Platelet-activating factor acetylhydrolase IB subunit gamma

Overview
NamePlatelet-activating factor acetylhydrolase IB subunit gamma
Smed IDSMED30034364
Length (bp)1141
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Platelet-activating factor acetylhydrolase IB subunit gamma (SMED30034364) t-SNE clustered cells

Violin plots show distribution of expression levels for Platelet-activating factor acetylhydrolase IB subunit gamma (SMED30034364) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Platelet-activating factor acetylhydrolase IB subunit gamma (SMED30034364) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Platelet-activating factor acetylhydrolase IB subunit gamma (SMED30034364) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034364

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30034364h1SMcG0011823 dd_Smed_v4_4977_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30034364h1SMcG0011823 dd_Smed_v4_4977_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30034364h1SMcG0011823 dd_Smed_v4_4977_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Human
Match: PAFAH1B3 (platelet activating factor acetylhydrolase 1b catalytic subunit 3 [Source:HGNC Symbol;Acc:HGNC:8576])

HSP 1 Score: 189.119 bits (479), Expect = 1.233e-57
Identity = 89/202 (44.06%), Postives = 134/202 (66.34%), Query Frame = 2
Query:   92 NSSSKP---DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKL 688
            N +SKP    D++GDGRW+S H RF+  ++++EP+VV IGDS+++ M     +++   PLH LNFGI  D T ++LWR+ENGEL+ I PK ++V  G +N G +AEQ+  GI +IV L++ERQPQA V+VLG+LP G+ PNP R K  ++N+++      +   + +   P    F+  DG ISH D +DYLH + +GY+ +
Sbjct:    6 NPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPG---FVHSDGTISHHDMYDYLHLSRLGYTPV 204          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Human
Match: PAFAH1B3 (platelet activating factor acetylhydrolase 1b catalytic subunit 3 [Source:HGNC Symbol;Acc:HGNC:8576])

HSP 1 Score: 189.119 bits (479), Expect = 1.233e-57
Identity = 89/202 (44.06%), Postives = 134/202 (66.34%), Query Frame = 2
Query:   92 NSSSKP---DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKL 688
            N +SKP    D++GDGRW+S H RF+  ++++EP+VV IGDS+++ M     +++   PLH LNFGI  D T ++LWR+ENGEL+ I PK ++V  G +N G +AEQ+  GI +IV L++ERQPQA V+VLG+LP G+ PNP R K  ++N+++      +   + +   P    F+  DG ISH D +DYLH + +GY+ +
Sbjct:    6 NPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPG---FVHSDGTISHHDMYDYLHLSRLGYTPV 204          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Human
Match: PAFAH1B2 (platelet activating factor acetylhydrolase 1b catalytic subunit 2 [Source:HGNC Symbol;Acc:HGNC:8575])

HSP 1 Score: 183.726 bits (465), Expect = 1.303e-55
Identity = 88/193 (45.60%), Postives = 128/193 (66.32%), Query Frame = 2
Query:  110 DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKL 688
            +DI+GD RW+SQH RF+   +++EPDV+ +GDS+++ M+    +++   PLH LNFGI  D T ++LWR++NGEL+ I PK I+V  G +N   +AE++  GI +IV LI+ RQPQA +IVLG+LP G +PNP R K +K+N +L    ++   L  V LL     F+  DG IS  D  D+LH T  GY+K+
Sbjct:   16 EDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLK---VSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKI 205          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Human
Match: PAFAH1B3 (platelet activating factor acetylhydrolase 1b catalytic subunit 3 [Source:HGNC Symbol;Acc:HGNC:8576])

HSP 1 Score: 168.318 bits (425), Expect = 1.754e-50
Identity = 75/154 (48.70%), Postives = 111/154 (72.08%), Query Frame = 2
Query:   92 NSSSKP---DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDIL 544
            N +SKP    D++GDGRW+S H RF+  ++++EP+VV IGDS+++ M     +++   PLH LNFGI  D T ++LWR+ENGEL+ I PK ++V  G +N G +AEQ+  GI +IV L++ERQPQA V+VLG+LP G+ PNP R K  ++N+++
Sbjct:    6 NPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELV 159          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Human
Match: PAFAH1B3 (platelet activating factor acetylhydrolase 1b catalytic subunit 3 [Source:HGNC Symbol;Acc:HGNC:8576])

HSP 1 Score: 143.28 bits (360), Expect = 2.171e-40
Identity = 74/200 (37.00%), Postives = 114/200 (57.00%), Query Frame = 2
Query:   98 SSKP---DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKL 688
            +SKP    D++GDGRW+S H RF+  ++++EP+VV IGDS+++ M     +++   PLH LNFGI  D T ++LWR+ENGEL+ I PK ++V  G +N G +AEQ                        G+LP G+ PNP R K  ++N+++      +   + +   P    F+  DG ISH D +DYLH + +GY+ +
Sbjct:    3 ASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQ------------------------GLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPG---FVHSDGTISHHDMYDYLHLSRLGYTPV 175          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Fly
Match: Paf-AHalpha (gene:FBgn0025809 transcript:FBtr0074191)

HSP 1 Score: 162.925 bits (411), Expect = 5.143e-48
Identity = 77/200 (38.50%), Postives = 125/200 (62.50%), Query Frame = 2
Query:  113 DIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKLIDMMLDEL 712
            D++GD RW S H RF+   RE++PDV+ +GD + + ++ +  + K+  PLHCLNF I +D T ++LWRIENG LD ++PK +++H G +N+  SAE++  G+ + V  I ++ P A +++  +LP G++PN  R K +KIN+++       K L  V  +   K  +Q DG ISH D  DY + T+ G  K+++ + D L
Sbjct:   12 DLDGDKRWHSIHRRFISDCREKDPDVIFLGDCIFETVQDTEAWNKYFAPLHCLNFSIRDDCTEHVLWRIENGALDNVNPKIVVLHVGTNNVRNSAEEVAEGVLANVTKIRQKLPNAYIVLPSLLPRGQQPNKLREKNAKINEVVNG---LTKGLYRVQTVAIDKGLVQTDGSISHHDMFDYKNLTNAGAKKILEPLYDLL 208          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Fly
Match: Paf-AHalpha (gene:FBgn0025809 transcript:FBtr0074190)

