Voltage gated potassium channel

Overview
NameVoltage gated potassium channel
Smed IDSMED30034362
Length (bp)1951
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Voltage gated potassium channel (SMED30034362) t-SNE clustered cells

Violin plots show distribution of expression levels for Voltage gated potassium channel (SMED30034362) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Voltage gated potassium channel (SMED30034362) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Voltage gated potassium channel (SMED30034362) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034362

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30034362SMESG000015782.1 SMESG000015781.1 dd_Smed_v4_13748_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034362SMESG000015782.1 SMESG000015781.1 dd_Smed_v4_13748_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034362SMESG000015782.1 SMESG000015781.1 dd_Smed_v4_13748_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 357.451 bits (916), Expect = 3.470e-115
Identity = 212/502 (42.23%), Postives = 290/502 (57.77%), Query Frame = 2
Query:  125 MSGIDN--RVILNVGGIRHETYKATLKKIPATRLSRLTE--------------------------------------------------ALANYDPVLNEYFF-DRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVD-IDKDKKTEIELYGK-FGLEDEYQ----NNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSN----PFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILP 1420
            M  I+N  RVILNVGG RHETY++TLK +P TRL+ L                                                      A+  P     FF DRHPGVFA +LNYYRTGKLH P DVCGPLFEEEL FW +D   VEPCCWMTY  HRD +E L I +  D I  D   + +L  K  G+ED       +     W++L+P++WAL E+  SS  A+ ++  S+ FIL+SI  FCL+T+  F      T  V + TS    +V+   I   P   Y E +C +WF+ E  +R++ SP    F K+ +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  + PN+        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:    1 MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGTS----VVLQYEIETDPALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 498          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 357.451 bits (916), Expect = 7.906e-115
Identity = 212/502 (42.23%), Postives = 290/502 (57.77%), Query Frame = 2
Query:  125 MSGIDN--RVILNVGGIRHETYKATLKKIPATRLSRLTE--------------------------------------------------ALANYDPVLNEYFF-DRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVD-IDKDKKTEIELYGK-FGLEDEYQ----NNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSN----PFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILP 1420
            M  I+N  RVILNVGG RHETY++TLK +P TRL+ L                                                      A+  P     FF DRHPGVFA +LNYYRTGKLH P DVCGPLFEEEL FW +D   VEPCCWMTY  HRD +E L I +  D I  D   + +L  K  G+ED       +     W++L+P++WAL E+  SS  A+ ++  S+ FIL+SI  FCL+T+  F      T  V + TS    +V+   I   P   Y E +C +WF+ E  +R++ SP    F K+ +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  + PN+        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:    1 MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGTS----VVLQYEIETDPALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 498          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 358.221 bits (918), Expect = 7.987e-115
Identity = 212/502 (42.23%), Postives = 290/502 (57.77%), Query Frame = 2
Query:  125 MSGIDN--RVILNVGGIRHETYKATLKKIPATRLSRLTE--------------------------------------------------ALANYDPVLNEYFF-DRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVD-IDKDKKTEIELYGK-FGLEDEYQ----NNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSN----PFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILP 1420
            M  I+N  RVILNVGG RHETY++TLK +P TRL+ L                                                      A+  P     FF DRHPGVFA +LNYYRTGKLH P DVCGPLFEEEL FW +D   VEPCCWMTY  HRD +E L I +  D I  D   + +L  K  G+ED       +     W++L+P++WAL E+  SS  A+ ++  S+ FIL+SI  FCL+T+  F      T  V + TS    +V+   I   P   Y E +C +WF+ E  +R++ SP    F K+ +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  + PN+        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:    1 MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGTS----VVLQYEIETDPALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 498          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 358.221 bits (918), Expect = 7.987e-115
Identity = 212/502 (42.23%), Postives = 290/502 (57.77%), Query Frame = 2
Query:  125 MSGIDN--RVILNVGGIRHETYKATLKKIPATRLSRLTE--------------------------------------------------ALANYDPVLNEYFF-DRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVD-IDKDKKTEIELYGK-FGLEDEYQ----NNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSN----PFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILP 1420
            M  I+N  RVILNVGG RHETY++TLK +P TRL+ L                                                      A+  P     FF DRHPGVFA +LNYYRTGKLH P DVCGPLFEEEL FW +D   VEPCCWMTY  HRD +E L I +  D I  D   + +L  K  G+ED       +     W++L+P++WAL E+  SS  A+ ++  S+ FIL+SI  FCL+T+  F      T  V + TS    +V+   I   P   Y E +C +WF+ E  +R++ SP    F K+ +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  + PN+        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:    1 MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGTS----VVLQYEIETDPALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 498          
BLAST of Voltage gated potassium channel vs. Ensembl Human
Match: KCNC2 (potassium voltage-gated channel subfamily C member 2 [Source:HGNC Symbol;Acc:HGNC:6234])

HSP 1 Score: 357.451 bits (916), Expect = 1.382e-114
Identity = 212/502 (42.23%), Postives = 290/502 (57.77%), Query Frame = 2
Query:  125 MSGIDN--RVILNVGGIRHETYKATLKKIPATRLSRLTE--------------------------------------------------ALANYDPVLNEYFF-DRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVD-IDKDKKTEIELYGK-FGLEDEYQ----NNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSN----PFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILP 1420
            M  I+N  RVILNVGG RHETY++TLK +P TRL+ L                                                      A+  P     FF DRHPGVFA +LNYYRTGKLH P DVCGPLFEEEL FW +D   VEPCCWMTY  HRD +E L I +  D I  D   + +L  K  G+ED       +     W++L+P++WAL E+  SS  A+ ++  S+ FIL+SI  FCL+T+  F      T  V + TS    +V+   I   P   Y E +C +WF+ E  +R++ SP    F K+ +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  + PN+        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:    1 MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPLSPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGTS----VVLQYEIETDPALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 498          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: shw-3 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A0A3B1DVP6])

HSP 1 Score: 514.998 bits (1325), Expect = 7.294e-178
Identity = 273/463 (58.96%), Postives = 343/463 (74.08%), Query Frame = 2
Query:  116 GFSMSGIDN--RVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNL--FTVFVNDSTSSSDFI------VISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVRPKLKES--RNINN 1468
             F  + +D+  R+ILNVGG+RHETYK TLKKIPATRLSRLT  LANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYP DVCGPLFEEEL++W LDSN+ EPCCWMT +  RDTQ+ L+ LD +DI+ D+    ELY +FG ED+Y N+ L+ WQK+KP++W L +E NSS  A+ ++ +S+ F++ +I+ FCLKT+P  + P L  F  F  +  S+S  I      +       HP F Y E +CNIWF+IEI  R    P  + + +  +N+IDI A ++FY+DL       +++  +EF SIIRIMRLFKLT H  GLKIL+ TF+ASAKEL LLVFFLV+ +VVFA+L+YYAER  SN +N FVSIP GLWWAIVTMTT+GYGD+ P TY G LIG++CA+ GVLTI+LPVPVIVSNF+MFYSHTQARSK+PKKRR +L ++ V   +K +  RN N 
Sbjct:   16 AFGQTVMDSEYRIILNVGGVRHETYKHTLKKIPATRLSRLTTNLANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPLDVCGPLFEEELKYWGLDSNECEPCCWMTLSGTRDTQDVLKTLDELDIEVDQTEGPELYKRFGWEDDYHNDSLSAWQKIKPRIWRLFDEPNSSRSAQFIAAISVFFLITAIIVFCLKTHPGLRIPELAPFGNFSRNHRSTSSRIHPAQINIDKANSRPHPTFMYIETICNIWFTIEILARFSSCPSRFEYLRAPVNIIDIVATLTFYIDLLSSMFGATAD--LEFFSIIRIMRLFKLTHHNSGLKILMHTFRASAKELMLLVFFLVLGVVVFASLVYYAERVESNEDNQFVSIPIGLWWAIVTMTTIGYGDITPHTYLGRLIGSICALAGVLTIALPVPVIVSNFAMFYSHTQARSKMPKKRRGVLSMDQVAQHVKHAPVRNSNG 476          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: shw-3 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A0A3B1DVP6])

HSP 1 Score: 514.227 bits (1323), Expect = 8.528e-178
Identity = 271/452 (59.96%), Postives = 338/452 (74.78%), Query Frame = 2
Query:  143 RVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNL--FTVFVNDSTSSSDFI------VISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVRPKLKES--RNINN 1468
            R+ILNVGG+RHETYK TLKKIPATRLSRLT  LANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYP DVCGPLFEEEL++W LDSN+ EPCCWMT +  RDTQ+ L+ LD +DI+ D+    ELY +FG ED+Y N+ L+ WQK+KP++W L +E NSS  A+ ++ +S+ F++ +I+ FCLKT+P  + P L  F  F  +  S+S  I      +       HP F Y E +CNIWF+IEI  R    P  + + +  +N+IDI A ++FY+DL       +++  +EF SIIRIMRLFKLT H  GLKIL+ TF+ASAKEL LLVFFLV+ +VVFA+L+YYAER  SN +N FVSIP GLWWAIVTMTT+GYGD+ P TY G LIG++CA+ GVLTI+LPVPVIVSNF+MFYSHTQARSK+PKKRR +L ++ V   +K +  RN N 
Sbjct:    6 RIILNVGGVRHETYKHTLKKIPATRLSRLTTNLANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPLDVCGPLFEEELKYWGLDSNECEPCCWMTLSGTRDTQDVLKTLDELDIEVDQTEGPELYKRFGWEDDYHNDSLSAWQKIKPRIWRLFDEPNSSRSAQFIAAISVFFLITAIIVFCLKTHPGLRIPELAPFGNFSRNHRSTSSRIHPAQINIDKANSRPHPTFMYIETICNIWFTIEILARFSSCPSRFEYLRAPVNIIDIVATLTFYIDLLSSMFGATAD--LEFFSIIRIMRLFKLTHHNSGLKILMHTFRASAKELMLLVFFLVLGVVVFASLVYYAERVESNEDNQFVSIPIGLWWAIVTMTTIGYGDITPHTYLGRLIGSICALAGVLTIALPVPVIVSNFAMFYSHTQARSKMPKKRRGVLSMDQVAQHVKHAPVRNSNG 455          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: shw-3 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A0A3B1DVP6])

