTAPKQFTKAMMRALETLHWNLSHAVPPAVRDEPTECGS----ILFSFAPSNRIAVNRIADRLRKANLPVATLPFASESLGLPEASVVGLSMCACNTTSRTQWFESLDQSPIMVACLSDAYRLSPGCRLEAEYFISNSSDAHPKPVVPIILQPKLKPSGWVTRIATRHPIDFNGKRDPDASYEALISQ-LGELVSD-------AKKRAEAAAVVMAGQRHSSVDGKRHMAIAGDTGVAAMSNTDAAINHINGSTVGGSRATSGMSMKREDAHSIPTPNVFPYKVLNSSTSLSALTGVNPRIIPTSAWRHVIRPEVRNWSTSTVATWLRFRGLGHVSANMAGGIDGVLLSQLAGLRLWAPEYFNQSIRAELGLGFTDSLRFLEALDEL 725          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A075A0F8 (TIR domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_02093 PE=4 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 2.331e-107
Identity = 238/725 (32.83%), Postives = 371/725 (51.17%), Query Frame = 2
Query:  275 IDIPQSSKSFTAADAEGFLTKAVKIFTSLSELNDLKNIYEMGKQLSRLYFDCAEFRPILCSKLIKLEFPEFVVKMMKKLNNMGIFKHDDIWFSSFYFYNICWNYSESSFEFATALSNASLPSLIVMNLLHKPYLENLSSRNIYFLIKASLSIMHNLCRYPGNRFMFKSDKVKDALIDFTSREEELIRVISILCLAFLLEDDEAGVLIKQWNNFTFNFIDI-------ITKAKLHDRGRFMGFATWELLQALTIFSSNDSVKKAIV--------------DSKGLLMVFDILGKASN-------VEEVRECLMIVWNFSFDNDLKSVLIKQHNGLQI-VDNFINHEDEDVRNCAAGIKWLLEDHMKSGRLLTEIVPSQPAPVNSSGFHLYVCFAEENREIVQKIVDRLKRANL----------TLVLPKNS--NIESALKNQENR---FRGIVQSTLFLFVLSEASKSCQQCRSETQY-----AAYLKKPIIPVIVQTKFKPSGWMEKFTDKLFFDFGGKRDFEANIELLKNT---LLSECMNDEDLKSVHSMKSANSRPEIIAQLPVNCRLQLGHSMDSSHRHHFNH--SASLNSTQPPLLDST---DQLPELV----PNKV---SSNMSSLES------------------IKKWSKEEVTEWLVSSDLSHLRLKLS-KFNGAMLASLLEIKREAPEYFYKCLEEKLELHFMDTLAFIDALHKL 2200
            +DIPQ  K FT  +A  F+ + + +F  L +++DL+++YE GKQLSR YFDC  +R  L   L   ++P F  KMMKKLNNMG+FK+DDIWFSSFYFYN  WN+S++  +FATAL+ A LP+L+ +N+ H+PYLENLSS+N+Y+LIKASLSI+HN+ R PGN   F S+ V+ AL+    REEE +R +S LCLA ++ + EA +++    + +   ID+       I  A++ ++ R  GF   ELL AL+ FS +D+VK  +V               S  + ++ D++  A +       ++E  E + I+WN + +    S+     N ++  V   +N+         A I+ L   H K    +  ++  +PA   S  F     FA  NR  V ++ DRL+ ANL          ++ L + S   +     N   R      I QST+ +  LS+A +    CR E +Y     +    +PIIP+++Q K KP+GW+ + +++   DF GKRD EA+ E L N    L++E     +  +  +  +    P I ++  +      G +  S+   + NH     +   +   + S    D LP       PNKV   S ++ +L                    ++ WS   V  WL    L H+   ++   +G +L+ L  ++  APEYF + L   L L F D+L F++AL +L
Sbjct:   12 MDIPQCRKGFTLEEARAFIDQVMDVFHGLEDMSDLRSMYETGKQLSRAYFDCHTYRAELAQHLTNCDYPAFASKMMKKLNNMGVFKNDDIWFSSFYFYNTTWNFSDTWPDFATALAAAGLPNLLNLNIGHQPYLENLSSKNVYYLIKASLSIIHNIARVPGNTHYFTSESVRQALLHLAQREEEFLRCVSTLCLAHIVTESEAHLIM----DTSSGGIDLPRVLFGYINSARVSEKRRCHGFQVIELLSALSAFSVHDTVKANLVSISIPPTGGPTSDQGSACISLLKDLIDAAVHPSPSTVSIKEAEEAIRILWNLTVET--TSLTSSTQNQMKTWVGEVLNNPAVPNLFTKAMIRALEAIHWKLCHTVPAVIRDEPAECGSVLF----SFAPSNRVAVSRVADRLREANLPISNVPFVSESIALSEASLVGLSMCACNTATRTQWLECIDQSTIMVVCLSDAYRLSPGCRLEAEYFISTGSDIRPRPIIPIVLQPKLKPTGWLTRLSNRHMIDFNGKRDTEASYETLINQLRELVAEARKRAEAAAHAAAMATARHPSIDSKRHMAIAGDTGIAGMSNADPNVNHLNGGPIGGNRAASVLSVKREDALPTSAAHGFPNKVLDPSMSLGALSGLASRPIPTNAWRQVIKPEVRTWSTSTVATWLRFRGLGHVPANMAGGIDGILLSQLAGLRLWAPEYFTQSLRSDLGLSFADSLRFLEALDEL 726          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: H2KNS6 (TIR domain-containing protein OS=Clonorchis sinensis OX=79923 GN=CLF_100679 PE=4 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 8.393e-105
Identity = 237/726 (32.64%), Postives = 369/726 (50.83%), Query Frame = 2
Query:  275 IDIPQSSKSFTAADAEGFLTKAVKIFTSLSELNDLKNIYEMGKQLSRLYFDCAEFRPILCSKLIKLEFPEFVVKMMKKLNNMGIFKHDDIWFSSFYFYNICWNYSESSFEFATALSNASLPSLIVMNLLHKPYLENLSSRNIYFLIKASLSIMHNLCRYPGNRFMFKSDKVKDALIDFTSREEELIRVISILCLAFLLEDDEAGVLIKQWNNFTFNFIDI-------ITKAKLHDRGRFMGFATWELLQALTIFSSNDSVKKAIV--------------DSKGLLMVFDILGKASN-------VEEVRECLMIVWNFSFDNDLKSVLIKQHNGLQI-VDNFINHEDEDVRNCAAGIKWLLEDHMKSGRLLTEIVPSQPAPVNSSGFHLYVCFAEENREIVQKIVDRLKRANL----------TLVLPKNS--NIESALKNQENR---FRGIVQSTLFLFVLSEASKSCQQCRSETQY-----AAYLKKPIIPVIVQTKFKPSGWMEKFTDKLFFDFGGKRDFEANIELLKNT---LLSECMNDEDLKSVHSMKSANSRPEIIAQLPVNCRLQLGHSMDSSHRHHFNH--SASLNSTQPPLLDST---DQLPELV----PNKV---SSNMSSLESIKK-------WS---KEEVTEWLVSSDLSHLRLK---------LSKFNGAMLASLLEIKREAPEYFYKCLEEKLELHFMDTLAFIDALHKLT 2203