HSP 1 Score: 162.925 bits (411), Expect = 5.143e-48
Identity = 77/200 (38.50%), Postives = 125/200 (62.50%), Query Frame = 2
Query:  113 DIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKLIDMMLDEL 712
            D++GD RW S H RF+   RE++PDV+ +GD + + ++ +  + K+  PLHCLNF I +D T ++LWRIENG LD ++PK +++H G +N+  SAE++  G+ + V  I ++ P A +++  +LP G++PN  R K +KIN+++       K L  V  +   K  +Q DG ISH D  DY + T+ G  K+++ + D L
Sbjct:   12 DLDGDKRWHSIHRRFISDCREKDPDVIFLGDCIFETVQDTEAWNKYFAPLHCLNFSIRDDCTEHVLWRIENGALDNVNPKIVVLHVGTNNVRNSAEEVAEGVLANVTKIRQKLPNAYIVLPSLLPRGQQPNKLREKNAKINEVVNG---LTKGLYRVQTVAIDKGLVQTDGSISHHDMFDYKNLTNAGAKKILEPLYDLL 208          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Zebrafish
Match: pafah1b3 (platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit [Source:ZFIN;Acc:ZDB-GENE-040426-1026])

HSP 1 Score: 175.252 bits (443), Expect = 1.441e-52
Identity = 82/201 (40.80%), Postives = 132/201 (65.67%), Query Frame = 2
Query:  113 DIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKLIDMMLDELQ 715
            DI+GDGRW+S H RF+  ++ +EPDV+ +GDS+I+ +     ++K   PLH LNFGI  D T ++LWR+ NGELD ISPK +++  G +N G++ EQI  GI +I+++IH++ P ++ +VLG+LP G+ PNP R + + +N ++  +     SL+ V  L     F+  DG I+H+D +DYLH T   Y ++ + + + L+
Sbjct:   16 DIQGDGRWMSLHNRFVSDSKGKEPDVLFVGDSLIQLLHEFEVWRKLFSPLHALNFGIGGDATQHVLWRLINGELDYISPKVVVLWVGTNNHGQTPEQICGGIMAIINVIHQKLPNSHTLVLGLLPRGKSPNPLRERNASVNALVQAE---VASLSHVSFLNMDPGFVHSDGSIAHQDMYDYLHLTPHAYQRVCEPLHEHLK 213          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Zebrafish
Match: pafah1b3 (platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit [Source:ZFIN;Acc:ZDB-GENE-040426-1026])

HSP 1 Score: 175.252 bits (443), Expect = 1.441e-52
Identity = 82/201 (40.80%), Postives = 132/201 (65.67%), Query Frame = 2
Query:  113 DIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKLIDMMLDELQ 715
            DI+GDGRW+S H RF+  ++ +EPDV+ +GDS+I+ +     ++K   PLH LNFGI  D T ++LWR+ NGELD ISPK +++  G +N G++ EQI  GI +I+++IH++ P ++ +VLG+LP G+ PNP R + + +N ++  +     SL+ V  L     F+  DG I+H+D +DYLH T   Y ++ + + + L+
Sbjct:   16 DIQGDGRWMSLHNRFVSDSKGKEPDVLFVGDSLIQLLHEFEVWRKLFSPLHALNFGIGGDATQHVLWRLINGELDYISPKVVVLWVGTNNHGQTPEQICGGIMAIINVIHQKLPNSHTLVLGLLPRGKSPNPLRERNASVNALVQAE---VASLSHVSFLNMDPGFVHSDGSIAHQDMYDYLHLTPHAYQRVCEPLHEHLK 213          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Zebrafish
Match: pafah1b3 (platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit [Source:ZFIN;Acc:ZDB-GENE-040426-1026])

HSP 1 Score: 175.252 bits (443), Expect = 1.441e-52
Identity = 82/201 (40.80%), Postives = 132/201 (65.67%), Query Frame = 2
Query:  113 DIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKLIDMMLDELQ 715
            DI+GDGRW+S H RF+  ++ +EPDV+ +GDS+I+ +     ++K   PLH LNFGI  D T ++LWR+ NGELD ISPK +++  G +N G++ EQI  GI +I+++IH++ P ++ +VLG+LP G+ PNP R + + +N ++  +     SL+ V  L     F+  DG I+H+D +DYLH T   Y ++ + + + L+
Sbjct:   16 DIQGDGRWMSLHNRFVSDSKGKEPDVLFVGDSLIQLLHEFEVWRKLFSPLHALNFGIGGDATQHVLWRLINGELDYISPKVVVLWVGTNNHGQTPEQICGGIMAIINVIHQKLPNSHTLVLGLLPRGKSPNPLRERNASVNALVQAE---VASLSHVSFLNMDPGFVHSDGSIAHQDMYDYLHLTPHAYQRVCEPLHEHLK 213          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Zebrafish
Match: pafah1b3 (platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit [Source:ZFIN;Acc:ZDB-GENE-040426-1026])

HSP 1 Score: 175.252 bits (443), Expect = 4.619e-52
Identity = 85/218 (38.99%), Postives = 138/218 (63.30%), Query Frame = 2
Query:   83 KIMNSSSKP-------DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKLIDMMLDELQ 715
            ++M+  S P        DI+GDGRW+S H RF+  ++ +EPDV+ +GDS+I+ +     ++K   PLH LNFGI  D T ++LWR+ NGELD ISPK +++  G +N G++ EQI  GI +I+++IH++ P ++ +VLG+LP G+ PNP R + + +N ++  +     SL+ V  L     F+  DG I+H+D +DYLH T   Y ++ + + + L+
Sbjct:   46 EVMSGDSNPAATPTPCQDIQGDGRWMSLHNRFVSDSKGKEPDVLFVGDSLIQLLHEFEVWRKLFSPLHALNFGIGGDATQHVLWRLINGELDYISPKVVVLWVGTNNHGQTPEQICGGIMAIINVIHQKLPNSHTLVLGLLPRGKSPNPLRERNASVNALVQAE---VASLSHVSFLNMDPGFVHSDGSIAHQDMYDYLHLTPHAYQRVCEPLHEHLK 260          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Zebrafish
Match: pafah1b2 (platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 [Source:ZFIN;Acc:ZDB-GENE-060526-43])

HSP 1 Score: 171.785 bits (434), Expect = 2.866e-51
Identity = 81/202 (40.10%), Postives = 125/202 (61.88%), Query Frame = 2
Query:   92 NSSSKP---DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKL 688
            N +++P    D++GDGRW+SQH RF+ + ++ EPDV+ +GDS+++ M+    +++   PLH LNFGI  D TSN++WR++NGEL+ I P+ ++V  G +N   +A+Q+  GI +I  L+  R P++ +IVLG+LP G  PNP R K + +N++L         L  +  L     F+  DG IS RD  DYLH T   Y  +
Sbjct:    6 NPAAEPAPVTDVQGDGRWMSQHNRFVQECKDAEPDVLFVGDSMVQLMQQYEVWRELFSPLHALNFGIGGDTTSNVMWRLQNGELENIRPRVVVVWVGTNNHEHTADQVAGGILAIAQLLLSRLPKSKMIVLGLLPRGEFPNPLREKNASVNNLLRASL---PRLGPIQFLDMGSSFVHSDGTISSRDMFDYLHLTASAYRTI 204          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Xenopus
Match: fkbp4 (FKBP prolyl isomerase 4 [Source:Xenbase;Acc:XB-GENE-948088])