HSP 1 Score: 514.612 bits (1324), Expect = 1.196e-177
Identity = 271/452 (59.96%), Postives = 338/452 (74.78%), Query Frame = 2
Query:  143 RVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNL--FTVFVNDSTSSSDFI------VISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVRPKLKES--RNINN 1468
            R+ILNVGG+RHETYK TLKKIPATRLSRLT  LANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYP DVCGPLFEEEL++W LDSN+ EPCCWMT +  RDTQ+ L+ LD +DI+ D+    ELY +FG ED+Y N+ L+ WQK+KP++W L +E NSS  A+ ++ +S+ F++ +I+ FCLKT+P  + P L  F  F  +  S+S  I      +       HP F Y E +CNIWF+IEI  R    P  + + +  +N+IDI A ++FY+DL       +++  +EF SIIRIMRLFKLT H  GLKIL+ TF+ASAKEL LLVFFLV+ +VVFA+L+YYAER  SN +N FVSIP GLWWAIVTMTT+GYGD+ P TY G LIG++CA+ GVLTI+LPVPVIVSNF+MFYSHTQARSK+PKKRR +L ++ V   +K +  RN N 
Sbjct:   24 RIILNVGGVRHETYKHTLKKIPATRLSRLTTNLANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPLDVCGPLFEEELKYWGLDSNECEPCCWMTLSGTRDTQDVLKTLDELDIEVDQTEGPELYKRFGWEDDYHNDSLSAWQKIKPRIWRLFDEPNSSRSAQFIAAISVFFLITAIIVFCLKTHPGLRIPELAPFGNFSRNHRSTSSRIHPAQINIDKANSRPHPTFMYIETICNIWFTIEILARFSSCPSRFEYLRAPVNIIDIVATLTFYIDLLSSMFGATAD--LEFFSIIRIMRLFKLTHHNSGLKILMHTFRASAKELMLLVFFLVLGVVVFASLVYYAERVESNEDNQFVSIPIGLWWAIVTMTTIGYGDITPHTYLGRLIGSICALAGVLTIALPVPVIVSNFAMFYSHTQARSKMPKKRRGVLSMDQVAQHVKHAPVRNSNG 473          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 509.99 bits (1312), Expect = 4.286e-174
Identity = 270/452 (59.73%), Postives = 340/452 (75.22%), Query Frame = 2
Query:  137 DNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAY------------HPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFL-FYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVRPKLKES 1453
            ++RVILNVGGIRHETY   LKKIPATRLSRLT  LANYDPVLNEYFFDRHPGVF+ ILNYYRTGKLHYPT+VCGPLFEEELEFW LD+NQVEPCCWMTYT HRDTQ+TL +++ +D+D D  T+ E+  KFG ED+Y   +++ WQ+LKP++WAL +E  SS  A+++S ++I F++ISIV FCLKT+P+F+ P+     ++ ST+  +F     G+              HP FFY E L NIWFS E   R++  P V  F +  +NLID  A VSFY+D  L   L+ S+   +EF SIIRI+RLFKLT+H  GLKILI TFKASA+EL LLVFF+++ IV+FAAL+YYAER   N  N F SIP GLWWA++T+ T+G+GD+VP+T  G L+G++CA+ GVLTI+LPVPVIVSNF+MFYSH QARSKLPKKRRR+L    ++P +  S
Sbjct:  100 EHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFGWEDDYYTGNMSQWQRLKPRVWALFDEPWSSKYARVISVVNIIFVIISIVCFCLKTHPSFRIPD-----IDISTTMGNFSAPLNGVQMNNIYVGKTATRAHPSFFYVELLSNIWFSGEFLTRMVFCPNVATFLRTPVNLIDFIATVSFYIDWALDRTLSGSNRDSVEFFSIIRILRLFKLTQHSTGLKILIQTFKASAQELFLLVFFVLLGIVIFAALVYYAERVEHNEENQFSSIPVGLWWAVITICTIGFGDLVPQTSLGRLVGSVCALMGVLTIALPVPVIVSNFAMFYSHAQARSKLPKKRRRVLQPHEIKPVVGRS 546          
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 500.36 bits (1287), Expect = 3.134e-172
Identity = 261/466 (56.01%), Postives = 344/466 (73.82%), Query Frame = 2
Query:  137 DNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAY-------HPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNPFI--EFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVRPKL--------KESRNINNMLFNQ 1483
            ++RVILNVGGIRHETY   LKKIPATRLSRLT  LANYDPVLNEYFFDRHPGVF+ ILNYYRTGKLHYPT+VCGPLFEEELEFW LD+NQVEPCCWMTYT HRDTQ+TL +++ +D+D D  T+ E+  KFG ED+Y   +++ WQ+LKP++WAL +E  SS  A+++S+LS+ FIL S  +F LKT+P+F+ P++   +         F    + I         HP FFY + +CNIWF+IE+ +R +  P  ++F +  + +ID+ +  +F+ +  L  + + +   +  +F+S+I ++RLFKLT+H  GLKILI TFKASA+EL LLVFF+++ IV+FAAL+YYAER   N +N F SIP GLWW++VT++TVG+GDMVPKTY GML+G+LCA+ GVLTI+LPVPVIVSNFS  YSH+QAR+KLPKKRRR+L    V+P L        K  +  ++  FNQ
Sbjct:    4 EHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFGWEDDYYTGNMSQWQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQIPDIDVFYSLRVVDEGGFKNYHKTIGTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFESLLHAILIQTGSLVTLDFLSMICVLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKLPKKRRRVLQAHEVKPALLGVKQHHGKHRKKSSSATFNQ 469          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0289989)

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 291/439 (66.29%), Postives = 353/439 (80.41%), Query Frame = 2
Query:  137 DNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFL--FYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVR-PKL 1444
            +NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP+LNEYFFDRHPGVFAQ+LNYYRTGKLHYPTDVCGPLFEEELEFW LDSNQVEPCCWMTYT HRDTQETL +LDR+D+D +K +E EL  KFG E++Y    ++ WQ++KP++W+L +E  SS+ AK +  +S+ FI ISI++FCLKT+P+ + P +  + V  +  S+ + +       H  FFY E +CN WF+ EI +R I SP  + F K  +N+ID  A +SFY+DL L  F  ++ +   +EF SIIRIMRLFKLTRH  GLKILI TF+ASAKEL+LLVFFLV+ IV+FA+L+YYAER   NP+NDF SIP GLWWA+VTMTTVGYGDM PKTY GM +GALCA+ GVLTI+LPVPVIVSNF+M+YSHTQAR+KLPKKRRR+LPVE  R P+L
Sbjct:   24 ENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRL 462          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0089275)

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 291/439 (66.29%), Postives = 353/439 (80.41%), Query Frame = 2
Query:  137 DNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFL--FYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVR-PKL 1444
            +NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP+LNEYFFDRHPGVFAQ+LNYYRTGKLHYPTDVCGPLFEEELEFW LDSNQVEPCCWMTYT HRDTQETL +LDR+D+D +K +E EL  KFG E++Y    ++ WQ++KP++W+L +E  SS+ AK +  +S+ FI ISI++FCLKT+P+ + P +  + V  +  S+ + +       H  FFY E +CN WF+ EI +R I SP  + F K  +N+ID  A +SFY+DL L  F  ++ +   +EF SIIRIMRLFKLTRH  GLKILI TF+ASAKEL+LLVFFLV+ IV+FA+L+YYAER   NP+NDF SIP GLWWA+VTMTTVGYGDM PKTY GM +GALCA+ GVLTI+LPVPVIVSNF+M+YSHTQAR+KLPKKRRR+LPVE  R P+L
Sbjct:    9 ENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRL 447          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0332185)

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 291/439 (66.29%), Postives = 353/439 (80.41%), Query Frame = 2
Query:  137 DNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFL--FYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVR-PKL 1444
            +NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP+LNEYFFDRHPGVFAQ+LNYYRTGKLHYPTDVCGPLFEEELEFW LDSNQVEPCCWMTYT HRDTQETL +LDR+D+D +K +E EL  KFG E++Y    ++ WQ++KP++W+L +E  SS+ AK +  +S+ FI ISI++FCLKT+P+ + P +  + V  +  S+ + +       H  FFY E +CN WF+ EI +R I SP  + F K  +N+ID  A +SFY+DL L  F  ++ +   +EF SIIRIMRLFKLTRH  GLKILI TF+ASAKEL+LLVFFLV+ IV+FA+L+YYAER   NP+NDF SIP GLWWA+VTMTTVGYGDM PKTY GM +GALCA+ GVLTI+LPVPVIVSNF+M+YSHTQAR+KLPKKRRR+LPVE  R P+L
Sbjct:    9 ENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRL 447          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0089274)