            +DIPQ  K FT  +A  F+ + + +F  L +++DL+++YE GKQLSR YFDC  +R  L   L   ++P F  KMMKKLNNMG+FK+DDIWFSSFYFYN  WN+S++  +FATAL+ A LP+L+ +N+ H+PYLENLSS+N+Y+LIKASLSI+HN+ R PGN   F S+ V+ AL+    REEE +R +S LCLA ++ + EA +++    + +   ID+       I  A++ ++ R  GF   ELL AL+ FS +D+VK  +V               S  + ++ D++  A +       ++E  E + I+WN + +    S+     N ++  V   +N+         A ++ L   H K    +   +  +PA   S  F     FA  NR  V ++ DRL+ ANL          ++ LP+ S   +     N   R      I QS + +  LS+A +    CR E +Y     +    +PIIP+++Q K KP+GW+ + +++   DF GKRD EA+ E L N    L++E     +  +  +  +    P I ++  +      G +  S+   + NH     +   +   + S    D LP       P+K    S N+ +L  +         W    K EV  W  S+  + LR +             +G +L+ L  ++  APEYF + L   L L F D+L F++AL +L 
Sbjct:   12 MDIPQCRKGFTLEEARAFIDQVMDVFHGLEDMSDLRSMYETGKQLSRAYFDCHTYRAELAQHLTSCDYPAFASKMMKKLNNMGVFKNDDIWFSSFYFYNTTWNFSDTWPDFATALAAAGLPNLLNLNIGHQPYLENLSSKNVYYLIKASLSIIHNIARVPGNTHYFTSESVRQALLHLAQREEEFLRCVSTLCLAHIITESEAHLIM----DTSSGGIDLPRVLFGYINSARVSEKRRCHGFQVIELLCALSAFSVHDTVKANLVSISIPPTGGPTSDQGSACISLLKDLIEAAVHPSPSTVSIKEAEEAIRILWNLTVET--SSLTSSTQNQMKTWVGEVLNNPAVPNHFTKAMVRALEAIHWKLCHTVPAAIREEPAECGSVLF----SFAPSNRVAVSRVADRLREANLPISNVPFVSESIALPEASLVGLSMCACNTATRTQWLECIDQSAIMVVCLSDAYRLSPGCRLEAEYFISTGSDIRPRPIIPIVLQPKLKPTGWLTRLSNRHIIDFNGKRDTEASYETLINQLRELVAEARKRAEAAAHAAAIATARHPSIDSKRHMAIAGDTGIAGMSNADPNVNHLNGGPIGGNRAASVLSVKREDALPAPAAHGFPSKAIDPSMNLGALSGLASRPIPTNAWRQVIKPEVRTWSTSTVATWLRFRGLGHVPANMAGGIDGILLSQLAGLRLWAPEYFTQSLRSDLGLSFADSLRFLEALDELA 727          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A419QCW4 (TIR domain-containing protein OS=Clonorchis sinensis OX=79923 GN=CSKR_33s PE=4 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 9.413e-105
Identity = 239/731 (32.69%), Postives = 371/731 (50.75%), Query Frame = 2
Query:  275 IDIPQSSKSFTAADAEGFLTKAVKIFTSLSELNDLKNIYEMGKQLSRLYFDCAEFRPILCSKLIKLEFPEFVVKMMKKLNNMGIFKHDDIWFSSFYFYNICWNYSESSFEFATALSNASLPSLIVMNLLHKPYLENLSSRNIYFLIKASLSIMHNLCRYPGNRFMFKSDKVKDALIDFTSREEELIRVISILCLAFLLEDDEAGVLIKQWNNFTFNFIDI-------ITKAKLHDRGRFMGFATWELLQALTIFSSNDSVKKAIV--------------DSKGLLMVFDILGKASN-------VEEVRECLMIVWNFSFDNDLKSVLIKQHNGLQI-VDNFINHEDEDVRNCAAGIKWLLEDHMKSGRLLTEIVPSQPAPVNSSGFHLYVCFAEENREIVQKIVDRLKRANL----------TLVLPKNS--NIESALKNQENR---FRGIVQSTLFLFVLSEASKSCQQCRSETQY-----AAYLKKPIIPVIVQTKFKPSGWMEKFTDKLFFDFGGKRDFEANIELLKNT---LLSECMNDEDLKSVHSMKSANSRPEIIAQLPVNCRLQLGHSMDSSHRHHFNH----------SASLNSTQPPLLDSTDQLPELV----PNKV---SSNMSSLESIKK-------WS---KEEVTEWLVSSDLSHLRLK---------LSKFNGAMLASLLEIKREAPEYFYKCLEEKLELHFMDTLAFIDALHKLT 2203
            +DIPQ  K FT  +A  F+ + + +F  L +++DL+++YE GKQLSR YFDC  +R  L   L   ++P F  KMMKKLNNMG+FK+DDIWFSSFYFYN  WN+S++  +FATAL+ A LP+L+ +N+ H+PYLENLSS+N+Y+LIKASLSI+HN+ R PGN   F S+ V+ AL+    REEE +R +S LCLA ++ + EA +++    + +   ID+       I  A++ ++ R  GF   ELL AL+ FS +D+VK  +V               S  + ++ D++  A +       ++E  E + I+WN + +    S+     N ++  V   +N+         A ++ L   H K    +   +  +PA   S  F     FA  NR  V ++ DRL+ ANL          ++ LP+ S   +     N   R      I QS + +  LS+A +    CR E +Y     +    +PIIP+++Q K KP+GW+ + +++   DF GKRD EA+ E L N    L++E     +  +  +  +    P I ++  +      G +  S+   + NH          +AS+ S +       D LP       P+K    S N+ +L  +         W    K EV  W  S+  + LR +             +G +L+ L  ++  APEYF + L   L L F D+L F++AL +L 
Sbjct:   12 MDIPQCRKGFTLEEARAFIDQVMDVFHGLEDMSDLRSMYETGKQLSRAYFDCHTYRAELAQHLTSCDYPAFASKMMKKLNNMGVFKNDDIWFSSFYFYNTTWNFSDTWPDFATALAAAGLPNLLNLNIGHQPYLENLSSKNVYYLIKASLSIIHNIARVPGNTHYFTSESVRQALLHLAQREEEFLRCVSTLCLAHIITESEAHLIM----DTSSGGIDLPRVLFGYINSARVSEKRRCHGFQVIELLCALSAFSVHDTVKANLVSISIPPTGGPTSDQGSACISLLKDLIEAAVHPSPSTVSIKEAEEAIRILWNLTVET--SSLTSSTQNQMKTWVGEVLNNPAVPNHFTKAMVRALEAIHWKLCHTVPAAIREEPAECGSVLF----SFAPSNRVAVSRVADRLREANLPISNVPFVSESIALPEASLVGLSMCACNTATRTQWLECIDQSAIMVVCLSDAYRLSPGCRLEAEYFISTGSDIRPRPIIPIVLQPKLKPTGWLTRLSNRHIIDFNGKRDTEASYETLINQLRELVAEARKRAEAAAHAAAIATARHPSIDSKRHMAIAGDTGIAGMSNADPNVNHLNGGPIGGNRAASVLSVK-----REDALPAPAAHGFPSKAIDPSMNLGALSGLASRPIPTNAWRQVIKPEVRTWSTSTVATWLRFRGLGHVPANMAGGIDGILLSQLAGLRLWAPEYFTQSLRSDLGLSFADSLRFLEALDELA 727          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A4S2LNJ2 (TIR domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007272 PE=4 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 1.853e-104