HSP 1 Score: 184.882 bits (468), Expect = 3.385e-56
Identity = 89/192 (46.35%), Postives = 125/192 (65.10%), Query Frame = 2
Query:  113 DIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKL 688
            DI+GDGRW+S H  F+  ++++EP+VV IGDS ++ M     +++   PLH LNFG   D T ++LWR+ENGELD + PK I++  G +N G SAEQI  GI +IV  I++RQPQA VIV+ +LP G+ PNP R +  ++N +L E   T  SL    LL     F+  DG ISH D +DYLH +  GY+++
Sbjct:   17 DIQGDGRWMSMHNHFVSSSKDKEPEVVFIGDSNVQIMHQFEVWRELFSPLHALNFGGLSDGTQHVLWRLENGELDHVKPKIIVLWVGTYNQGHSAEQIAGGILAIVRCIYQRQPQAKVIVMALLPRGKNPNPLRNRNLQVNKLLEE---TLPSLPNAFLLDADPGFVHSDGTISHHDMYDYLHLSRHGYARV 205          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Xenopus
Match: PAFAH1B2 (platelet activating factor acetylhydrolase 1b catalytic subunit 2 [Source:NCBI gene;Acc:100492775])

HSP 1 Score: 176.022 bits (445), Expect = 2.920e-52
Identity = 85/202 (42.08%), Postives = 132/202 (65.35%), Query Frame = 2
Query:   92 NSSSKP---DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKL 688
            NS++ P   +D++GD RW+SQH RF+   +++EPDV+ +GDS+++ M+    +++   PLH LNFGI  D T ++LWR++NGEL+ I PK I++  G +N   SAE++  G+ +I+++I+  QPQA +IV+ +LP G +PNP R K +++N IL   W+    L  V LL     F+  DG IS  D  D+LH T  GY+K+
Sbjct:   37 NSAAVPLAAEDLQGDDRWLSQHNRFVLDCKDKEPDVLFVGDSLVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLQNGELENIKPKVIVLWIGTNNHENSAEEVAGGVEAIINVINILQPQAKIIVMALLPRGEKPNPLREKNARVNHIL-RSWLPR--LPGVQLLDVDNGFVHSDGTISRHDMFDFLHLTAAGYAKV 235          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Mouse
Match: Pafah1b2 (platelet-activating factor acetylhydrolase, isoform 1b, subunit 2 [Source:MGI Symbol;Acc:MGI:108415])

HSP 1 Score: 182.956 bits (463), Expect = 2.021e-55
Identity = 88/193 (45.60%), Postives = 128/193 (66.32%), Query Frame = 2
Query:  110 DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKL 688
            +DI+GD RW+SQH RF+   +++EPDV+ +GDS+++ M+    +++   PLH LNFGI  D T ++LWR++NGEL+ I PK I+V  G +N   +AE++  GI +IV LI+ RQPQA +IVLG+LP G +PNP R K +K+N +L    ++   L  V LL     F+  DG IS  D  D+LH T  GY+K+
Sbjct:   16 EDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLK---VSLPKLANVQLLDIDGGFVHSDGAISCHDMFDFLHLTGGGYAKI 205          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Mouse
Match: Pafah1b2 (platelet-activating factor acetylhydrolase, isoform 1b, subunit 2 [Source:MGI Symbol;Acc:MGI:108415])

HSP 1 Score: 182.956 bits (463), Expect = 2.021e-55
Identity = 88/193 (45.60%), Postives = 128/193 (66.32%), Query Frame = 2
Query:  110 DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKL 688
            +DI+GD RW+SQH RF+   +++EPDV+ +GDS+++ M+    +++   PLH LNFGI  D T ++LWR++NGEL+ I PK I+V  G +N   +AE++  GI +IV LI+ RQPQA +IVLG+LP G +PNP R K +K+N +L    ++   L  V LL     F+  DG IS  D  D+LH T  GY+K+
Sbjct:   16 EDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLK---VSLPKLANVQLLDIDGGFVHSDGAISCHDMFDFLHLTGGGYAKI 205          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Mouse
Match: Pafah1b3 (platelet-activating factor acetylhydrolase, isoform 1b, subunit 3 [Source:MGI Symbol;Acc:MGI:108414])

HSP 1 Score: 181.03 bits (458), Expect = 1.140e-54
Identity = 86/202 (42.57%), Postives = 132/202 (65.35%), Query Frame = 2
Query:   92 NSSSKP---DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKL 688
            N +SKP    D++GDGRW+S H RF+  ++++EP+VV IGDS+++ M     +++   PLH LNFGI  D+T ++LWR+ENGEL+ I PK ++V  G +N   +AEQ+  GI +IV L+++ QPQA V+VLG+LP G+ PNP R K  ++N+++          + +   P    F+  DG ISH D +DYLH + +GY+ +
Sbjct:    7 NPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHSHTAEQVTGGIKAIVQLVNKLQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGYPRAHFLDADPG---FVHSDGTISHHDMYDYLHLSRLGYTPV 205          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Mouse
Match: Pafah1b2 (platelet-activating factor acetylhydrolase, isoform 1b, subunit 2 [Source:MGI Symbol;Acc:MGI:108415])

HSP 1 Score: 175.252 bits (443), Expect = 7.319e-53
Identity = 84/184 (45.65%), Postives = 122/184 (66.30%), Query Frame = 2
Query:  110 DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLH 661
            +DI+GD RW+SQH RF+   +++EPDV+ +GDS+++ M+    +++   PLH LNFGI  D T ++LWR++NGEL+ I PK I+V  G +N   +AE++  GI +IV LI+ RQPQA +IVLG+LP G +PNP R K +K+N +L    ++   L  V LL     F+  DG IS  D  D+LH
Sbjct:   16 EDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLK---VSLPKLANVQLLDIDGGFVHSDGAISCHDMFDFLH 196          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Mouse
Match: Pafah1b3 (platelet-activating factor acetylhydrolase, isoform 1b, subunit 3 [Source:MGI Symbol;Acc:MGI:108414])