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 291/439 (66.29%), Postives = 353/439 (80.41%), Query Frame = 2
Query:  137 DNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFL--FYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVR-PKL 1444
            +NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP+LNEYFFDRHPGVFAQ+LNYYRTGKLHYPTDVCGPLFEEELEFW LDSNQVEPCCWMTYT HRDTQETL +LDR+D+D +K +E EL  KFG E++Y    ++ WQ++KP++W+L +E  SS+ AK +  +S+ FI ISI++FCLKT+P+ + P +  + V  +  S+ + +       H  FFY E +CN WF+ EI +R I SP  + F K  +N+ID  A +SFY+DL L  F  ++ +   +EF SIIRIMRLFKLTRH  GLKILI TF+ASAKEL+LLVFFLV+ IV+FA+L+YYAER   NP+NDF SIP GLWWA+VTMTTVGYGDM PKTY GM +GALCA+ GVLTI+LPVPVIVSNF+M+YSHTQAR+KLPKKRRR+LPVE  R P+L
Sbjct:    9 ENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRL 447          
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0332184)

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 291/439 (66.29%), Postives = 353/439 (80.41%), Query Frame = 2
Query:  137 DNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFL--FYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVR-PKL 1444
            +NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP+LNEYFFDRHPGVFAQ+LNYYRTGKLHYPTDVCGPLFEEELEFW LDSNQVEPCCWMTYT HRDTQETL +LDR+D+D +K +E EL  KFG E++Y    ++ WQ++KP++W+L +E  SS+ AK +  +S+ FI ISI++FCLKT+P+ + P +  + V  +  S+ + +       H  FFY E +CN WF+ EI +R I SP  + F K  +N+ID  A +SFY+DL L  F  ++ +   +EF SIIRIMRLFKLTRH  GLKILI TF+ASAKEL+LLVFFLV+ IV+FA+L+YYAER   NP+NDF SIP GLWWA+VTMTTVGYGDM PKTY GM +GALCA+ GVLTI+LPVPVIVSNF+M+YSHTQAR+KLPKKRRR+LPVE  R P+L
Sbjct:    9 ENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRL 447          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 361.688 bits (927), Expect = 9.475e-117
Identity = 212/501 (42.32%), Postives = 309/501 (61.68%), Query Frame = 2
Query:  140 NRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQIL---------DRVDIDK-----DKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVRPKLKESRNINNMLFNQQFFPGKSNSDQKSNEERVQRMVRS 1555
            +RV++NVGGIRH+TY++TL+ +P TRL+ L E  A    +YD  ++E+FFDRHPGVFA ILNYYRTGKLH P DVCGPL+EEEL FW +D   VEPCCWMTY  HR+ +E L            D +D +      D   E+E+  +  + D         WQ+ + ++WAL E+  SS  A+ V+  S+ FIL+SI  FCL+T+  F +P +   +VN   ++S F + +  + Y     Y E +C +WF+ E  +R+   P   +F K+ +N+ID  A++ FY+++ L  L+ S       F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  +NPN+        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLPKK+ + +P     P+L  +    + + +    P  S     + +E +  M R+
Sbjct:    8 DRVVINVGGIRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDAQIDEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGPVEMGNDDMDTEALGDPGDGDEELEMTKRLAVGDSPDTKGAGFWQRWQRRVWALFEDPYSSKYARWVAFASLFFILVSITTFCLETHEAF-NPIINRTYVNTQDNTSRFHLETETVVY---LTYIEGVCVVWFTFEFLMRVTFCPDKKKFIKNTLNIIDFVAILPFYLEVGLSGLSSSEAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPRASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNKHIPRA---PQLGSANYCKSAMNSPHHSPQISEHCALAAQEEILEMNRA 501          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 362.459 bits (929), Expect = 1.166e-116
Identity = 212/501 (42.32%), Postives = 309/501 (61.68%), Query Frame = 2
Query:  140 NRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQIL---------DRVDIDK-----DKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSN----PFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVRPKLKESRNINNMLFNQQFFPGKSNSDQKSNEERVQRMVRS 1555
            +RV++NVGGIRH+TY++TL+ +P TRL+ L E  A    +YD  ++E+FFDRHPGVFA ILNYYRTGKLH P DVCGPL+EEEL FW +D   VEPCCWMTY  HR+ +E L            D +D +      D   E+E+  +  + D         WQ+ + ++WAL E+  SS  A+ V+  S+ FIL+SI  FCL+T+  F +P +   +VN   ++S F + +  + Y     Y E +C +WF+ E  +R+   P   +F K+ +N+ID  A++ FY+++ L  L+ S       F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  +NPN+        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLPKK+ + +P     P+L  +    + + +    P  S     + +E +  M R+
Sbjct:    8 DRVVINVGGIRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDAQIDEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGPVEMGNDDMDTEALGDPGDGDEELEMTKRLAVGDSPDTKGAGFWQRWQRRVWALFEDPYSSKYARWVAFASLFFILVSITTFCLETHEAF-NPIINRTYVNTQDNTSRFHLETETVVY---LTYIEGVCVVWFTFEFLMRVTFCPDKKKFIKNTLNIIDFVAILPFYLEVGLSGLSSSEAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPRASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNKHIPRA---PQLGSANYCKSAMNSPHHSPQISEHCALAAQEEILEMNRA 501          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 362.459 bits (929), Expect = 1.293e-116
Identity = 212/501 (42.32%), Postives = 309/501 (61.68%), Query Frame = 2
Query:  140 NRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQIL---------DRVDIDK-----DKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVRPKLKESRNINNMLFNQQFFPGKSNSDQKSNEERVQRMVRS 1555
            +RV++NVGGIRH+TY++TL+ +P TRL+ L E  A    +YD  ++E+FFDRHPGVFA ILNYYRTGKLH P DVCGPL+EEEL FW +D   VEPCCWMTY  HR+ +E L            D +D +      D   E+E+  +  + D         WQ+ + ++WAL E+  SS  A+ V+  S+ FIL+SI  FCL+T+  F +P +   +VN   ++S F + +  + Y     Y E +C +WF+ E  +R+   P   +F K+ +N+ID  A++ FY+++ L  L+ S       F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  +NPN+        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLPKK+ + +P     P+L  +    + + +    P  S     + +E +  M R+
Sbjct:    8 DRVVINVGGIRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDAQIDEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGPVEMGNDDMDTEALGDPGDGDEELEMTKRLAVGDSPDTKGAGFWQRWQRRVWALFEDPYSSKYARWVAFASLFFILVSITTFCLETHEAF-NPIINRTYVNTQDNTSRFHLETETVVY---LTYIEGVCVVWFTFEFLMRVTFCPDKKKFIKNTLNIIDFVAILPFYLEVGLSGLSSSEAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPRASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNKHIPRA---PQLGSANYCKSAMNSPHHSPQISEHCALAAQEEILEMNRA 501          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 352.443 bits (903), Expect = 1.572e-113
Identity = 197/444 (44.37%), Postives = 276/444 (62.16%), Query Frame = 2
Query:  140 NRVILNVGGIRHETYKATLKKIPATRLSRLTE---------------ALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGK-FGLEDEYQ-NNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRG--IAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNND-------FVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 1381
             RVILNVGG RHETY++TLK +P TRL+ L                     Y    NEYFFDRHPGVFA +LNYYRTGKLH P DVCGPLFEEEL FW +D   VEPCCWMTY  HRD +E L + + +++D ++  E   YGK  G+ED    +  ++ W++ +P +W L ++  SS  A+ ++  S+ FI++SI  FCL+T+  F +     +   D   +     IS+   I   P   Y E +C +WF+ E  +R+  SP    F K  +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  ++PN+        F +IP G WWA+VTMTT+GYGDM P+T+ GM++GALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    8 ERVILNVGGTRHETYRSTLKTLPGTRLALLASESDLELVLDQLQQVPGFIEYSARSNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEALDVFE-MNVDTEEDDE---YGKRLGIEDVVSADGTVSRWRRWQPVIWNLFDDPYSSRAARFIAFASLFFIMVSITTFCLETHEAFNT----IINKTDPLRNETLTDISQQYEIETDPALTYVEGVCVLWFTFEFLVRITFSPDKLEFIKSVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPNDPTASHHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMVVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 443          
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 352.829 bits (904), Expect = 3.616e-113
Identity = 197/444 (44.37%), Postives = 276/444 (62.16%), Query Frame = 2
Query:  140 NRVILNVGGIRHETYKATLKKIPATRLSRLTE---------------ALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGK-FGLEDEYQ-NNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRG--IAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNND-------FVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 1381
             RVILNVGG RHETY++TLK +P TRL+ L                     Y    NEYFFDRHPGVFA +LNYYRTGKLH P DVCGPLFEEEL FW +D   VEPCCWMTY  HRD +E L + + +++D ++  E   YGK  G+ED    +  ++ W++ +P +W L ++  SS  A+ ++  S+ FI++SI  FCL+T+  F +     +   D   +     IS+   I   P   Y E +C +WF+ E  +R+  SP    F K  +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  ++PN+        F +IP G WWA+VTMTT+GYGDM P+T+ GM++GALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    8 ERVILNVGGTRHETYRSTLKTLPGTRLALLASESDLELVLDQLQQVPGFIEYSARSNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEALDVFE-MNVDTEEDDE---YGKRLGIEDVVSADGTVSRWRRWQPVIWNLFDDPYSSRAARFIAFASLFFIMVSITTFCLETHEAFNT----IINKTDPLRNETLTDISQQYEIETDPALTYVEGVCVLWFTFEFLVRITFSPDKLEFIKSVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPNDPTASHHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMVVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 443          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: KCNC2 (potassium channel, voltage gated Shaw related subfamily C, member 2 [Source:NCBI gene;Acc:100489216])