Identity = 238/728 (32.69%), Postives = 370/728 (50.82%), Query Frame = 2
Query:  275 IDIPQSSKSFTAADAEGFLTKAVKIFTSLSELNDLKNIYEMGKQLSRLYFDCAEFRPILCSKLIKLEFPEFVVKMMKKLNNMGIFKHDDIWFSSFYFYNICWNYSESSFEFATALSNASLPSLIVMNLLHKPYLENLSSRNIYFLIKASLSIMHNLCRYPGNRFMFKSDKVKDALIDFTSREEELIRVISILCLAFLLEDDEAGVLIKQWNNFTFNFIDI----ITKAKLHDRGRFMGFATWELLQALTIFSSNDSVKKAIV--------------DSKGLLMVFDILGKASN-------VEEVRECLMIVWNFSFDNDLKSVLIKQHNGLQI-VDNFINHEDEDVRNCAAGIKWLLEDHMKSGRLLTEIVPSQPAPVNSSGFHLYVCFAEENREIVQKIVDRLKRANL----------TLVLPKNS--NIESALKNQENR---FRGIVQSTLFLFVLSEASKSCQQCRSETQY-----AAYLKKPIIPVIVQTKFKPSGWMEKFTDKLFFDFGGKRDFEANIELLKNT---LLSECMNDEDLKSVHSMKSANSRPEIIAQLPVNCRLQLGHSMDSSHRHHFNH----------SASLNSTQPPLLDSTDQLPELV----PNKV---SSNMSSLESIKK-------WS---KEEVTEWLVSSDLSHLRLK---------LSKFNGAMLASLLEIKREAPEYFYKCLEEKLELHFMDTLAFIDALHKLT 2203
            +DIPQ  K FT  +A  F+ + + +F  L +++DL+++YE GKQLSR YFDC  +R  L   L   ++P F  KMMKKLNNMG+FK+DDIWFSSFYFYN  WN+S++  +FATAL+ A LP+L+ +N+ H+PYLENLSS+N+Y+LIKASLSI+HN+ R PGN   F S+ V+ AL+    REEE +R +S LCLA ++ + EA  LI   ++   + + +    I  A++ ++ R  GF   ELL AL+  S +D+VK  +V               S  + ++ D++  A +       ++E  E + I+WN + +    S+     N ++  V   +N+         A ++ L   H K    +  ++  +PA   S  F     FA  NR  V ++ DRL+ ANL          ++ LP+ S   +     N   R      I QS + +  LS+A +    CR E +Y     +    +PIIP+++Q K KP+GW+ + +++   DF GKRD EA+ E L N    L++E     +  +  +  +    P I ++  +      G +  S+   + NH          +AS+ S +       D LP       PNK    S ++ +L  +         W    K EV  W  S+  + LR +             +G +L+ L  ++  APEYF + L   L L F D+L F++AL +L 
Sbjct:   12 MDIPQCRKGFTLEEARAFIDQVMDVFHGLEDMSDLRSMYETGKQLSRAYFDCHTYRAELAQHLTSCDYPAFASKMMKKLNNMGVFKNDDIWFSSFYFYNTTWNFSDTWPDFATALAAAGLPNLLNLNIGHQPYLENLSSKNVYYLIKASLSIIHNIARVPGNTHYFTSESVRQALLHLAQREEEFLRCVSTLCLAHIITESEAH-LIMDTSSGGIDLLRVLFGYINSARVSEKRRCHGFQVIELLCALSALSVHDTVKANLVSISIPPTGGPTSDQGSACISLLKDLIDAAVHPSPSAVSIKEAEEAIRILWNLTVET--SSLTSSTQNQMKTWVGEVLNNPAVPNLFTKAMVRALEAIHWKLCHTVPAVIREEPAECGSVLF----SFAPSNRVAVSRVADRLREANLPISNVPFVSESIALPEASLVGLSMCACNTATRTQWLECIDQSAIMVVCLSDAYRLSPGCRLEAEYFISTGSDIRPRPIIPIVLQPKLKPTGWLTRLSNRHIIDFNGKRDTEASYETLINQLRELVAEARKRAEAAAHAAAIATARHPSIDSKRHMAIAGDTGIAGMSNADPNVNHLNGGPVGGNRAASVLSVK-----REDALPASAAHGFPNKALDPSMSLGALSGLASRPIPTNAWRQVIKPEVRTWSTSTVATWLRFRGLGHVPANMAGGIDGILLSQLAGLRLWAPEYFTQSLRSDLGLSFADSLRFLEALDELA 727          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO41008 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5P1])

HSP 1 Score: 137.117 bits (344), Expect = 7.041e-33
Identity = 120/507 (23.67%), Postives = 219/507 (43.20%), Query Frame = 2
Query:  707 LIKASLSIMHNLCRYPG-NRFMFKSDKVKDALIDFTSREEELIRVISILCLAFLLEDDEAGVLIKQWNNFTFNFIDIITKAKLHDRGRFMGFATWELLQALTIFSSNDSVKKAIVDSKGLLMVFDILGKASNVEEVRECLMIVWNFSFDNDLKSVLIKQHNGLQIVDNFINHEDEDVRNCAAGIKWLLEDHMKSGRLLTEIVPSQPAPVNSSGFHLYVCFAEENREIVQKIVDRLKRANLTLVLPKNSNIESALKNQENRFRGIVQSTLFLFVLSEASKSCQQCRSETQYAAYLKKPIIPVIVQTKFKPSGWMEK-FTDKLFFDFGGKRDFEANIELLKNTLLSECMNDEDLKSVHSMKSANSRPEIIAQLPVNCRLQLGHSMDSSHRHHFNHSASLNSTQPPLLDSTDQLPELVPNK-----VSSNMSSLESIKKWSKEEVTEWLVSSDLSHLRLKLSKFNGAMLASLLEIKREAPEYFYKCLEEKLEL-HFMDTLAFIDALHKLT 2203
            L+   L  +HNL R P   RF  +S+ VK  L+ F         + ++LCLA+L+++    +++      TF  + +++ A    R + +GFA WE+   +   +SND  K+ I    G+ ++  ++ +A N  E    L  ++  SFD + K +L K    + ++ N      ++V+  A GI W +E   K GR   E           S  H+ + +  +N++ +  +  RLK A   + +       S L   E   R +  +++ L  +S+  +    CRSE +YA   +K I+P++++  ++P GW+      KL+ DF  +   +  I                   VH MK                               +N +A+L     P+   T  +    P+K       +++     + KW KE+V +WL    LS       K +G+ML  L  +K+E+PE++Y  +++ ++    ++ L F + L KL 