HSP 1 Score: 146.362 bits (368), Expect = 1.697e-42
Identity = 66/137 (48.18%), Postives = 98/137 (71.53%), Query Frame = 2
Query:   92 NSSSKP---DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCG 493
            N +SKP    D++GDGRW+S H RF+  ++++EP+VV IGDS+++ M     +++   PLH LNFGI  D+T ++LWR+ENGEL+ I PK ++V  G +N   +AEQ+  GI +IV L+++ QPQA V+VLG+LP G
Sbjct:    7 NPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHSHTAEQVTGGIKAIVQLVNKLQPQARVVVLGLLPRG 143          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. UniProt/SwissProt
Match: sp|Q29460|PA1B3_BOVIN (Platelet-activating factor acetylhydrolase IB subunit gamma OS=Bos taurus OX=9913 GN=PAFAH1B3 PE=1 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 4.567e-57
Identity = 89/202 (44.06%), Postives = 135/202 (66.83%), Query Frame = 2
Query:   92 NSSSKP---DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKL 688
            N +SKP    D++GDGRW+S H RF+  ++++EP+VV IGDS+++ M     +++   PLH LNFGI  D+T ++LWR+ENGEL+ I PK ++V  G +N G +AEQ+  GI +IV L++ERQPQA V+VLG+LP G+ PNP R K  ++N+++      +   + +   P    F+  DG ISH D +DYLH + +GY+ +
Sbjct:    6 NPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRRVNELVRAALAGHPRAHFLDADPG---FVHSDGTISHHDMYDYLHLSRLGYTPV 204          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. UniProt/SwissProt
Match: sp|Q15102|PA1B3_HUMAN (Platelet-activating factor acetylhydrolase IB subunit gamma OS=Homo sapiens OX=9606 GN=PAFAH1B3 PE=1 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 5.920e-57
Identity = 89/202 (44.06%), Postives = 134/202 (66.34%), Query Frame = 2
Query:   92 NSSSKP---DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKL 688
            N +SKP    D++GDGRW+S H RF+  ++++EP+VV IGDS+++ M     +++   PLH LNFGI  D T ++LWR+ENGEL+ I PK ++V  G +N G +AEQ+  GI +IV L++ERQPQA V+VLG+LP G+ PNP R K  ++N+++      +   + +   P    F+  DG ISH D +DYLH + +GY+ +
Sbjct:    6 NPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPG---FVHSDGTISHHDMYDYLHLSRLGYTPV 204          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. UniProt/SwissProt
Match: sp|Q5R6X1|PA1B3_PONAB (Platelet-activating factor acetylhydrolase IB subunit gamma OS=Pongo abelii OX=9601 GN=PAFAH1B3 PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 6.554e-56
Identity = 88/202 (43.56%), Postives = 133/202 (65.84%), Query Frame = 2
Query:   92 NSSSKP---DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKL 688
            N +SKP    D++GDGRW+S H RF+  ++++EP+VV IGDS+++ M     +++   PLH LNFGI  D T ++LWR+ENGEL+ I PK ++V  G +N G +AEQ+  GI +IV L++ERQPQA V+VL +LP G+ PNP R K  ++N+++      +   + +   P    F+  DG ISH D +DYLH + +GY+ +
Sbjct:    6 NPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLDLLPRGQHPNPLREKNQRVNELVRAALAGHPRAHFLDADPG---FVHSDGTISHHDMYDYLHLSRLGYAPV 204          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. UniProt/SwissProt
Match: sp|Q5R4G2|PA1B2_PONAB (Platelet-activating factor acetylhydrolase IB subunit beta OS=Pongo abelii OX=9601 GN=PAFAH1B2 PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 6.258e-55
Identity = 88/193 (45.60%), Postives = 128/193 (66.32%), Query Frame = 2
Query:  110 DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKL 688
            +DI+GD RW+SQH RF+   +++EPDV+ +GDS+++ M+    +++   PLH LNFGI  D T ++LWR++NGEL+ I PK I+V  G +N   +AE++  GI +IV LI+ RQPQA +IVLG+LP G +PNP R K +K+N +L    ++   L  V LL     F+  DG IS  D  D+LH T  GY+K+
Sbjct:   16 EDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLK---VSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKI 205          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. UniProt/SwissProt
Match: sp|P68402|PA1B2_HUMAN (Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B2 PE=1 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 6.258e-55
Identity = 88/193 (45.60%), Postives = 128/193 (66.32%), Query Frame = 2
Query:  110 DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKL 688
            +DI+GD RW+SQH RF+   +++EPDV+ +GDS+++ M+    +++   PLH LNFGI  D T ++LWR++NGEL+ I PK I+V  G +N   +AE++  GI +IV LI+ RQPQA +IVLG+LP G +PNP R K +K+N +L    ++   L  V LL     F+  DG IS  D  D+LH T  GY+K+
Sbjct:   16 EDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLK---VSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKI 205          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. TrEMBL
Match: A0A504YQJ3 (Platelet-activating factor acetylhydrolase IB subunit gamma OS=Fasciola gigantica OX=46835 GN=FGIG_07313 PE=4 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 1.806e-84
Identity = 119/219 (54.34%), Postives = 165/219 (75.34%), Query Frame = 2
Query:  113 DIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKLIDMMLDELQIAMPSSFLKPDQALNVAV 769
            D  GDG WISQH RF+ QT EREPDVVL+GDS++  M+F+  Y+ +LEPLHC+NF IY D T NILWRIENGEL G SPK I++  G HN+  SAE++V GI++IV+ + ++QP A+VIV+G+LPCGREPNPRR K+ K+N +L++++  ++      + PDW+ FIQP+G ISHRD +DY+HPT+ GY+KL D +++ELQ ++  +FLK +   N  V
Sbjct:   11 DPAGDGCWISQHMRFVFQTSEREPDVVLLGDSILLHMQFTKVYQTYLEPLHCVNFSIYSDQTQNILWRIENGELGGFSPKVIVIMIGTHNVTHSAEEVVRGITTIVETVKKKQPHASVIVMGLLPCGREPNPRRAKHEKVNKLLSKEF--DQQSKVTFIHPDWENFIQPNGTISHRDMYDYMHPTESGYAKLADPLIEELQNSL-QTFLKTNAPSNSLV 226          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. TrEMBL
Match: A0A4E0R2G4 (Platelet-activating factor acetylhydrolase IB subunit gamma OS=Fasciola hepatica OX=6192 GN=D915_009565 PE=4 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 2.913e-84
Identity = 119/219 (54.34%), Postives = 164/219 (74.89%), Query Frame = 2
Query:  113 DIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKLIDMMLDELQIAMPSSFLKPDQALNVAV 769
            D  GDG WISQH RF+ QT EREPDVVL+GDS++  M+F+  Y+ +LEPLHC+NF IY D T NILWRIENGEL G SPK I++  G HN+  SAE++V GI++IV+ +  +QP A+VIV+G+LPCGREPNPRR K+ K+N +L++++  ++      + PDW+ FIQP+G ISHRD +DY+HPT+ GY+KL D +++ELQ ++  +FLK +   N  V
Sbjct:   11 DPAGDGCWISQHMRFVFQTSEREPDVVLLGDSILLNMQFTKVYQTYLEPLHCVNFSIYSDQTQNILWRIENGELGGFSPKVIVIMIGTHNVTHSAEEVVRGITTIVETVKRKQPHASVIVMGLLPCGREPNPRRAKHEKVNKLLSKEF--DQQSKVTFIHPDWENFIQPNGTISHRDMYDYMHPTESGYAKLADPLIEELQNSL-QTFLKTNAPSNSLV 226          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. TrEMBL
Match: A0A3Q0KHP9 (Putative platelet-activating factor acetylhydrolase ib OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 7.331e-83
Identity = 118/212 (55.66%), Postives = 157/212 (74.06%), Query Frame = 2
Query:  107 PDDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKLIDMMLDELQIAMPSSFLK 742
            P D EGDGRW+SQHTRF+CQ R++EPDVVL+GDS+   M+F+  YKK +EPLHC+NF I  D T N+LWRIENGELDG SPK +++  G+HN+ +S E++V GI S+V+    +QP+A++IV+G+LPCGR PN RR K+ +IN +LTE +      +   L PDW  FIQ DG ISHRD  DY+HPT+ GY KL D +L+ELQ ++  +FLK
Sbjct:    9 PPDTEGDGRWMSQHTRFVCQARKKEPDVVLLGDSIFVYMQFTQTYKKHIEPLHCVNFSISNDQTQNVLWRIENGELDGFSPKVVVIMIGSHNVNDSEEEVVKGILSVVEKTKSKQPRASLIVMGLLPCGRTPNKRRTKHEQINKLLTEAFTCRP--DVTYLNPDWDNFIQQDGTISHRDMFDYMHPTENGYEKLCDPLLEELQNSL-HTFLK 217          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. TrEMBL
Match: A0A4S2JKZ1 (SGNH_hydro domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_011384 PE=4 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 5.296e-81
Identity = 117/225 (52.00%), Postives = 158/225 (70.22%), Query Frame = 2
Query:  107 PDDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKLIDMMLDELQIAMPSSFLKPDQALNVAVSGES 781
            P D  GD  W+SQH RF CQT E EPDVV +GDS++  M+FS  YK ++ PLHC+NF +Y D T ++LWRIENGELDG SPK I++  G HN+  + E++V GI ++V+   E+QPQA +IV+G+LPCGR+PNPRR K+ +IN +L  +   ++      L PDW+QF+QP+G ISHRD  DYLHP + GY+KL + ++DELQ  +  +FLK D   N AV  ES
Sbjct:    9 PSDTCGDNCWMSQHIRFRCQTTENEPDVVFLGDSILLHMQFSQVYKTYIVPLHCVNFSVYHDETQHVLWRIENGELDGFSPKVIVIMVGTHNVSHTPEEVVRGILAVVEKAREKQPQAAMIVMGLLPCGRDPNPRRAKHEQINKLLAAE--LSQRPQVTFLSPDWEQFVQPNGTISHRDMFDYLHPAENGYNKLAEPLIDELQNLL-QTFLKTDAPSNSAVVEES 230          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. TrEMBL
Match: A0A5J4N9Y2 (Platelet-activating factor acetylhydrolase IB subunit beta/gamma OS=Paragonimus westermani OX=34504 GN=DEA37_0000649 PE=4 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 6.647e-81
Identity = 119/223 (53.36%), Postives = 159/223 (71.30%), Query Frame = 2
Query:  101 SKPDDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKLIDMMLDELQIAMPSSFLKPDQALNVAV 769
            S P D+ GD  W SQH RF+CQT E+EPDVV +GDS++  M+F+  YK ++EPLHC+NF I  D T N+LWRIENGELDG SPK I+V  G+HN+  +AE++V GI  IV+   E+QP A++IV+G+LPCGR+PN RR K+ KIN +L E++  N+      L PDW  FIQPDG ISHRD +DY HPT+ GY KL + +++ELQ ++  +FLK +   N  V
Sbjct:    7 SVPHDLSGDHCWNSQHVRFVCQTTEKEPDVVFLGDSILLHMQFTQVYKTYIEPLHCVNFSISGDQTQNVLWRIENGELDGFSPKVIVVMIGSHNLTHTAEEVVEGIQRIVEKAREKQPHASIIVMGLLPCGRDPNIRRTKHEKINKLLAEEF--NQKSQVTFLNPDWDLFIQPDGTISHRDMYDYAHPTESGYVKLAEPLIEELQNSL-QTFLKTNAPANSFV 226          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Cavefish
Match: PAFAH1B2 (platelet-activating factor acetylhydrolase IB subunit beta [Source:NCBI gene;Acc:103030597])