HSP 1 Score: 373.244 bits (957), Expect = 4.325e-121
Identity = 207/465 (44.52%), Postives = 289/465 (62.15%), Query Frame = 2
Query:  125 MSGIDN--RVILNVGGIRHETYKATLKKIPATRLSRLT--------------EALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELY-----GKFGLEDEY-QNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILP 1420
            M  ID   R+ILNVGG RHETY++TLK +P TRL+ L                   N     NE+FFDRHPGVFA +LNYYRTGKLH P DVCGPLFEEEL FW +D   VEPCCWMTY  HRD +E L I +  D+   +   I+ Y      +  +ED    +  +  W++L+P++WAL E+  SS  A+ ++  S+ FIL+SI  FCL+T+  F +    T  VN+ T     I I       P   Y E +C +WF+ E  +R+I  P    F ++ +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  ++P++        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:    1 MGKIDENERIILNVGGTRHETYRSTLKTVPGTRLALLACESQSEQGLDQQTVSGSFNITSRGNEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLITGEPPPIDEYEEDLGKRLAIEDVVCPDGKVGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNTIINKTETVNNGTELISLIEIET----DPALTYVEGVCVVWFTFEFLVRVIFCPDKLEFIRNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPSDPSASKHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKYIP 461          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: KCNC2 (potassium channel, voltage gated Shaw related subfamily C, member 2 [Source:NCBI gene;Acc:100489216])

HSP 1 Score: 372.859 bits (956), Expect = 1.203e-120
Identity = 207/465 (44.52%), Postives = 289/465 (62.15%), Query Frame = 2
Query:  125 MSGIDN--RVILNVGGIRHETYKATLKKIPATRLSRLT--------------EALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELY-----GKFGLEDEY-QNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILP 1420
            M  ID   R+ILNVGG RHETY++TLK +P TRL+ L                   N     NE+FFDRHPGVFA +LNYYRTGKLH P DVCGPLFEEEL FW +D   VEPCCWMTY  HRD +E L I +  D+   +   I+ Y      +  +ED    +  +  W++L+P++WAL E+  SS  A+ ++  S+ FIL+SI  FCL+T+  F +    T  VN+ T     I I       P   Y E +C +WF+ E  +R+I  P    F ++ +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  ++P++        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:    1 MGKIDENERIILNVGGTRHETYRSTLKTVPGTRLALLACESQSEQGLDQQTVSGSFNITSRGNEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLITGEPPPIDEYEEDLGKRLAIEDVVCPDGKVGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNTIINKTETVNNGTELISLIEIET----DPALTYVEGVCVVWFTFEFLVRVIFCPDKLEFIRNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPSDPSASKHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKYIP 461          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: KCNC4 (potassium channel, voltage gated Shaw related subfamily C, member 4 [Source:NCBI gene;Acc:100492941])

HSP 1 Score: 353.599 bits (906), Expect = 3.086e-113
Identity = 190/429 (44.29%), Postives = 274/429 (63.87%), Query Frame = 2
Query:  140 NRVILNVGGIRHETYKATLKKIPATRLSRL----TEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSN----PFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 1381
             ++ +NVGG RHETYK+TL+ +P TRL+ L    T + +  D    E+FFDRHPG+F+ +LNYYRTGKLH P D+CGPLFEEEL FW +D   VEPCCWMTY  HRD +E L I + V+ +  ++       +    +E  +     W+  +PK+WAL E+  SS  A++V+ +S+ FIL+SI  FCL+T+ +F      T  V     +   I++ R +   P+  Y E +C  WF++E  +R+I  P    F K+ +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  +NP +        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:   36 GKITINVGGTRHETYKSTLRTLPGTRLAWLADPDTASNSESDSQRTEFFFDRHPGIFSYVLNYYRTGKLHCPADICGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFENVEPEDGEEENKGSSPELLCIEERTDRSRGCWKVWQPKMWALFEDPYSSRAARVVAFVSLFFILMSITTFCLETHESFIVDRNVTETVTIGNMTE--ILVVREVETEPILTYIEGVCVFWFTLEFLVRIICCPDKVFFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPTDPSGSNHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 462          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 352.829 bits (904), Expect = 3.543e-113
Identity = 200/435 (45.98%), Postives = 277/435 (63.68%), Query Frame = 2
Query:  140 NRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQ-----ILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFT-VFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 1381
            +++++NVGGIRHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VFA +LNYYRTGKLH P DVCGPL+EEEL FW +D   VE CCWM Y  HRD +E L           + D D K       +  L+++     L  W++L+PK+WAL E+  SS  A+ ++  S+ FILISI  FCL+T+  F   N  T VF   + + ++ I+    +   P   Y E +C IWF+ E  +R+I  P    F K  +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  + P++       DF +IP G WWA+VTMTT+GYGDM P T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:   36 DKIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPTEEEEDGDLK-------RLCLQED--GRKLGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEAFNDVNNKTEVFTQGNITRTETIL---EMETEPFLTYVEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLEIGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAAPDDITGSKHTDFKNIPIGFWWAVVTMTTLGYGDMYPVTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 458          
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 352.829 bits (904), Expect = 3.688e-113
Identity = 200/435 (45.98%), Postives = 277/435 (63.68%), Query Frame = 2
Query:  140 NRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQ-----ILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFT-VFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 1381
            +++++NVGGIRHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VFA +LNYYRTGKLH P DVCGPL+EEEL FW +D   VE CCWM Y  HRD +E L           + D D K       +  L+++     L  W++L+PK+WAL E+  SS  A+ ++  S+ FILISI  FCL+T+  F   N  T VF   + + ++ I+    +   P   Y E +C IWF+ E  +R+I  P    F K  +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  + P++       DF +IP G WWA+VTMTT+GYGDM P T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:   36 DKIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPTEEEEDGDLK-------RLCLQED--GRKLGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEAFNDVNNKTEVFTQGNITRTETIL---EMETEPFLTYVEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLEIGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAAPDDITGSKHTDFKNIPIGFWWAVVTMTTLGYGDMYPVTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 458          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnc1 (potassium voltage gated channel, Shaw-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96667])

HSP 1 Score: 352.058 bits (902), Expect = 7.129e-114
Identity = 193/442 (43.67%), Postives = 275/442 (62.22%), Query Frame = 2
Query:  143 RVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDID--------------KDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 1381
            R+++NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHPGVFA ILNYYRTGKLH P DVCGPL+EEEL FW +D   VEPCCWMTY  HRD +E L       +D               D + E+E+  +  L D         W++ +P++WAL E+  SS  A+ V+  S+ FIL+SI  FCL+T+  F +P +    + +  + +  +   R         Y E +C +WF+ E  +R++  P    F K+ +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  + PN+        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    9 RIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERF-NPIVNKTEIENVRNGTQ-VRYYREAETEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnc1 (potassium voltage gated channel, Shaw-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96667])

HSP 1 Score: 352.443 bits (903), Expect = 3.920e-113
Identity = 193/442 (43.67%), Postives = 275/442 (62.22%), Query Frame = 2
Query:  143 RVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDID--------------KDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 1381
            R+++NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHPGVFA ILNYYRTGKLH P DVCGPL+EEEL FW +D   VEPCCWMTY  HRD +E L       +D               D + E+E+  +  L D         W++ +P++WAL E+  SS  A+ V+  S+ FIL+SI  FCL+T+  F +P +    + +  + +  +   R         Y E +C +WF+ E  +R++  P    F K+ +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  + PN+        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    9 RIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERF-NPIVNKTEIENVRNGTQ-VRYYREAETEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnc2 (potassium voltage gated channel, Shaw-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96668])

HSP 1 Score: 342.813 bits (878), Expect = 1.127e-108
Identity = 188/402 (46.77%), Postives = 259/402 (64.43%), Query Frame = 2
Query:  266 EYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVD-IDKDKKTEIELYGK-FGLEDEYQ----NNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSN----PFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILP 1420
            E+FFDRHPGVFA +LNYYRTGKLH P DVCGPLFEEEL FW +D   VEPCCWMTY  HRD +E L I +  D I  D   + +L  K  G+ED       +     W+KL+P++WAL E+  SS  A+ ++  S+ FIL+SI  FCL+T+  F      T  V + TS     V+   I   P   Y E +C +WF+ E  +R++ SP    F K+ +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  + PN+        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:  105 EFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRKLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGTSP----VLQYEIETDPALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 502          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnc2 (potassium voltage gated channel, Shaw-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96668])