Sbjct:  813 LLSHVLGALHNLSRRPAVKRFFEESNGVKHLLL-FMKCGVTYFVMNALLCLAYLVDERNNDLIMADEEPITF-LLRMLSSAISDSRRQHLGFAAWEIACGIGRVASNDKNKRLIGRHDGVSILSTLVKEAKNDAERVYGLQALYMLSFDGENKKILCKDKATVNLLRNLKQSGHKEVQKAAVGILWEIEG--KVGRDRNE----------DSQQHIMISYQWDNQKAMLAVNKRLKEAGHKVWMDVEQMGGSTL---EAMARAVENASVILIAMSQRYQDSPNCRSEAEYAFQRRKKIVPLMMEQDYRPDGWLGMILGAKLWMDF--RESVDTGI-------------------VHLMKEL----------------------------QYNQTAALQQPHDPVTVDTTTVISSPPDKEDGPPGPTDVVDRPDVSKWKKEDVAKWLSDIGLSSSNKVRKKLDGSMLILLYRLKQESPEFYYASVKKDMDFPTVIEVLQFTEELRKLV 1253          

HSP 2 Score: 58.151 bits (139), Expect = 1.636e-8
Identity = 37/127 (29.13%), Postives = 63/127 (49.61%), Query Frame = 2
Query: 1319 PAPVNSSGFHLYVCFAEENREIVQKIVDRLKRANLTLVLP----KNSNIESALKNQENRFRGIVQSTLFLFVLSEASKSCQQCRSETQYAAYLKKPIIPVIVQTKFKPSGWMEKFTD-KLFFDFGGK 1684
            P P   SG H+ + +    +++V K+ D L+ A   + +     + S +E+     EN       +   L  +S A K    CRSE +Y+  L+K IIP++++ ++KP GW+      KL+ DF  K
Sbjct:  548 PKP---SGHHVMLSYQWGYQDVVLKVRDELRAAGYKVWIDVEQMEGSTLEAMASAVEN-------AAAVLMCVSRAYKESPNCRSEAEYSFQLRKDIIPLMMEPQYKPDGWLGIIVGAKLWMDFRSK 664          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO45030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU69])

HSP 1 Score: 119.398 bits (298), Expect = 1.519e-27
Identity = 82/329 (24.92%), Postives = 159/329 (48.33%), Query Frame = 2
Query:  707 LIKASLSIMHNLCRY-PGNRFMFKSDKVKDALIDFTSREEELIRVISILCLAFLLEDDEAGVLIKQWNNFTFNFIDIITKAKLHDRGRFMGFATWELLQALTIFSSNDSVKKAIVDSKGLLMVFDILGKASNVEEVRECLMIVWNFSFDNDLKSVLIKQHNGLQIVDNFINHEDEDVRNCAAGIKWLLEDHMKSGRLLTEIVPSQPAPVNSSGFHLYVCFAEENREIVQKIVDRLKRANLTLVLPKNSNIESALKNQENRFRGIVQSTLFLFVLSEASKSCQQCRSETQYAAYLKKPIIPVIVQTKFKPSGWMEKFTD-KLFFDFGGKR 1687
            ++  ++  MHNL R  P  ++  K+D VK  L+   + E       ++L LA+L ++    +++       F  I I++K+   +  R++GF   EL + L+  + NDS KK I     + ++ D+L  A N E+ R     +W  +FDN+ K  ++   N ++++    + ED+ V+  AAG+ W +E   K    + E    +P        H+ + +  + +  + ++  +L+ A   + +       S L+   N    +  + + L  +S+  K    CRSE +YA  L+K I+P++++  ++P GW+      KL+ DF  K+
Sbjct:  392 ILNTAMGTMHNLSRRIPCRQYFKKADTVK-VLLPMLNDEVSQFAAKALLILAYLTDESNNSLIMASEEPIQF-LIHILSKSCSSNSNRYLGFTNSELAEGLSQIAVNDSNKKLIGQHGAIPILVDMLANAKNDEQRRCGAEALWVLAFDNENKEAILTTPNAVELLKELQHSEDDSVKKAAAGVLWEIEG--KESHTVKESTADEPLR-----NHVMISYQWDVQPTMIQVKSKLQAAGYRVWMDLEQMGGSTLQAMAN---AVENAEVVLMCVSQKYKESPNCRSEAEYAFQLRKDIVPLMMEKSYRPDGWLGMIMGAKLWIDFSDKQ 708          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO33720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRG5])

HSP 1 Score: 47.3654 bits (111), Expect = 5.466e-7
Identity = 22/64 (34.38%), Postives = 34/64 (53.12%), Query Frame = 2
Query: 1490 GIVQSTLFLFVLSEASKSCQQCRSETQYAAYLKKPIIPVIVQTKFKPSGWMEKFT-DKLFFDFG 1678
             +  S + L   S   K     RSE +YA   KKPI+P++++  +KP GW+      KL+F+F 
Sbjct:   12 AVENSAVVLMCASRKYKDSVNYRSEAEYAYTQKKPIVPLMMENGYKPDGWLGMIMGSKLYFNFA 75          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000017428.1 (SMESG000017428.1)

HSP 1 Score: 1366.67 bits (3536), Expect = 0.000e+0
Identity = 664/666 (99.70%), Postives = 666/666 (100.00%), Query Frame = 2
Query:  212 MNKSSKRSHSRETTDSVRDVGIDIPQSSKSFTAADAEGFLTKAVKIFTSLSELNDLKNIYEMGKQLSRLYFDCAEFRPILCSKLIKLEFPEFVVKMMKKLNNMGIFKHDDIWFSSFYFYNICWNYSESSFEFATALSNASLPSLIVMNLLHKPYLENLSSRNIYFLIKASLSIMHNLCRYPGNRFMFKSDKVKDALIDFTSREEELIRVISILCLAFLLEDDEAGVLIKQWNNFTFNFIDIITKAKLHDRGRFMGFATWELLQALTIFSSNDSVKKAIVDSKGLLMVFDILGKASNVEEVRECLMIVWNFSFDNDLKSVLIKQHNGLQIVDNFINHEDEDVRNCAAGIKWLLEDHMKSGRLLTEIVPSQPAPVNSSGFHLYVCFAEENREIVQKIVDRLKRANLTLVLPKNSNIESALKNQENRFRGIVQSTLFLFVLSEASKSCQQCRSETQYAAYLKKPIIPVIVQTKFKPSGWMEKFTDKLFFDFGGKRDFEANIELLKNTLLSECMNDEDLKSVHSMKSANSRPEIIAQLPVNCRLQLGHSMDSSHRHHFNHSASLNSTQPPLLDSTDQLPELVPNKVSSNMSSLESIKKWSKEEVTEWLVSSDLSHLRLKLSKFNGAMLASLLEIKREAPEYFYKCLEEKLELHFMDTLAFIDALHKLTIC 2209