HSP 1 Score: 177.948 bits (450), Expect = 1.116e-53
Identity = 91/217 (41.94%), Postives = 129/217 (59.45%), Query Frame = 2
Query:  110 DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSK----LIDMML-------DELQIAMP 727
            +D++GD RW+SQH RF+ + ++ EPDV+ +GDS+++ M+    +K+   PLH LNFGI  D T N+LWR++NGEL  I PK ++V  G  N   +AEQ+  G+  IV L+  + P   +I+LG+LP G   NP R K +K+ND+L     +   L++V LL     F   DG IS RD  DYLH T  GY K    L D++L       DE Q  +P
Sbjct:   16 EDVQGDARWMSQHNRFVQECKDAEPDVLFVGDSMVQLMQQQEVWKELFSPLHVLNFGIAGDTTCNVLWRLQNGELHNIKPKVVVVWVGTTNYQHTAEQVSGGVMEIVQLLINQIPHTKIILLGLLPRGERQNPLREKNAKVNDLLRA---SASRLSSVQLLDLSSGFTHSDGTISSRDMFDYLHLTSAGYRKVARPLHDLLLQILEETPDEKQTTLP 229          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Cavefish
Match: PAFAH1B2 (platelet-activating factor acetylhydrolase IB subunit beta [Source:NCBI gene;Acc:103030597])

HSP 1 Score: 177.948 bits (450), Expect = 1.116e-53
Identity = 91/217 (41.94%), Postives = 129/217 (59.45%), Query Frame = 2
Query:  110 DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSK----LIDMML-------DELQIAMP 727
            +D++GD RW+SQH RF+ + ++ EPDV+ +GDS+++ M+    +K+   PLH LNFGI  D T N+LWR++NGEL  I PK ++V  G  N   +AEQ+  G+  IV L+  + P   +I+LG+LP G   NP R K +K+ND+L     +   L++V LL     F   DG IS RD  DYLH T  GY K    L D++L       DE Q  +P
Sbjct:   16 EDVQGDARWMSQHNRFVQECKDAEPDVLFVGDSMVQLMQQQEVWKELFSPLHVLNFGIAGDTTCNVLWRLQNGELHNIKPKVVVVWVGTTNYQHTAEQVSGGVMEIVQLLINQIPHTKIILLGLLPRGERQNPLREKNAKVNDLLRA---SASRLSSVQLLDLSSGFTHSDGTISSRDMFDYLHLTSAGYRKVARPLHDLLLQILEETPDEKQTTLP 229          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Cavefish
Match: pafah1b2 (platelet-activating factor acetylhydrolase IB subunit beta [Source:NCBI gene;Acc:103024507])