HSP 1 Score: 342.428 bits (877), Expect = 1.300e-108
Identity = 188/402 (46.77%), Postives = 259/402 (64.43%), Query Frame = 2
Query:  266 EYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVD-IDKDKKTEIELYGK-FGLEDEYQ----NNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSN----PFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILP 1420
            E+FFDRHPGVFA +LNYYRTGKLH P DVCGPLFEEEL FW +D   VEPCCWMTY  HRD +E L I +  D I  D   + +L  K  G+ED       +     W+KL+P++WAL E+  SS  A+ ++  S+ FIL+SI  FCL+T+  F      T  V + TS     V+   I   P   Y E +C +WF+ E  +R++ SP    F K+ +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  + PN+        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLP+KR++ +P
Sbjct:  105 EFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRKLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGTSP----VLQYEIETDPALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIP 502          
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Match: Kcnc4 (potassium voltage gated channel, Shaw-related subfamily, member 4 [Source:MGI Symbol;Acc:MGI:96670])

HSP 1 Score: 337.421 bits (864), Expect = 7.738e-107
Identity = 193/459 (42.05%), Postives = 275/459 (59.91%), Query Frame = 2
Query:  140 NRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLN-------------------EYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDR------------VDIDKDKKTEIELYG--KFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFK-SPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSN----PFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 1381
             ++I+NVGG RHETY++TL+ +P TRL+ L +      P  +                   E+FFDRHPGVFA +LNYYRTGKLH P DVCGPLFEEEL FW +D   VEPCCWMTY  HRD +E L I +                D +++  ++  G  + G      +     WQ   P++WAL E+  SS  A++V+  S+ FIL+SI  FCL+T+  F    N+  +    + +S  F    R +   P+  Y E +C +WF++E  +R++  P    F K+ +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  + P++       DF +IP G WWA+VTMTT+GYGDM PKT+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:   36 EKIIINVGGTRHETYRSTLRTLPGTRLAWLADPDGGGRPESDGGGAGSSGSSGGGGGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGGGAGPGDEAGDDERELALQRLGPHEGGSGPGAGSGGCRGWQ---PRMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDRNVTEIHRVGNITSVRF---RREVETEPILTYIEGVCVMWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 488          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|P17972|KCNAW_DROME (Potassium voltage-gated channel protein Shaw OS=Drosophila melanogaster OX=7227 GN=Shaw PE=2 SV=1)

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 291/439 (66.29%), Postives = 353/439 (80.41%), Query Frame = 2
Query:  137 DNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFL--FYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVR-PKL 1444
            +NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP+LNEYFFDRHPGVFAQ+LNYYRTGKLHYPTDVCGPLFEEELEFW LDSNQVEPCCWMTYT HRDTQETL +LDR+D+D +K +E EL  KFG E++Y    ++ WQ++KP++W+L +E  SS+ AK +  +S+ FI ISI++FCLKT+P+ + P +  + V  +  S+ + +       H  FFY E +CN WF+ EI +R I SP  + F K  +N+ID  A +SFY+DL L  F  ++ +   +EF SIIRIMRLFKLTRH  GLKILI TF+ASAKEL+LLVFFLV+ IV+FA+L+YYAER   NP+NDF SIP GLWWA+VTMTTVGYGDM PKTY GM +GALCA+ GVLTI+LPVPVIVSNF+M+YSHTQAR+KLPKKRRR+LPVE  R P+L
Sbjct:    9 ENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPRL 447          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|G5EFC3|KCNAG_CAEEL (Potassium voltage-gated channel protein egl-36 OS=Caenorhabditis elegans OX=6239 GN=egl-36 PE=1 SV=1)

HSP 1 Score: 491.886 bits (1265), Expect = 7.462e-167
Identity = 264/449 (58.80%), Postives = 332/449 (73.94%), Query Frame = 2
Query:  116 GFSMSGIDNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEI---ELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIV---ISR-GIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP--FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVR 1435
            G SM   D R++LNVGG+RHETY+ATLKKIPATRLSRLT +LAN+DP+LNEYFFDRHP VFA ILNYYRTGKLHYPTDVCGPLFEEEL++W LD++  EPCCWM     +DTQETL +LDR+D D +   ++   +   KFG E++Y     T W KLKP++W+L +E  SS  AK+++ +S+ FI ISI +FCLKT+ +F+ P    V +  + +    +V   I R      P+F   E LCNIWF++E+ +R +  P   RFFK  +N+ID+ A +SFY D  +  + V   P   +EF+S+IRI RLFKLT+H  GL+ILI TF+ASAKEL LLVFFL++ IV+FAAL+YYAE+  +NPNN F SIP GLWWAI TMTTVGYGDM P T  G L+G+LCAV GVLTI+LPVPVIVSNF+MFYSH QAR KLPK+RRR+LPVE +R
Sbjct:   32 GISM---DERIVLNVGGVRHETYQATLKKIPATRLSRLTPSLANFDPLLNEYFFDRHPAVFAMILNYYRTGKLHYPTDVCGPLFEEELQYWGLDASDTEPCCWMQLLHAKDTQETLAVLDRMDADHEDDPQLREQDTMKKFGWEEDYFQGKRTRWMKLKPQMWSLFDEPYSSQAAKLIAGISVLFIFISIFSFCLKTHQSFRLP----VLIGQNITMPGGVVQPSIERVSTEPLPIFGQIEMLCNIWFTLELIIRFVFCPSKIRFFKSPLNMIDLVATLSFYADAMMVRV-VEDEPKDVVEFLSMIRIFRLFKLTQHHQGLQILIHTFRASAKELILLVFFLILGIVIFAALVYYAEKMEANPNNQFQSIPLGLWWAICTMTTVGYGDMTPHTSFGRLVGSLCAVMGVLTIALPVPVIVSNFAMFYSHNQARDKLPKRRRRVLPVEQIR 472          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|P48547|KCNC1_HUMAN (Potassium voltage-gated channel subfamily C member 1 OS=Homo sapiens OX=9606 GN=KCNC1 PE=1 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 2.887e-113
Identity = 194/442 (43.89%), Postives = 275/442 (62.22%), Query Frame = 2
Query:  143 RVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDID--------------KDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 1381
            R+++NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHPGVFA ILNYYRTGKLH P DVCGPL+EEEL FW +D   VEPCCWMTY  HRD +E L       +D               D + E+E+  +  L D         W++ +P++WAL E+  SS  A+ V+  S+ FIL+SI  FCL+T+  F +P +    + +  + +  +   R         Y E +C +WF+ E  +R+I  P    F K+ +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  + PN+        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    9 RIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERF-NPIVNKTEIENVRNGTQ-VRYYREAETEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|P15388|KCNC1_MOUSE (Potassium voltage-gated channel subfamily C member 1 OS=Mus musculus OX=10090 GN=Kcnc1 PE=1 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 4.987e-113
Identity = 193/442 (43.67%), Postives = 275/442 (62.22%), Query Frame = 2
Query:  143 RVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDID--------------KDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 1381
            R+++NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHPGVFA ILNYYRTGKLH P DVCGPL+EEEL FW +D   VEPCCWMTY  HRD +E L       +D               D + E+E+  +  L D         W++ +P++WAL E+  SS  A+ V+  S+ FIL+SI  FCL+T+  F +P +    + +  + +  +   R         Y E +C +WF+ E  +R++  P    F K+ +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  + PN+        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    9 RIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERF-NPIVNKTEIENVRNGTQ-VRYYREAETEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Match: sp|P25122|KCNC1_RAT (Potassium voltage-gated channel subfamily C member 1 OS=Rattus norvegicus OX=10116 GN=Kcnc1 PE=1 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 2.742e-112
Identity = 193/442 (43.67%), Postives = 275/442 (62.22%), Query Frame = 2
Query:  143 RVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDID--------------KDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 1381
            R+++NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHPGVFA ILNYYRTGKLH P DVCGPL+EEEL FW +D   VEPCCWMTY  HRD +E L       +D               D + E+E+  +  L D         W++ +P++WAL E+  SS  A+ V+  S+ FIL+SI  FCL+T+  F +P +    + +  + +  +   R         Y E +C +WF+ E  +R++  P    F K+ +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  + PN+        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    9 RIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERF-NPIVNKTEIENVRNGTQ-VRYYREAETEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A2R2MT20 (potassium voltage-gated channel protein Shaw isoform X1 OS=Lingula unguis OX=7574 GN=LOC106158767 PE=3 SV=1)

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 323/501 (64.47%), Postives = 389/501 (77.64%), Query Frame = 2
Query:  110 FAGFSMSGIDNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSS-NPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVRPKLKESRNINNMLFNQQFFPGKSNSDQKSN------EERVQRMVRSSALQQMMPFTSL 1591
            +AG S S  +NRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFW LDSNQVEPCCWMTYT HRDTQETL ILDR+D+D DK T  ++  KFGLED Y+  DL  WQ++ PK++AL +E  SS  AK++S +S+ FI++SI++FCLKT+P  + P +    V+  T++  +++  +G   HP FFY E +CN WF+ EI +R IVSP  ++F K  +N+ID  A +SFY+D  L  +N  S +  +EF SIIRI+RL KLTRH  GLKILI TFKASAKELSLL+FFL++ IV+FAALI+YAER   NPNNDF SIP GLWWAIVTMTT+GYGDMVPKTY GM++G+LCA+TGVLTI+LPVP+IV NFSMFYSHTQARSKLPKKRRRILPVEAVRPK+  +RN+          P +  +  K        E ++ R+ +  A+ +MMPF SL
Sbjct:    7 YAGISDS--ENRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTAHRDTQETLSILDRLDLDTDKPTAEDIMKKFGLEDAYKAGDLNCWQRVAPKIYALFDEPYSSMWAKVLSIVSVFFIVVSILSFCLKTHPEMRVPLIVNRTVSVHTANDSWLLEKQGSDPHPAFFYIECMCNAWFTFEIIIRFIVSPSKFQFVKQPVNIIDFVATLSFYMDFMLSRINKESKSDILEFFSIIRILRLVKLTRHSTGLKILIHTFKASAKELSLLIFFLLLGIVMFAALIFYAERIQYNPNNDFESIPLGLWWAIVTMTTIGYGDMVPKTYMGMVVGSLCAITGVLTIALPVPIIVGNFSMFYSHTQARSKLPKKRRRILPVEAVRPKMPPNRNMGGGGGGPHGGPHRRMNAIKQGHIGGGLESKMNRIAQGGAISEMMPFRSL 505          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A2R2MT17 (potassium voltage-gated channel protein Shaw isoform X2 OS=Lingula unguis OX=7574 GN=LOC106158767 PE=3 SV=1)