            MNKSSKRSHSRETTDSVRDVGIDIPQSSKSFTAADAEGFLTKAVKIFTSLSELNDLKNIYEMGKQLSRLYFDCAEFRPILC+KLIKLEFPEFVVKMMKKLNNMGIFKHDDIWFSSFYFYNICWNYSESSFEFATALSNASLPSLIVMNLLHKPYLENLSSRNIYFLIKASLSIMHNLCRYPGNRFMFKSDKVKDALIDFTSREEELIRVISILCLAFLLEDDEAGVLIKQWNNFTFNFIDIITKAKLHDRGRFMGFATWELLQALTIFSSNDSVKKAIVDSKGLLMVFDILGKASNVEEVRECLMIVWNFSFDNDLKSVLIKQHNGLQIVDNFINHEDEDVRNCAAGIKWLLEDHMKSGRLLTEIVPSQPAPVNSSGFHLYVCFAEENREIVQKIVDRLKRANLTLVLPKNSNIESALKNQENRFRGIVQSTLFLFVLSEASKSCQQCRSETQYAAYLKKPIIPVIVQTKFKPSGWMEKFTDKLFFDFGGKRDFEANIELLKNTLLSECMNDEDLKSVHSMKSANSRPEIIAQLPVNCRLQLGHSMDS+HRHHFNHSASLNSTQPPLLDSTDQLPELVPNKVSSNMSSLESIKKWSKEEVTEWLVSSDLSHLRLKLSKFNGAMLASLLEIKREAPEYFYKCLEEKLELHFMDTLAFIDALHKLTIC
Sbjct:    1 MNKSSKRSHSRETTDSVRDVGIDIPQSSKSFTAADAEGFLTKAVKIFTSLSELNDLKNIYEMGKQLSRLYFDCAEFRPILCAKLIKLEFPEFVVKMMKKLNNMGIFKHDDIWFSSFYFYNICWNYSESSFEFATALSNASLPSLIVMNLLHKPYLENLSSRNIYFLIKASLSIMHNLCRYPGNRFMFKSDKVKDALIDFTSREEELIRVISILCLAFLLEDDEAGVLIKQWNNFTFNFIDIITKAKLHDRGRFMGFATWELLQALTIFSSNDSVKKAIVDSKGLLMVFDILGKASNVEEVRECLMIVWNFSFDNDLKSVLIKQHNGLQIVDNFINHEDEDVRNCAAGIKWLLEDHMKSGRLLTEIVPSQPAPVNSSGFHLYVCFAEENREIVQKIVDRLKRANLTLVLPKNSNIESALKNQENRFRGIVQSTLFLFVLSEASKSCQQCRSETQYAAYLKKPIIPVIVQTKFKPSGWMEKFTDKLFFDFGGKRDFEANIELLKNTLLSECMNDEDLKSVHSMKSANSRPEIIAQLPVNCRLQLGHSMDSAHRHHFNHSASLNSTQPPLLDSTDQLPELVPNKVSSNMSSLESIKKWSKEEVTEWLVSSDLSHLRLKLSKFNGAMLASLLEIKREAPEYFYKCLEEKLELHFMDTLAFIDALHKLTIC 666          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000058865.1 (SMESG000058865.1)

HSP 1 Score: 416.387 bits (1069), Expect = 5.055e-134
Identity = 259/675 (38.37%), Postives = 388/675 (57.48%), Query Frame = 2
Query:  281 IPQSSKSFTAADAEGFLTKAVKIFTSLSELNDLKNIYEMGKQLSRLYFDCAEFRPILCSKLIKLEFPEFVVKMMKKLNNMGIFKHDDIWFSSFYFYNICWNYSESSFEFATALSNASLPSLIVMNLLHKPYLENLSSRNIYFLIKASLSIMHNLCRYPGNRFMFKSDKVKDALIDFTSREEELIRVISILCLAFLLEDDEAGVL----IKQWNNFTFNFIDIITKAKLHDRGRFMGFATWELLQALTIFSSNDSVKKAIVDSKGLLMVFDILGKASNV--EEVRECLMIVWNFSFDNDLKSVLIKQHNGLQIVDNFINHEDEDVRNCAAGIKWLLE-DHMKSGRLLTEIVPSQPAPVNSSGFHLYVCFAEENREIVQKIVDRLKRANLTLVLPKNSNIESALKNQENRFRGIVQSTLFLFVLSEASKSCQQCRSETQYAAYLKKPIIPVIVQTKFKPSGWMEKFTDK--LFFDFGGKRDFEANIELLKNTLLS-------ECMNDEDLKSVH-----------------SMKSANSRPE-IIAQLPVNCRLQLGHSMDSSHRHHFNHSASLNSTQPPLLDSTDQLPELVPNKVSSNMSSLESIKKWSKEE-VTEWLVSSDLSHLRLKLSKFNGAMLASLLEIKREAPEYFYKCLEEKLELHFMDTLAFIDALHKL 2200
            +PQS K  T  +A  FL   + +F SLS + DLK +YE GKQLSRLYFDCA  +  L   L++LEFPE+ +K MKKLNNMG+FK+DDIWFSSFYFYNICWNYS++SFEFATAL+   LP+L+ +N+ HKPYL+NLSSRN+Y+LIKASLSI+HN+CR+PG+   F+S+ VK +L++  +REE+ IRV++ LCLA ++ ++E  +L      +  +   + +  I KA+  +RGRFMGF ++ELLQ +   ++ +  K+  +D  G+ ++ + L   S V  E+V ECL I+ N + + +++  L++       +  F+NHE+  +R  +    W LE D     +   E+  ++P PV       Y+ +A  NR  V KI DRL  AN+   +  +S++ S   N E   + I +S L +  +SEA KS  + + E ++   + KPI+P+++Q K++P GW+++  D+    FD   KRDFEA+ E    +L         E     DLK                    ++    SR + ++  LP       G      +    N  A + S Q P      Q+ E VP+  S    S++S+   + E  V  WL S+DLSHLR KL+  N  +L     +K+ APEYFY+ LE+ L+L F+D L F +A+  L
Sbjct:   18 VPQSYKGMTLEEARVFLRNTMDLFQSLSSMTDLKTMYEAGKQLSRLYFDCANHQRELAEILLELEFPEYTIKTMKKLNNMGVFKNDDIWFSSFYFYNICWNYSDASFEFATALALCGLPNLLNLNIGHKPYLDNLSSRNVYYLIKASLSIIHNICRFPGSCIYFRSESVKSSLLNLINREEDFIRVVASLCLASIVGENEPHLLRDDESDERPDVMQSIMGYIRKARNSERGRFMGFRSYELLQGIRSATTVECEKRHFIDLDGITLLKESLINKSVVIEEDVAECLEILCNLNVNKEIQYKLVESGLDGTTIGQFVNHENVRIRTASQDYLWSLEIDSTNPEQFHEEMDLNKPLPV-------YISYASINRFSVLKIRDRLADANIVRFI--DSDVRS---NGEMVKKTIGKSALVIICVSEAFKSHPRYQLEVEFCERIHKPIVPLLIQQKYRPEGWLQRAIDRDLSVFDLSSKRDFEASWETFITSLSGKLKEIKLEYQKQSDLKVKQEKIEHQLHHHHEEDYKNNINDDMSRSQHLVEPLPTQSD---GGGYRRYNGVENNLDAEVRSNQLP----PKQIIESVPH--SGAGESVDSVAGAAGENLVHAWLDSNDLSHLRPKLTWLNTKLLHYYQNVKKNAPEYFYQTLEKHLKLEFVDILKFSNAIDHL 671          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000015387.1 (SMESG000015387.1)

HSP 1 Score: 303.138 bits (775), Expect = 6.959e-92
Identity = 187/646 (28.95%), Postives = 341/646 (52.79%), Query Frame = 2