HSP 1 Score: 176.792 bits (447), Expect = 2.995e-53
Identity = 85/200 (42.50%), Postives = 126/200 (63.00%), Query Frame = 2
Query:   92 NSSSKP---DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYS 682
            N +++P    D++GDGRW+SQH RF+ + ++ EPDV+ +GDS+++ M+    +++   PLH LNFGI  D T+N+LWR++NGEL+ I P+ +++  G +N   +AEQ+  GI +IV L+H R P+A +IVL +LP G  PNP R K S +N+ L         L  V  L     F+  DG +S RD  D+LH T  GYS
Sbjct:    6 NPAAEPLPVQDVQGDGRWMSQHNRFVQECKDAEPDVLFVGDSMVQLMQQYEVWRELFSPLHALNFGIGGDTTNNVLWRLQNGELENIRPRVVVLWVGTNNHEHTAEQVTGGIVAIVQLLHSRLPKAKIIVLALLPRGELPNPLREKNSAVNNYLRAAL---PRLGPVQFLDVSGGFVHSDGTVSCRDMFDFLHLTASGYS 202          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Cavefish
Match: pafah1b2 (platelet-activating factor acetylhydrolase IB subunit beta [Source:NCBI gene;Acc:103024507])

HSP 1 Score: 176.792 bits (447), Expect = 2.995e-53
Identity = 85/200 (42.50%), Postives = 126/200 (63.00%), Query Frame = 2
Query:   92 NSSSKP---DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYS 682
            N +++P    D++GDGRW+SQH RF+ + ++ EPDV+ +GDS+++ M+    +++   PLH LNFGI  D T+N+LWR++NGEL+ I P+ +++  G +N   +AEQ+  GI +IV L+H R P+A +IVL +LP G  PNP R K S +N+ L         L  V  L     F+  DG +S RD  D+LH T  GYS
Sbjct:    6 NPAAEPLPVQDVQGDGRWMSQHNRFVQECKDAEPDVLFVGDSMVQLMQQYEVWRELFSPLHALNFGIGGDTTNNVLWRLQNGELENIRPRVVVLWVGTNNHEHTAEQVTGGIVAIVQLLHSRLPKAKIIVLALLPRGELPNPLREKNSAVNNYLRAAL---PRLGPVQFLDVSGGFVHSDGTVSCRDMFDFLHLTASGYS 202          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Cavefish
Match: pafah1b3 (platelet activating factor acetylhydrolase 1b catalytic subunit 3 [Source:NCBI gene;Acc:103039607])

HSP 1 Score: 175.252 bits (443), Expect = 9.652e-53
Identity = 86/207 (41.55%), Postives = 134/207 (64.73%), Query Frame = 2
Query:   89 MNSSSKP-------DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKL 688
            M+S S P       +D++GDGRW+S H RF+  ++ +EP+V+ +GDS+++ +     ++K   PLH LNFGI  D T ++LWR+ NGELD I+PK +++  G +N G + EQI  GI +IV++I++R PQ +++VLG+LP G+ PNP R + +K+N+++    +   SL+    L     FI  DG ISH+D +DYLH T   Y K+
Sbjct:    1 MSSDSNPAATPTPCEDVQGDGRWMSMHHRFVSDSKGKEPEVLFVGDSLVQLLHEFEVWRKLFSPLHTLNFGIGGDATQHVLWRLTNGELDHINPKVVVLWVGTNNHGHTPEQICGGIMAIVNVINQRLPQTHILVLGILPRGKSPNPLRDRNAKVNELVQ---VELASLSYTSFLNVDPGFIHSDGSISHQDLYDYLHLTPHAYQKV 204          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Sea Lamprey
Match: pafah1b3 (platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit [Source:ZFIN;Acc:ZDB-GENE-040426-1026])

HSP 1 Score: 160.614 bits (405), Expect = 1.323e-47
Identity = 76/194 (39.18%), Postives = 119/194 (61.34%), Query Frame = 2
Query:  113 DIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLN--TVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKL 688
            D +GD RW+S H  ++ + + +EP+++ +GDS+++ +     +K+   PLH LNFGI  D T ++LWR++NGEL+ I PK I+V  G +N   + E+I  GI +IV  I+E+ PQA V+VLG+LP GR+PNP R K  ++N+++ +  +    +       L D   F+  DG I   D +D+LH T  GY  L
Sbjct:   17 DTQGDRRWMSIHESYVIECKSKEPEILFVGDSMVQLLGQYEIWKRLFSPLHALNFGIGGDETQHVLWRLQNGELENIDPKVIVVWVGTNNHKHTPEEISEGILAIVTYINEKHPQAAVVVLGLLPRGRDPNPLREKNLRVNELVAKALVPANDVKPPRAHFLDDNYGFVHSDGTIGRSDMYDFLHLTTGGYENL 210          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Nematostella
Match: EDO46036 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR23])

HSP 1 Score: 158.303 bits (399), Expect = 1.241e-46
Identity = 82/193 (42.49%), Postives = 117/193 (60.62%), Query Frame = 2
Query:  113 DIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKLI 691
            D++GD RW+S H RFL + ++    V+ +GDS+I  M  +  ++++ +PL  LNFGI  D T N LWR++NGEL  I PK +++  G +N G +AEQIV GI  IV  IHE  P A V+VLG+LP G +PNP R ++ ++N  L +  I         L  D   F++ DG+I H D  DYLH T  GY + +
Sbjct:   13 DVQGDRRWMSMHERFLREGKDSACQVLFVGDSLIFHMHDTQEWEEYFKPLRVLNFGIGGDRTENTLWRLQNGELSSIEPKVVVLLVGTNNHGCTAEQIVEGIECIVWTIHELVPDAKVLVLGLLPRGEKPNPIRERHFEVNHALKD--IIPAIPGATFLDAD-PGFVRSDGMIDHTDMADYLHLTRKGYKRFM 202          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Nematostella
Match: EDO32560 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUP9])