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 322/502 (64.14%), Postives = 388/502 (77.29%), Query Frame = 2
Query:  110 FAGFSMSGIDNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSS-NPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVRPKLKESRNINNMLFNQQFFPGKSNSDQKSN------EERVQRMVRSSALQQMMPFTSLN 1594
            +AG S S  +NRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFW LDSNQVEPCCWMTYT HRDTQETL ILDR+D+D DK T  ++  KFGLED Y+  DL  WQ++ PK++AL +E  SS  AK++S +S+ FI++SI++FCLKT+P  + P +    V+  T++  +++  +G   HP FFY E +CN WF+ EI +R IVSP  ++F K  +N+ID  A +SFY+D  L  +N  S +  +EF SIIRI+RL KLTRH  GLKILI TFKASAKELSLL+FFL++ IV+FAALI+YAER   NPNNDF SIP GLWWAIVTMTT+GYGDMVPKTY GM++G+LCA+TGVLTI+LPVP+IV NFSMFYSHTQARSKLPKKRRRILPVEAVRPK+  +RN+          P +  +  K        E ++ R+ +  A+ +MMPF   N
Sbjct:    7 YAGISDS--ENRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTAHRDTQETLSILDRLDLDTDKPTAEDIMKKFGLEDAYKAGDLNCWQRVAPKIYALFDEPYSSMWAKVLSIVSVFFIVVSILSFCLKTHPEMRVPLIVNRTVSVHTANDSWLLEKQGSDPHPAFFYIECMCNAWFTFEIIIRFIVSPSKFQFVKQPVNIIDFVATLSFYMDFMLSRINKESKSDILEFFSIIRILRLVKLTRHSTGLKILIHTFKASAKELSLLIFFLLLGIVMFAALIFYAERIQYNPNNDFESIPLGLWWAIVTMTTIGYGDMVPKTYMGMVVGSLCAITGVLTIALPVPIIVGNFSMFYSHTQARSKLPKKRRRILPVEAVRPKMPPNRNMGGGGGGPHGGPHRRMNAIKQGHIGGGLESKMNRIAQGGAISEMMPFRRTN 506          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A2R2MT25 (potassium voltage-gated channel protein Shaw isoform X5 OS=Lingula unguis OX=7574 GN=LOC106158767 PE=3 SV=1)

HSP 1 Score: 606.29 bits (1562), Expect = 0.000e+0
Identity = 322/501 (64.27%), Postives = 388/501 (77.45%), Query Frame = 2
Query:  110 FAGFSMSGIDNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSS-NPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVRPKLKESRNINNMLFNQQFFPGKSNSDQKSN------EERVQRMVRSSALQQMMPFTSL 1591
            +AG S S  +NRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFW LDSNQVEPCCWMTYT HRDTQETL ILDR+D+D DK T  ++  KFGLED Y+  DL  WQ++ PK++AL +E  SS  AK++S +S+ FI++SI++FCLKT+P  + P +    V+  T++  +++  +G   HP FFY E +CN WF+ EI +R IVSP  ++F K  +N+ID  A +SFY+D  L  +N  S +  +EF SIIRI+RL KLTRH  GLKILI TFKASAKELSLL+FFL++ IV+FAALI+YAER   NPNNDF SIP GLWWAIVTMTT+GYGDMVPKTY GM++G+LCA+TGVLTI+LPVP+IV NFSMFYSHTQARSKLPKKRRRILPVEAVRPK+  +RN+          P +  +  K        E ++ R+ +  A+ +MMPF  L
Sbjct:    7 YAGISDS--ENRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTAHRDTQETLSILDRLDLDTDKPTAEDIMKKFGLEDAYKAGDLNCWQRVAPKIYALFDEPYSSMWAKVLSIVSVFFIVVSILSFCLKTHPEMRVPLIVNRTVSVHTANDSWLLEKQGSDPHPAFFYIECMCNAWFTFEIIIRFIVSPSKFQFVKQPVNIIDFVATLSFYMDFMLSRINKESKSDILEFFSIIRILRLVKLTRHSTGLKILIHTFKASAKELSLLIFFLLLGIVMFAALIFYAERIQYNPNNDFESIPLGLWWAIVTMTTIGYGDMVPKTYMGMVVGSLCAITGVLTIALPVPIIVGNFSMFYSHTQARSKLPKKRRRILPVEAVRPKMPPNRNMGGGGGGPHGGPHRRMNAIKQGHIGGGLESKMNRIAQGGAISEMMPFRML 505          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A2R2MT02 (potassium voltage-gated channel protein Shaw isoform X6 OS=Lingula unguis OX=7574 GN=LOC106158767 PE=3 SV=1)

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 321/498 (64.46%), Postives = 387/498 (77.71%), Query Frame = 2
Query:  110 FAGFSMSGIDNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSS-NPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVRPKLKESRNINNMLFNQQFFPGKSNSDQKSN------EERVQRMVRSSALQQMMPF 1582
            +AG S S  +NRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFW LDSNQVEPCCWMTYT HRDTQETL ILDR+D+D DK T  ++  KFGLED Y+  DL  WQ++ PK++AL +E  SS  AK++S +S+ FI++SI++FCLKT+P  + P +    V+  T++  +++  +G   HP FFY E +CN WF+ EI +R IVSP  ++F K  +N+ID  A +SFY+D  L  +N  S +  +EF SIIRI+RL KLTRH  GLKILI TFKASAKELSLL+FFL++ IV+FAALI+YAER   NPNNDF SIP GLWWAIVTMTT+GYGDMVPKTY GM++G+LCA+TGVLTI+LPVP+IV NFSMFYSHTQARSKLPKKRRRILPVEAVRPK+  +RN+          P +  +  K        E ++ R+ +  A+ +MMPF
Sbjct:    7 YAGISDS--ENRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTAHRDTQETLSILDRLDLDTDKPTAEDIMKKFGLEDAYKAGDLNCWQRVAPKIYALFDEPYSSMWAKVLSIVSVFFIVVSILSFCLKTHPEMRVPLIVNRTVSVHTANDSWLLEKQGSDPHPAFFYIECMCNAWFTFEIIIRFIVSPSKFQFVKQPVNIIDFVATLSFYMDFMLSRINKESKSDILEFFSIIRILRLVKLTRHSTGLKILIHTFKASAKELSLLIFFLLLGIVMFAALIFYAERIQYNPNNDFESIPLGLWWAIVTMTTIGYGDMVPKTYMGMVVGSLCAITGVLTIALPVPIIVGNFSMFYSHTQARSKLPKKRRRILPVEAVRPKMPPNRNMGGGGGGPHGGPHRRMNAIKQGHIGGGLESKMNRIAQGGAISEMMPF 502          
BLAST of Voltage gated potassium channel vs. TrEMBL
Match: A0A2R2MTQ0 (potassium voltage-gated channel protein Shaw isoform X3 OS=Lingula unguis OX=7574 GN=LOC106158767 PE=3 SV=1)