Query:  278 DIPQSSKSFTAADAEGFLTKAVKIFTSLSELNDLKNIYEMGKQLSRLYFDCAEFRPILCSKLIKLEFPEFVVKMMKKLNNMGIFKHDDIWFSSFYFYNICWNYSESSFEFATALSNASLPSLIVMNLLHKPYLENLSSRNIYFLIKASLSIMHNLCRYPGNRFMFKSDKVKDALIDFTSR-EEELIRVISILCLAFLLEDDEAGVLIKQWNNFTFNFIDIITKAKLHDRGRFMGFATWELLQALTIFSSNDSVKKAIVDSKGLLMVFDILGKASNVEEVRECLMIVWNFSFDNDLKSVLIKQHNGLQIVDNFINHEDEDVRNCAAGIKWLLEDHMKSG-RLLTEIVPSQPAPVNSSGFHLYVCFAEENREIVQKIVDRLKRANLTLVLPKNSNIESALKNQENRFRGIVQSTLFLFVLSEASKSCQQCRSETQYAAYLKKPIIPVIVQTKFKPSGWMEKFT-DKLFFDFGGKRDFEANIELLKNTLLSECMNDEDLKSVHSMKSANSRPEIIAQLPVNCRLQLGHSMDSSHRHHFNHSASLNSTQPPLLDSTDQLPELVPNKVSSNMSSLESIKKWSKEEVTEWLVSSDLSHLRLKLSKFNGAMLASLLEIKREAPEYFYKCLEEKLELHFMDTLAFIDALHKLTI 2206
            ++P   KSFT   A  ++ KA++    L +  +   IY++ K +S+ YFD       L + L+ L++       + K +  G F +DD+WF+++Y  N  WNY +   E A  +    LP  ++ NLLH+PYL+N+ + NI++LIKAS+SI+HN+ R PGN   F+  ++K+ L+    R + + I +IS+L L+ L+ + E  +L +  N+     + I T A  +D  +  GFA WEL+  L   S+ND+VKK IV   G+ ++FDIL   +   ++ +CL ++WN  FD D+K++L+   +    ++ F NH+   ++ C  GI WL+++ ++S  R+L+  +    A      F +++ +   N+++V  I D L ++N+ + +  +    S L   E    GI  S +F+  +SEA ++   CR+E +YA  L KPIIP+IV+ K+KP+ W+      K++++F  +R+FE +I  L             L +V+++   N   +I+ ++ V        + + S++       S +   P +L                      S+  WS + V +WLV + L H++ +   F+G +L SL+++K ++ +Y    L+ +  + F+D L    A++++ +
Sbjct:    5 EVPDYEKSFTEPQAVDYMKKALEKLKELQDSLNFNIIYKIFKGISQSYFDLKSHLNALSNVLLNLKYVSITSNYVGKFSKEGYFVNDDVWFATYYALNSLWNYCDGFQEIANEIVVTDLPQYLIANLLHRPYLDNMKNTNIFYLIKASISIIHNIVRCPGNEEKFQIIELKNVLVGLIKRNDSDFIVLISMLTLSCLVNESELHLLDEGKNSIKALIMKIRT-AFENDSKKVNGFAIWELVNGLKCVSANDNVKKTIVTENGIKLIFDILKNPTCDNDIEKCLGVLWNLCFDKDIKAILVNDFDLKLFINRFKNHKLSTIKRCYNGILWLIDEKIQSKERILSAHLSKVKASKTHWKFDVFISYCWANKQMVLSIRDFLVQSNIKIWIDLDQMKGSTL---EAMADGIENSNIFIMAISEAYRTSPNCRTEAEYAFSLNKPIIPLIVEMKYKPTSWLGIIMGSKMYYEFSKRRNFEESIHSL-------------LANVNTI-IQNVERKIVTEIIVPV------AQNESYQ-------SSDGGTPKIL----------------------SVHSWSNKIVEKWLVKNGLGHVKSRFMNFDGKLLFSLIDVKNKSRKYLIDALKVEYGMKFIDLLKLHSAINEICL 597          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000047638.1 (SMESG000047638.1)

HSP 1 Score: 285.419 bits (729), Expect = 7.443e-86
Identity = 173/589 (29.37%), Postives = 317/589 (53.82%), Query Frame = 2
Query:  449 LCSKLIKLEFPEFVVKMMKKLNNMGIFKHDDIWFSSFYFYNICWNYSESSFEFATALSNASLPSLIVMNLLHKPYLENLSSRNIYFLIKASLSIMHNLCRYPGNRFMFKSDKVKDALIDFTS-REEELIRVISILCLAFLLEDDEAGVLIKQWNNFTFNFIDIITKAKLHDRG-RFMGFATWELLQALTIFSSNDSVKKAIVDSKGLLMVFDILGKASNVEEVRECLMIVWNFSFDNDLKSVLIKQHNGLQIVDNFINHEDEDVRNCAAGIKWLLEDHMKSG-RLLTEIVPSQPAPVNSSGFHLYVCFAEENREIVQKIVDRLKRANLTLVLPKNSNIESALKNQENRFRGIVQSTLFLFVLSEASKSCQQCRSETQYAAYLKKPIIPVIVQTKFKPSGWMEKFT-DKLFFDFGGKRDF-EANIELLKNTLLSECMNDEDLKSVHSMKSANSRPEIIAQLPVNCRLQLGHSMDSSHRHHFNHSASLNSTQPPLLDSTDQLPELVPNKVSSNMSSLESIKKWSKEEVTEWLVSSDLSHLRLKLSKFNGAMLASLLEIKREAPEYFYKCLEEKLELHFMDTLAFIDALHKL 2200
            + ++L+++ +   +  ++ K N++G F +D IWFS++Y  N  WNY +S+ E A ++ N  LP+L++ N+LH+PY++NL S N+Y+++KAS+SI+HN+ R  G   +F++ ++K+ L+      + + + ++SIL LA L++++E  +L +  N  T N + +  ++ +  +  R  GF+ WEL+  L   S+ND++KK+IV+  G+ ++ DI+ K S  +++ +CL ++WN  FD ++K  LI  +    ++  F +H    ++ C  GI WL+E+   S  RL +       A  +   F +++ ++  N+ I+  I D L ++ + + +  +    S L   E    GI  S +F+  +SEA ++   CR+E +YA  LKKPIIP+IV+ K+KP  W+      K +++F  +R+F E+ I LL N  L   MND +   V      N                             NH    N                  N VS+ + S   I KW+ ++V +WL+  +L HL++K S F+G ++ S++++  ++P++ Y  L+ +  +  +D L F  AL ++
Sbjct:    8 MGNELLRMNYASVIADVICKFNDVGFFNNDSIWFSTYYALNGFWNYCDSNQEIANSILNTKLPNLLISNVLHQPYVQNLKSTNVYYVMKASISIIHNVVRVAGYEGIFQNKELKEGLVGLIHINDSDFLGLVSILTLACLVKENELHLLEEGKN--TINLLIVQIRSAMESKTKRINGFSIWELVNGLKCVSANDNMKKSIVNENGIQLLLDIIEKPSCDDDIEKCLGVLWNLCFDKEIKQTLIIDYKLSLLIKPFESHPSAKIKKCFEGISWLIENKSHSKQRLKSAQAFKLKANKDKWKFDIFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKGSTL---EAMADGIENSHIFVMAISEAYRTSPNCRTEAEYAFSLKKPIIPLIVELKYKPMSWLGMIMGSKTYYEFSDRRNFNESVIGLLSNINL--FMNDTETIIVPKTDVPNEA---------------------------NHVEIRNV-----------------NTVSNEIRS--EISKWTNKDVEKWLIKHNLEHLKIKFSSFDGRLINSMVDLNSKSPDFLYGNLKSEYGMKLIDVLKFNLALQQI 543          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000006301.1 (SMESG000006301.1)