HSP 1 Score: 110.153 bits (274), Expect = 1.246e-28
Identity = 64/190 (33.68%), Postives = 108/190 (56.84%), Query Frame = 2
Query:  131 RWISQHTRFLCQTREREPDVVLIGDSVIKCM-EFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIG-ESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKW-ITNKSLNTVLLLPDWKQFIQPDGIISHRDQH-DYLHPTDMGYSKL 688
            RW   H ++   T      V+L+GDS+IK +  +++ ++++  PL  L+FGI  D T ++LWR++NGEL+  +P+ +++H G +N+  + A  IV GI +IV  I  + P   ++V G+LP    P+ RR K S++N  L E    +++  +   L PD   +++ DG +     H DYLH  + G  KL
Sbjct:    1 RWQETHEQYSRLTSSPMNQVLLVGDSIIKGLTRYASVWQEYFRPLRALSFGIGGDRTQHVLWRLQNGELES-TPRILVLHCGTNNVNTDHASDIVGGILAIVQFIQSKSPSTTIVVTGLLPRDLYPSFRRKKISEVNRQLEELIDFSDEFADVHFLRPD-DDWVRGDGTLEESFYHTDYLHLVEAGDRKL 188          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Medaka
Match: pafah1b3 (platelet activating factor acetylhydrolase 1b catalytic subunit 3 [Source:NCBI gene;Acc:101160583])

HSP 1 Score: 176.022 bits (445), Expect = 6.711e-53
Identity = 82/194 (42.27%), Postives = 124/194 (63.92%), Query Frame = 2
Query:  113 DIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKLID 694
            DI GDGRW+S H  F+ ++++REPDV+ +GDS+I+ M     +++   PLHCLNFGI  D T ++LWR+ NGELD ISPK +++  G +N G + EQI  GI +IV +I  + P A  ++LG+LP G+ PNP R + +++N ++ E   +    +   + P    F+  DG ISH+D +DYLH T  GY  + +
Sbjct:   17 DIHGDGRWMSLHNHFVAESKDREPDVLFVGDSLIQLMHQFGIWRQLFSPLHCLNFGIGGDATQHVLWRLSNGELDNISPKVVVLWVGTNNHGHTPEQICGGIMAIVQVIKNKLPDAQTLILGLLPRGKSPNPLRERNAQVNKLVKEAVSSLPHASFYNVDPG---FVLSDGSISHQDMYDYLHLTQKGYQAVCE 207          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Medaka
Match: pafah1b2 (platelet-activating factor acetylhydrolase IB subunit beta [Source:NCBI gene;Acc:101159126])

HSP 1 Score: 174.866 bits (442), Expect = 1.611e-52
Identity = 85/206 (41.26%), Postives = 128/206 (62.14%), Query Frame = 2
Query:  110 DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSK----LIDMMLDELQ 715
            +D++GDGRW+SQHTRF+ + ++ EPDV+ IGDS+++ M+    +++   PLH LNFGI  D T N+LWR++NGEL+ I PK +++  G +N   +AEQ+  GI +I  ++  R P+A ++VL +LP G  PN  R K + +N  L   W+    L   L L   ++F+  DG IS +D  DYLH T  GY      L D++L  L+
Sbjct:   16 EDVQGDGRWLSQHTRFVQECKDAEPDVLFIGDSMVQLMQQHEVWREVFSPLHALNFGIAGDTTCNVLWRLQNGELENIRPKVVVLWVGTNNHEHTAEQVAGGILAIAQMLTTRLPKAKIVVLSLLPRGERPNLLREKNATVNG-LVRSWLPR--LRQALFLDVSREFVHSDGAISPQDMFDYLHLTAAGYRTISKPLSDLLLQILE 218          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Medaka
Match: pafah1b2 (platelet-activating factor acetylhydrolase IB subunit beta [Source:NCBI gene;Acc:101159126])

HSP 1 Score: 174.866 bits (442), Expect = 1.611e-52
Identity = 85/206 (41.26%), Postives = 128/206 (62.14%), Query Frame = 2
Query:  110 DDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSK----LIDMMLDELQ 715
            +D++GDGRW+SQHTRF+ + ++ EPDV+ IGDS+++ M+    +++   PLH LNFGI  D T N+LWR++NGEL+ I PK +++  G +N   +AEQ+  GI +I  ++  R P+A ++VL +LP G  PN  R K + +N  L   W+    L   L L   ++F+  DG IS +D  DYLH T  GY      L D++L  L+
Sbjct:   16 EDVQGDGRWLSQHTRFVQECKDAEPDVLFIGDSMVQLMQQHEVWREVFSPLHALNFGIAGDTTCNVLWRLQNGELENIRPKVVVLWVGTNNHEHTAEQVAGGILAIAQMLTTRLPKAKIVVLSLLPRGERPNLLREKNATVNG-LVRSWLPR--LRQALFLDVSREFVHSDGAISPQDMFDYLHLTAAGYRTISKPLSDLLLQILE 218          
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Planmine SMEST
Match: SMESG000016097.1 (SMESG000016097.1)