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 312/452 (69.03%), Postives = 370/452 (81.86%), Query Frame = 2
Query:  110 FAGFSMSGIDNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSS-NPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVRPKLKESRNI 1462
            +AG S S  +NRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFW LDSNQVEPCCWMTYT HRDTQETL ILDR+D+D DK T  ++  KFGLED Y+  DL  WQ++ PK++AL +E  SS  AK++S +S+ FI++SI++FCLKT+P  + P +    V+  T++  +++  +G   HP FFY E +CN WF+ EI +R IVSP  ++F K  +N+ID  A +SFY+D  L  +N  S +  +EF SIIRI+RL KLTRH  GLKILI TFKASAKELSLL+FFL++ IV+FAALI+YAER   NPNNDF SIP GLWWAIVTMTT+GYGDMVPKTY GM++G+LCA+TGVLTI+LPVP+IV NFSMFYSHTQARSKLPKKRRRILPVEAVRPK+  +RN+
Sbjct:    7 YAGISDS--ENRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTAHRDTQETLSILDRLDLDTDKPTAEDIMKKFGLEDAYKAGDLNCWQRVAPKIYALFDEPYSSMWAKVLSIVSVFFIVVSILSFCLKTHPEMRVPLIVNRTVSVHTANDSWLLEKQGSDPHPAFFYIECMCNAWFTFEIIIRFIVSPSKFQFVKQPVNIIDFVATLSFYMDFMLSRINKESKSDILEFFSIIRILRLVKLTRHSTGLKILIHTFKASAKELSLLIFFLLLGIVMFAALIFYAERIQYNPNNDFESIPLGLWWAIVTMTTIGYGDMVPKTYMGMVVGSLCAITGVLTIALPVPIIVGNFSMFYSHTQARSKLPKKRRRILPVEAVRPKMPPNRNM 456          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 345.895 bits (886), Expect = 6.087e-111
Identity = 194/440 (44.09%), Postives = 273/440 (62.05%), Query Frame = 2
Query:  137 DNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVL-------NEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILD----RVDIDKDKKTEIELYGKFGLEDEYQNNDL-TNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVIS--RGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSN----PFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNND-------FVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 1381
            + R+ILNVGG RHETY+ TL+ +P TRL+ L   L +    +       NEYFFDRHPGVFA +LNYYRTGKLH P DVCGPLFEEEL FW +D   VEPCCWMTY  HRD +E L + D        +     + +  G+   + E+ + +  T W++ +P +W L E+  SS  A+ V+  S+ FI++SI  FCL+T+  F +     +   D+  +   + +S    I   P   Y E +C +WF+ E  +R+  SP    F K  +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  +NPN+        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:   18 NERIILNVGGTRHETYRNTLRTLPGTRLALLATELPSSACAVTVRARANNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEALDVFDMNALGGGPEGPGGEDGDELGEAAEQREHADKERDTGWRRWQPVMWNLFEDPYSSRAARFVAFASLFFIMVSITTFCLETHEAFNT----IINKTDALRNDSLLEVSPQYEIETDPALTYVEGVCVLWFTFEFLVRVTFSPDKLEFVKSVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASVNEFFLLIIFLALGVLIFATMIYYAERIGANPNDPTASDHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 453          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: ENSAMXT00000048024.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:103030489])

HSP 1 Score: 346.28 bits (887), Expect = 1.267e-110
Identity = 196/436 (44.95%), Postives = 272/436 (62.39%), Query Frame = 2
Query:  143 RVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFG----LEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPV----FFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 1381
            R+++N GG+RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF+ ILNYYRTGKLH P DVCGPLFEEEL FW +D   VE CCWM Y  HRD +E L   +  + +          G  G    L  +  N  +  W+  +P++WAL E+  SS  A+ V+  S+ FILISI  FC++T+        F    N + + +   V    I Y  V      Y E +C +WF+IE+  R++  P    FFK  +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  +NP++       +F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:   37 RIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKADEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFESPEPEAPDDDAALAGGADGDLKRLCLQEDNRKVGWWRVWQPRIWALFEDPYSSKYARYVAFGSLLFILISISTFCMETH------EAFNTIYNKTENVTVGNVTREEIVYEVVTDSWLTYVEGVCVVWFTIEVFTRVVFCPDKAEFFKSLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 466          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 344.354 bits (882), Expect = 1.688e-110
Identity = 195/441 (44.22%), Postives = 273/441 (61.90%), Query Frame = 2
Query:  131 GIDNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDP------VLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILD----RVDIDKDKKTEIELYGKFGLEDEYQNNDL-TNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVIS--RGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSN----PFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNND-------FVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 1381
            G  +R+ILNVGG RHETY+ TL+ +P TRL+ L   L +           NEYFFDRHPGVFA +LNYYRTGKLH P DVCGPLFEEEL FW +D   VEPCCWMTY  HRD +E L + D        +     + +  G+   + E+ + +  T W++ +P +W L E+  SS  A+ V+  S+ FI++SI  FCL+T+  F +     +   D+  +   + +S    I   P   Y E +C +WF+ E  +R+  SP    F K  +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  +NPN+        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    2 GQGHRIILNVGGTRHETYRNTLRTLPGTRLALLATELPSSACQQVRARANNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEALDVFDMNALGGGPEGPGGEDGDELGEAAEQREHADKERDTGWRRWQPVMWNLFEDPYSSRAARFVAFASLFFIMVSITTFCLETHEAFNT----IINKTDALRNDSLLEVSPQYEIETDPALTYVEGVCVLWFTFEFLVRVTFSPDKLEFVKSVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASVNEFFLLIIFLALGVLIFATMIYYAERIGANPNDPTASDHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 438          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: ENSAMXT00000012289.2 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:103030489])

HSP 1 Score: 346.28 bits (887), Expect = 2.570e-110
Identity = 196/436 (44.95%), Postives = 272/436 (62.39%), Query Frame = 2
Query:  143 RVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFG----LEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPV----FFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 1381
            R+++N GG+RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF+ ILNYYRTGKLH P DVCGPLFEEEL FW +D   VE CCWM Y  HRD +E L   +  + +          G  G    L  +  N  +  W+  +P++WAL E+  SS  A+ V+  S+ FILISI  FC++T+        F    N + + +   V    I Y  V      Y E +C +WF+IE+  R++  P    FFK  +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  +NP++       +F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    9 RIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKADEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFESPEPEAPDDDAALAGGADGDLKRLCLQEDNRKVGWWRVWQPRIWALFEDPYSSKYARYVAFGSLLFILISISTFCMETH------EAFNTIYNKTENVTVGNVTREEIVYEVVTDSWLTYVEGVCVVWFTIEVFTRVVFCPDKAEFFKSLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 438          
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Match: ENSAMXT00000049045.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:103030489])

HSP 1 Score: 346.665 bits (888), Expect = 2.696e-110
Identity = 196/436 (44.95%), Postives = 272/436 (62.39%), Query Frame = 2
Query:  143 RVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFG----LEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPV----FFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 1381
            R+++N GG+RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF+ ILNYYRTGKLH P DVCGPLFEEEL FW +D   VE CCWM Y  HRD +E L   +  + +          G  G    L  +  N  +  W+  +P++WAL E+  SS  A+ V+  S+ FILISI  FC++T+        F    N + + +   V    I Y  V      Y E +C +WF+IE+  R++  P    FFK  +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  +NP++       +F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:   37 RIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKADEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFESPEPEAPDDDAALAGGADGDLKRLCLQEDNRKVGWWRVWQPRIWALFEDPYSSKYARYVAFGSLLFILISISTFCMETH------EAFNTIYNKTENVTVGNVTREEIVYEVVTDSWLTYVEGVCVVWFTIEVFTRVVFCPDKAEFFKSLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 466          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 363.614 bits (932), Expect = 1.491e-117
Identity = 211/443 (47.63%), Postives = 288/443 (65.01%), Query Frame = 2
Query:  137 DNRVILNVGGIRHETYKATLKKIPATRLSRLTE--ALAN--YDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKT--EIELYGKFGLEDEYQNND----LTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNF-----KSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP------FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 1381
            + RV++NVGG RHETY+ TL+ +P TRLS LTE  A AN  YD   NE+FFDRHP VFA ILNYYRTGKLH P++VCGPLFEEEL FW +D   VEPCCWM Y  HRD +E L   +  DI+ + +   + E+  +FGL++   +      L  WQ   P++WAL E+  SS  A+IV+  S+ FILISI  FCL+T+  F     K+ N     +N+ T+   ++     +   PV  Y E +C  WFS E  +R+I  P    F K+++N+ID  A++ FY+++ L  L  +S P      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +I+YAERF +NPN+        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NFSM+YS   A
Sbjct:   35 NERVVINVGGTRHETYRGTLRTLPGTRLSWLTEPDAFANFDYDAKGNEFFFDRHPTVFAHILNYYRTGKLHCPSEVCGPLFEEELIFWGIDETDVEPCCWMNYRQHRDAEEALVSFENPDINGNDEVNEDGEVSKRFGLDERSPDGGKLGFLRRWQ---PRMWALFEDPYSSRAARIVALASLLFILISITTFCLETHEAFNTVLNKTENY---TINNVTTQKVYV----DVETDPVLMYVEGVCVAWFSFEFLVRIICCPDKKVFIKNYLNVIDFVAILPFYLEVGLSSL--TSKPARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIFYAERFGANPNDPTASDHTSFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFSMYYSLAMA 465          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004235.1 (pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-1 gene:ENSPMAG00000003870.1 transcript:ENSPMAT00000004235.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 262.307 bits (669), Expect = 2.236e-81
Identity = 162/436 (37.16%), Postives = 249/436 (57.11%), Query Frame = 2
Query:  143 RVILNVGGIRHETYKATLKKIPATRLSRL---------TEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNPF------IEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKR 1405
            RV LNVGG+ HE    TL+++P TRL RL         +E   +Y    NEYFFDRHPG FA +LN+YRTG+LH   ++C   F +EL++W +D   +E CC   Y  H+  ++  + L R     + ++  E  G     DE++     + ++   KLW LLE  NSS  AK ++ +SI FI++S +A  L T P+ +  + F+  +++                 P     E +C  WF++E  LR + +P  ++FFK  +N+ID+ A++ +Y+ +FL   +   + F      ++   I+RI+R+ KL RH  GL+ L  T + S  EL LL+ FL + I++F++L+++AE+    P+  F SIP   WWA +TMTTVGYGD+ P T  G +IG LC + GVL I+LP+P+IV+NFS FY   + + K  K+R
Sbjct:    1 RVRLNVGGLVHEVLWRTLERLPRTRLGRLHATNTHGALSELCDDYSIADNEYFFDRHPGAFASVLNFYRTGRLHMSEEMCALSFGQELDYWGVDEIYLETCCQARY--HQKKEQMSEELRR-----EAESAREREG-----DEFEGTCCADKRR---KLWELLENPNSSLAAKGMAIVSILFIVLSTIALSLNTLPDLQHKDEFSHIIDN-----------------PKLAQVEAVCIAWFTMEYLLRFMSAPNKWKFFKGALNVIDLMAILPYYITIFLTESSRGVSQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEK--DEPDTKFHSIPASFWWATITMTTVGYGDIYPMTLLGKIIGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAVKRR 402          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 235.728 bits (600), Expect = 9.042e-72
Identity = 159/415 (38.31%), Postives = 224/415 (53.98%), Query Frame = 2
Query:  137 DNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTG-KLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYL---NVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYS 1369
            DNRV++NV G R ET   TL + P + L    +    +DP+ NEYFFDR    F  IL YY++G +L  P DV   +F EE+EF+ L    V                                    YG+  L+   + N   + +  +  +W L E  + S  AK++S +S    ++SI   CL+T P F+  N   V  N +  S     I   I     FF  E  C +WF  E+++R    P    F KDF+N IDI A++ +++ + L  +   + +  P ++ I ++R++R+FKL+RH   L+IL LT KAS +EL++L FFL V +V+F+  IYY E    +P   F SIP+  WWA+VTMT VGYGDM P T  G ++GALCA+TGVLTISLPVPVIVSNF  FY+
Sbjct:    8 DNRVVINVSGERFETQLKTLDQFPDSLLGHPDKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELGEEAVAK----------------------------------YGENTLDTPEEEN--VHGKDFQQHVWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKDN--QVHANRTEFS-----IRTSIYNLDPFFMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFITVVLEIMQQQDQTRQPLLKIIRLVRVLRIFKLSRHCQDLQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVE--ADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYN 377          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 231.491 bits (589), Expect = 4.377e-70
Identity = 157/414 (37.92%), Postives = 222/414 (53.62%), Query Frame = 2
Query:  140 NRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTG-KLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYL---NVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYS 1369
             RV++NV G R ET   TL + P + L    +    +DP+ NEYFFDR    F  IL YY++G +L  P DV   +F EE+EF+ L    V                                    YG+  L+   + N   + +  +  +W L E  + S  AK++S +S    ++SI   CL+T P F+  N   V  N +  S     I   I     FF  E  C +WF  E+++R    P    F KDF+N IDI A++ +++ + L  +   + +  P ++ I ++R++R+FKL+RH   L+IL LT KAS +EL++L FFL V +V+F+  IYY E    +P   F SIP+  WWA+VTMT VGYGDM P T  G ++GALCA+TGVLTISLPVPVIVSNF  FY+
Sbjct:    5 QRVVINVSGERFETQLKTLDQFPDSLLGHPDKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELGEEAVAK----------------------------------YGENTLDTPEEEN--VHGKDFQQHVWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKDN--QVHANRTEFS-----IRTSIYNLDPFFMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFITVVLEIMQQQDQTRQPLLKIIRLVRVLRIFKLSRHCQDLQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVE--ADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYN 373          
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 231.106 bits (588), Expect = 6.631e-70
Identity = 157/414 (37.92%), Postives = 222/414 (53.62%), Query Frame = 2
Query:  140 NRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTG-KLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYL---NVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYS 1369
             RV++NV G R ET   TL + P + L    +    +DP+ NEYFFDR    F  IL YY++G +L  P DV   +F EE+EF+ L    V                                    YG+  L+   + N   + +  +  +W L E  + S  AK++S +S    ++SI   CL+T P F+  N   V  N +  S     I   I     FF  E  C +WF  E+++R    P    F KDF+N IDI A++ +++ + L  +   + +  P ++ I ++R++R+FKL+RH   L+IL LT KAS +EL++L FFL V +V+F+  IYY E    +P   F SIP+  WWA+VTMT VGYGDM P T  G ++GALCA+TGVLTISLPVPVIVSNF  FY+
Sbjct:    1 QRVVINVSGERFETQLKTLDQFPDSLLGHPDKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELGEEAVAK----------------------------------YGENTLDTPEEEN--VHGKDFQQHVWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKDN--QVHANRTEFS-----IRTSIYNLDPFFMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFITVVLEIMQQQDQTRQPLLKIIRLVRVLRIFKLSRHCQDLQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVE--ADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYN 369          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO39804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8W8])