HSP 1 Score: 211.846 bits (538), Expect = 6.312e-59
Identity = 134/448 (29.91%), Postives = 231/448 (51.56%), Query Frame = 2
Query:  371 NDLKNIYEMGKQLSRLYFDCAEFRPILCSKLIKLEFPEFVVKMMKKLNNMGIFKHDDIWFSSFYFYNICWNYSESSFEFATALSNASLPSLIVMNLLHKPYLENLSSRNIYFLIKASLSIMHNLCRYPGNRFMFKSDKVKDALIDFTSREEELIRVISILCLAFLLEDDEAGVLIKQWNNFTFNFIDIITKAK---------LHDRGRFMGFATWELLQALTIFSSNDSVKKAIVDSKGLLMVFDILGKASNVEEVRECLMIVWNFSFDNDLKSVLIKQHNG---LQIVDNFINHEDEDVRNCAAGIKWLLE--------DHMKSGRLLTEIVPSQPAPVNSSGFHLYVCFAEENREIVQKI-VDRLKRANLTLVLPKNSNIESALKNQENRFRGIVQSTLFLFVLSEASKSCQQCRSETQYAAYLKKPIIPVIVQTKFKPSGWMEKF 1651
            NDL  +++ GKQL+ LYFDC   R IL   LIK+EF E+ VK +K+LNN+G+F++DDIWF+SFY YN+CWNYS  + EF + L    + SL++ N+ H PY+ NLS RN+ +LI A+LSIM+N+ + PG R +F ++ V   LI   S+ ++ I V+  +CL+++  +D     IK  ++F     DI    K         L   G++  +  +E  + L   S +++ K AIV+  G  ++ + L    +    RE L  + N          L    NG    +I D +  ++   + +    + W +E        ++ K G++             S   ++++ FA+ +  +  KI  D +   NL L++  + +++   +  +       +S++ +  +SEA K+    +   +Y +   K I PV++Q  +KP GW++ F
Sbjct:   34 NDLVTLHKAGKQLTSLYFDCKTHRLILSEHLIKIEFLEYAVKTLKQLNNLGVFQNDDIWFASFYLYNLCWNYSTINPEFGSGLMLCGIESLLISNITHDPYINNLSKRNVNYLISATLSIMNNILKTPGYRLIFSTENVIKGLIKI-SKFDDKISVLCTMCLSYIATNDN----IKSTSDF-----DIFYNVKVLFYCIDRALETDGKYNNYTVYEFFEVLKFASLSNNQKDAIVNLDGFNIMIEQLNTTKDERVKREILFTLVN----------LCDAENGNKIKEIADFYSTNKSNVISSAVKTLSWFMEILEQKSKQNNNKLGKI-------------SRKKNIFINFAKPDERMAMKIFTDLMNGPNLPLIINDDEDVDKLRQAYD-------KSSIIIVCVSEAFKNSINLKVGAEYISLKNKIIFPVLIQNNYKPEGWIKDF 441          

HSP 2 Score: 51.6026 bits (122), Expect = 2.777e-6
Identity = 20/64 (31.25%), Postives = 45/64 (70.31%), Query Frame = 2
Query: 2009 VTEWLVSSDLSHLRLKLSKFNGAMLASLLEIKREAPEYFYKCLEEKLELHFMDTLAFIDALHKL 2200
            +++WL+  +LSHL+ K+   +  +L  + +I+ EAP+++++ L++ L+L+F++ + F  AL +L
Sbjct:  503 ISQWLIEHELSHLQAKMINISMELLCYMRKIRSEAPDFYFRSLQDSLKLNFVEIIQFSAALDEL 566          
The following BLAST results are available for this feature:
BLAST of TIR domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NUD32.517e-10832.83TIR domain-containing protein OS=Paragonimus weste... [more]
A0A075A0F82.331e-10732.83TIR domain-containing protein OS=Opisthorchis vive... [more]
H2KNS68.393e-10532.64TIR domain-containing protein OS=Clonorchis sinens... [more]
A0A419QCW49.413e-10532.69TIR domain-containing protein OS=Clonorchis sinens... [more]
A0A4S2LNJ21.853e-10432.69TIR domain-containing protein OS=Opisthorchis feli... [more]
back to top
BLAST of TIR domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO410087.041e-3323.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450301.519e-2724.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337205.466e-734.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TIR domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017428.10.000e+099.70SMESG000017428.1[more]
SMESG000058865.15.055e-13438.37SMESG000058865.1[more]
SMESG000015387.16.959e-9228.95SMESG000015387.1[more]
SMESG000047638.17.443e-8629.37SMESG000047638.1[more]
SMESG000006301.16.312e-5929.91SMESG000006301.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034374 ID=SMED30034374|Name=TIR domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2681bp
AATGGCTGAAATCCATTGATTTTTCACAAAAAAATAAATTCCAATAAGTC
GATTTACGTTTCAATTTGCATTATAGCAGAATTTATCTGAACTTCGCTTG
GTATATTTAAAGTTATTGGTGAATTTTCTCCAAGTTCACTATCTTTATTC
GAGCAGAATAGTCATGATCAAGAAATTTTAACTGCAATTCAAAATTTCAA
TCAAAAGATTAATGAATAAATCTTCAAAACGAAGTCATTCCAGAGAAACA
ACGGATTCAGTCAGAGATGTCGGAATTGATATTCCACAATCGTCGAAATC
TTTCACCGCAGCCGATGCAGAAGGTTTCCTAACGAAAGCTGTAAAGATTT
TCACTTCACTGTCAGAATTGAATGATTTGAAAAACATTTACGAAATGGGA
AAACAATTGAGTCGGCTCTATTTCGACTGTGCGGAATTCCGGCCGATTCT
CTGTTCAAAACTCATCAAATTGGAGTTTCCGGAATTTGTGGTGAAAATGA
TGAAAAAACTCAACAACATGGGCATTTTCAAGCATGACGACATTTGGTTC