HSP 1 Score: 481.1 bits (1237), Expect = 8.359e-173
Identity = 232/232 (100.00%), Postives = 232/232 (100.00%), Query Frame = 2
Query:   89 MNSSSKPDDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKLIDMMLDELQIAMPSSFLKPDQALNVAVSGESS 784
            MNSSSKPDDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKLIDMMLDELQIAMPSSFLKPDQALNVAVSGESS
Sbjct:    1 MNSSSKPDDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAPYKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIGESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKINDILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKLIDMMLDELQIAMPSSFLKPDQALNVAVSGESS 232          
The following BLAST results are available for this feature:
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAFAH1B31.233e-5744.06platelet activating factor acetylhydrolase 1b cata... [more]
PAFAH1B31.233e-5744.06platelet activating factor acetylhydrolase 1b cata... [more]
PAFAH1B21.303e-5545.60platelet activating factor acetylhydrolase 1b cata... [more]
PAFAH1B31.754e-5048.70platelet activating factor acetylhydrolase 1b cata... [more]
PAFAH1B32.171e-4037.00platelet activating factor acetylhydrolase 1b cata... [more]
back to top
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Paf-AHalpha5.143e-4838.50gene:FBgn0025809 transcript:FBtr0074191[more]
Paf-AHalpha5.143e-4838.50gene:FBgn0025809 transcript:FBtr0074190[more]
back to top
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pafah1b31.441e-5240.80platelet-activating factor acetylhydrolase, isofor... [more]
pafah1b31.441e-5240.80platelet-activating factor acetylhydrolase, isofor... [more]
pafah1b31.441e-5240.80platelet-activating factor acetylhydrolase, isofor... [more]
pafah1b34.619e-5238.99platelet-activating factor acetylhydrolase, isofor... [more]
pafah1b22.866e-5140.10platelet-activating factor acetylhydrolase 1b, cat... [more]
back to top
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fkbp43.385e-5646.35FKBP prolyl isomerase 4 [Source:Xenbase;Acc:XB-GEN... [more]
PAFAH1B22.920e-5242.08platelet activating factor acetylhydrolase 1b cata... [more]
back to top
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pafah1b22.021e-5545.60platelet-activating factor acetylhydrolase, isofor... [more]
Pafah1b22.021e-5545.60platelet-activating factor acetylhydrolase, isofor... [more]
Pafah1b31.140e-5442.57platelet-activating factor acetylhydrolase, isofor... [more]
Pafah1b27.319e-5345.65platelet-activating factor acetylhydrolase, isofor... [more]
Pafah1b31.697e-4248.18platelet-activating factor acetylhydrolase, isofor... [more]
back to top
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q29460|PA1B3_BOVIN4.567e-5744.06Platelet-activating factor acetylhydrolase IB subu... [more]
sp|Q15102|PA1B3_HUMAN5.920e-5744.06Platelet-activating factor acetylhydrolase IB subu... [more]
sp|Q5R6X1|PA1B3_PONAB6.554e-5643.56Platelet-activating factor acetylhydrolase IB subu... [more]
sp|Q5R4G2|PA1B2_PONAB6.258e-5545.60Platelet-activating factor acetylhydrolase IB subu... [more]
sp|P68402|PA1B2_HUMAN6.258e-5545.60Platelet-activating factor acetylhydrolase IB subu... [more]
back to top
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YQJ31.806e-8454.34Platelet-activating factor acetylhydrolase IB subu... [more]
A0A4E0R2G42.913e-8454.34Platelet-activating factor acetylhydrolase IB subu... [more]
A0A3Q0KHP97.331e-8355.66Putative platelet-activating factor acetylhydrolas... [more]
A0A4S2JKZ15.296e-8152.00SGNH_hydro domain-containing protein OS=Opisthorch... [more]
A0A5J4N9Y26.647e-8153.36Platelet-activating factor acetylhydrolase IB subu... [more]
back to top
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAFAH1B21.116e-5341.94platelet-activating factor acetylhydrolase IB subu... [more]
PAFAH1B21.116e-5341.94platelet-activating factor acetylhydrolase IB subu... [more]
pafah1b22.995e-5342.50platelet-activating factor acetylhydrolase IB subu... [more]
pafah1b22.995e-5342.50platelet-activating factor acetylhydrolase IB subu... [more]
pafah1b39.652e-5341.55platelet activating factor acetylhydrolase 1b cata... [more]
back to top
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pafah1b31.323e-4739.18platelet-activating factor acetylhydrolase, isofor... [more]
back to top
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO460361.241e-4642.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325601.246e-2833.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pafah1b36.711e-5342.27platelet activating factor acetylhydrolase 1b cata... [more]
pafah1b21.611e-5241.26platelet-activating factor acetylhydrolase IB subu... [more]
pafah1b21.611e-5241.26platelet-activating factor acetylhydrolase IB subu... [more]
back to top
BLAST of Platelet-activating factor acetylhydrolase IB subunit gamma vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000016097.18.359e-173100.00SMESG000016097.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034364 ID=SMED30034364|Name=Platelet-activating factor acetylhydrolase IB subunit gamma|organism=Schmidtea mediterranea sexual|type=transcript|length=1141bp
TTTTAATCTTAGACCGAATAATGATTTCACTTCAAACAATTTTGTGTTTT
AAATTTATTTTTTCTGAACCAATTTTAAAAATAAAATTATGAATTCATCA
TCTAAACCAGATGATATTGAAGGAGATGGTAGATGGATTAGTCAACACAC
TAGATTTTTATGTCAAACGAGAGAAAGGGAGCCAGACGTTGTACTTATCG
GAGATTCTGTTATTAAGTGTATGGAATTCTCAGCACCATATAAAAAGTTT
TTAGAACCACTTCATTGTCTTAATTTTGGGATATACGAAGATAACACTAG
CAATATTTTATGGAGAATCGAAAATGGAGAGCTAGATGGGATTTCTCCTA
AGGCTATAATTGTTCATGCTGGTAATCATAACATTGGCGAATCTGCTGAA
CAGATAGTTTCTGGCATTAGTTCAATTGTCGATCTGATTCACGAACGACA
ACCACAGGCTAATGTTATCGTTTTGGGGATGCTTCCATGTGGCAGGGAAC
CCAATCCAAGGAGAGTAAAATATTCCAAAATTAACGATATACTCACTGAA
AAGTGGATTACAAATAAATCTCTCAATACTGTTCTTCTTCTACCGGACTG
GAAGCAGTTTATTCAACCCGATGGGATAATTTCCCACCGTGACCAACACG
ATTATCTCCACCCAACTGACATGGGCTATTCAAAATTAATCGACATGATG
TTGGATGAGTTGCAAATTGCCATGCCGTCTTCTTTCTTGAAACCCGACCA
AGCTTTGAATGTAGCTGTCAGCGGTGAATCGAGCTAATAATGGGATTTAT
TTTGAGAACACGAATAAATATGGTGCAATCATATTTAATATTTGAAAATT
AATTTTAGTATGGCATAAGAATATTTTTCTATTTTGTTTTGTTTTTTGGA
TTGCCTACTGATTTCTATAAATTTATTGAATTTATATTACTCAGTGAGCT
CCTTTTGGTTATAACTTAGTGTTTGTGAATTCTTTGTTATGAAATGCGGA
TTGGTATATAATTACAATATCTCTGGTTTGTTTTCTTTGAGATATCAAAA
GTTTTATTTTCTATTGTATGTGGTTTATGAGCTACTTAAATGATGTCATT
AATTGATAGAGAATGCATATATATATTCTACTAATTTCTTG
back to top

protein sequence of SMED30034364-orf-1

>SMED30034364-orf-1 ID=SMED30034364-orf-1|Name=SMED30034364-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=233bp
MNSSSKPDDIEGDGRWISQHTRFLCQTREREPDVVLIGDSVIKCMEFSAP
YKKFLEPLHCLNFGIYEDNTSNILWRIENGELDGISPKAIIVHAGNHNIG
ESAEQIVSGISSIVDLIHERQPQANVIVLGMLPCGREPNPRRVKYSKIND
ILTEKWITNKSLNTVLLLPDWKQFIQPDGIISHRDQHDYLHPTDMGYSKL
IDMMLDELQIAMPSSFLKPDQALNVAVSGESS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036514SGNH_hydro_sf
IPR013830SGNH_hydro
IPR001087GDSL
Vocabulary: molecular function
TermDefinition
GO:0016788hydrolase activity, acting on ester bonds
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036514SGNH hydrolase superfamilyGENE3DG3DSA:3.40.50.1110coord: 1..214
e-value: 2.3E-41
score: 143.5
IPR001087GDSL lipase/esterasePFAMPF00657Lipase_GDSLcoord: 89..200
e-value: 7.7E-6
score: 26.0
NoneNo IPR availablePANTHERPTHR11852:SF2PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB SUBUNIT GAMMAcoord: 3..204
NoneNo IPR availablePANTHERPTHR11852PLATELET-ACTIVATING FACTOR ACETYLHYDROLASEcoord: 3..204
NoneNo IPR availableSUPERFAMILYSSF52266SGNH hydrolasecoord: 7..208