TCTTCGTTTTATTTTTATAATATCTGCTGGAATTATTCAGAAAGCTCATT
CGAATTCGCTACGGCTTTGTCAAATGCCAGTCTGCCTAGCCTCATCGTTA
TGAATTTGCTTCACAAGCCGTATTTGGAGAATCTTTCTAGCCGTAACATT
TACTTTCTCATCAAAGCCTCACTGAGTATAATGCACAATTTGTGCCGATA
TCCCGGCAATAGGTTCATGTTCAAATCAGACAAGGTCAAGGATGCACTTA
TAGACTTCACGAGTCGGGAAGAAGAACTGATTAGAGTGATTTCGATTCTT
TGCCTGGCATTCCTACTGGAAGACGATGAGGCAGGGGTCTTGATCAAGCA
ATGGAATAACTTTACCTTCAATTTCATTGATATCATTACTAAAGCAAAGC
TGCATGATCGTGGCCGCTTTATGGGATTCGCCACTTGGGAGTTGCTTCAA
GCCTTAACCATATTTAGTAGTAACGATAGCGTTAAGAAAGCAATTGTCGA
CTCGAAGGGTCTGTTGATGGTATTCGACATTTTAGGAAAGGCATCAAACG
TCGAAGAAGTAAGAGAATGCCTGATGATTGTTTGGAACTTTTCTTTTGAT
AATGACTTGAAATCTGTGTTAATTAAACAACACAACGGATTGCAAATCGT
TGATAACTTTATCAATCACGAAGACGAAGACGTTAGAAACTGCGCGGCCG
GAATCAAGTGGCTTTTGGAGGATCACATGAAAAGCGGTCGTTTATTAACA
GAAATCGTTCCATCTCAGCCAGCTCCGGTCAACTCATCAGGATTTCATTT
GTATGTTTGTTTTGCTGAAGAAAATCGAGAAATTGTACAGAAAATTGTTG
ACAGATTAAAGCGAGCTAACCTAACATTGGTGTTACCAAAAAACTCCAAC
ATAGAATCGGCTTTGAAAAACCAAGAGAACAGATTCCGAGGAATCGTACA
GTCGACTCTCTTTCTGTTTGTTTTGTCTGAAGCCAGCAAATCTTGTCAAC
AGTGCCGTTCGGAAACCCAATATGCTGCCTATTTGAAAAAGCCAATTATC
CCAGTGATTGTTCAAACGAAATTCAAGCCATCTGGCTGGATGGAGAAGTT
CACTGATAAATTGTTTTTCGATTTCGGTGGCAAGCGAGATTTCGAAGCGA
ACATTGAACTGTTGAAAAATACTCTGCTTAGTGAATGCATGAATGACGAA
GACTTGAAGTCCGTTCATTCAATGAAGTCAGCAAACTCAAGACCGGAAAT
AATCGCTCAATTGCCGGTGAATTGCCGGCTCCAGTTAGGCCACTCAATGG
ACAGCTCCCACAGGCATCATTTCAATCACAGTGCGAGCCTCAACAGTACT
CAGCCTCCACTTCTAGATTCGACAGACCAGTTGCCAGAACTCGTTCCGAA
CAAAGTCTCCTCGAATATGTCGAGCTTAGAAAGCATCAAAAAGTGGTCAA
AAGAAGAAGTGACCGAATGGTTGGTCAGTAGTGATCTGTCACATTTGAGA
TTAAAGTTATCAAAATTTAACGGAGCGATGCTGGCATCTCTTCTGGAAAT
CAAACGAGAAGCGCCTGAATATTTCTACAAGTGCTTAGAAGAAAAACTTG
AATTGCATTTCATGGACACTTTAGCATTTATTGATGCCCTCCATAAATTG
ACTATCTGTTGATAAAATAGAGACCTCTAGTTGCTGCTTATGATGTTTAT
TTACCTTTTCTCAATCTGCAGTCATTTTTATTTCTCAAGATATTCTATTC
TTGTCTAGGTTTACTGTGTTGAATATTTAGAATTTTTATCTATTGTTTAT
ACTATAGATTGCTGATTTTTTTTAATGAAAATACGTAGAAATGTTGCTTT
CATTATAAAATTATCTATTATACTATTGAGTTTTTATAACGAATTTCAAC
AAAAGCTATTTTTTGTTTTAATTTGCACATAATTGTGGGTCATACAAACC
CATGCTTAGATTGTATTGACTGCCAACAACAGGTAGGAGAGTAAAAAACT
ATGTATATTGAAGATGATTTAAACAAATTATTCAAATTCTTTAGTCGAGT
TCGTTAACGTTGTCAACTGAATTTTGATTTTATTATTCTGATTTTAAAAT
GTTATTAAAAAGTTTTAATAATTATTGGGAA
back to top

protein sequence of SMED30034374-orf-1

>SMED30034374-orf-1 ID=SMED30034374-orf-1|Name=SMED30034374-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=667bp
MNKSSKRSHSRETTDSVRDVGIDIPQSSKSFTAADAEGFLTKAVKIFTSL
SELNDLKNIYEMGKQLSRLYFDCAEFRPILCSKLIKLEFPEFVVKMMKKL
NNMGIFKHDDIWFSSFYFYNICWNYSESSFEFATALSNASLPSLIVMNLL
HKPYLENLSSRNIYFLIKASLSIMHNLCRYPGNRFMFKSDKVKDALIDFT
SREEELIRVISILCLAFLLEDDEAGVLIKQWNNFTFNFIDIITKAKLHDR
GRFMGFATWELLQALTIFSSNDSVKKAIVDSKGLLMVFDILGKASNVEEV
RECLMIVWNFSFDNDLKSVLIKQHNGLQIVDNFINHEDEDVRNCAAGIKW
LLEDHMKSGRLLTEIVPSQPAPVNSSGFHLYVCFAEENREIVQKIVDRLK
RANLTLVLPKNSNIESALKNQENRFRGIVQSTLFLFVLSEASKSCQQCRS
ETQYAAYLKKPIIPVIVQTKFKPSGWMEKFTDKLFFDFGGKRDFEANIEL
LKNTLLSECMNDEDLKSVHSMKSANSRPEIIAQLPVNCRLQLGHSMDSSH
RHHFNHSASLNSTQPPLLDSTDQLPELVPNKVSSNMSSLESIKKWSKEEV
TEWLVSSDLSHLRLKLSKFNGAMLASLLEIKREAPEYFYKCLEEKLELHF
MDTLAFIDALHKLTIC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR035897Toll_tir_struct_dom_sf
IPR000157TIR_dom
IPR011989ARM-like
IPR016024ARM-type_fold
IPR025786Mononega_L_MeTrfase
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR035897Toll/interleukin-1 receptor homology (TIR) domain superfamilyGENE3DG3DSA:3.40.50.10140coord: 376..505
e-value: 8.2E-10
score: 40.6
IPR035897Toll/interleukin-1 receptor homology (TIR) domain superfamilySUPERFAMILYSSF52200Toll/Interleukin receptor TIR domaincoord: 376..468
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 120..354
e-value: 8.6E-10
score: 39.8
IPR000157Toll/interleukin-1 receptor homology (TIR) domainPFAMPF13676TIR_2coord: 381..500
e-value: 8.4E-12
score: 45.7
NoneNo IPR availablePANTHERPTHR46270FAMILY NOT NAMEDcoord: 76..664
NoneNo IPR availablePANTHERPTHR46270:SF2coord: 76..664
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 120..348