HSP 1 Score: 362.459 bits (929), Expect = 9.943e-120
Identity = 195/426 (45.77%), Postives = 278/426 (65.26%), Query Frame = 2
Query:  140 NRVILNVGGIRHETYKATLKKIPATRLSRLTE---ALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRR 1408
            +RV++NVGG +HETY  TLK IP TRL  +TE    L  +DP  +E+FFDRHPGVFAQ+LN+YRTGKLH P DVCGPLFE+EL FW +D  QVEPCCW+ Y  HR+ Q  L   D  D D +   ++++     + D  +  + T W+K +P++W + EE  SS  A++++ +++  I+ S+  FCL+T P F +P           +S  F           V +  E +C  WF++E   RLI  P    FFK  +N ID+ A++ FY+ L +   N  +   +  + +IR+ R+FKL+RH YGL+IL  T ++S  EL LLVFFL + +V+F+++I+YAE+ T   +  F +IP+  WWA+VTMTT+GYGDMVP T+ G ++G+LCAV GVL I+LPVPVIVSNFS++YSH +AR KLP+++R
Sbjct:   16 DRVVINVGGQKHETYIGTLKNIPDTRLYWITENGTQLPEFDPNTSEFFFDRHPGVFAQVLNFYRTGKLHCPNDVCGPLFEDELAFWGIDELQVEPCCWLNYKQHREAQANLDPFDHHDSDNESVGDMDMSVYGLVADSIRQRNRTWWKKYQPRIWTMFEEPYSSIPAQVLAFITMFLIISSVCLFCLETVPKFDNPK----------TSEGF-----------VLYILEAVCVAWFTLEFLFRLIFCPDKLSFFKKPMNWIDLGAILPFYLTLIVRESNFKTIVVLRVVRLIRVFRIFKLSRHSYGLQILGHTLRSSCSELFLLVFFLTIGVVIFSSVIFYAEKDTKGTH--FTTIPHTFWWAVVTMTTLGYGDMVPITWQGQIVGSLCAVCGVLMIALPVPVIVSNFSLYYSHAKARMKLPRRKR 418          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO42724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S6])

HSP 1 Score: 359.762 bits (922), Expect = 6.377e-119
Identity = 217/432 (50.23%), Postives = 285/432 (65.97%), Query Frame = 2
Query:  140 NRVILNVGGIRHETYKATLKKIPATRLSRLTEA---LANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDI----DKDKKTEIELYG-KFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRR 1411
            +RV +NVGG+RHETYK+TLK IP TRLS + EA    A++DP   EYFFDRHPGVFA +LNYYRTGKLH P DVCGPLFE+EL FW +D  QVE CCW+TY  HRD QETL   + V+     + D++ ++  YG  F  E E    D T W++ +P++W L+EE +SS  AK+++  ++T IL+S+  FCL++   F    L            D +VI  GI            C +WF++E+ +R +  P    FFK  +N ID  A+V FYV L  F  N +    +  I +IRI R+FKL+RH  GL+IL  T +AS +EL LL+FFL++ +V+FA+LI+Y E+    P   FV IP+  WWA+VTMTTVGYGDM P++  G  IG+LCAV GVLTI+LPVPVIV+NFS++YSH QAR KLPKKRRR
Sbjct:    1 DRVSINVGGVRHETYKSTLKNIPDTRLSWIAEASAGAADFDPSTGEYFFDRHPGVFANVLNYYRTGKLHCPLDVCGPLFEDELGFWGIDDQQVESCCWLTYRQHRDAQETLAAFEGVEFENEYEDDEEPDLGRYGFNFAAESE---PDKTWWERYQPRIWTLMEEPHSSTLAKVIAYTTLTLILVSVGIFCLESMEKFSEKYL-----------KDLLVILEGI------------CVVWFTLELMVRFVFCPAKCEFFKKIMNWIDFLAIVPFYVSLG-FNNNNNDIDALMIIRLIRIFRIFKLSRHSSGLQILGHTLRASFRELLLLIFFLLIGVVLFASLIFYCEK--KIPGTKFVDIPSSFWWAVVTMTTVGYGDMAPQSPSGKFIGSLCAVCGVLTIALPVPVIVNNFSLYYSHAQARLKLPKKRRR 403          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO38237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDJ4])

HSP 1 Score: 337.421 bits (864), Expect = 3.884e-110
Identity = 186/427 (43.56%), Postives = 260/427 (60.89%), Query Frame = 2
Query:  137 DNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDID--KDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRR 1411
             +R+I+NVGG RHET  +TL+ IP TRLS + E     +    EYFFDRHP  F Q+LN+YRTGKLH PT++CGP+FEEEL FW +D  Q+EPCCW TYT HR+ +E L+       +  KD+  E  + G +G       N+L  W++++P+LW  L+E +SS  AKI S  S  FI +SI  FC  T P  +  N+       S    D I               E  C+I+FS E+ +RLI  P    F +  +N ID  A++ FYV++F        NP +    +IRIMRLF+  +  YGL+I+I T KAS+ EL LL+  +++ +V+F++++YY E         F S+P   WW ++TMTTVGYGDM P+T+PG +IG  CA+ GVL ++LP+ VI SNF+++Y+H QAR KLP K+RR
Sbjct:   15 SSRIIINVGGFRHETSVSTLQNIPDTRLSWIAENSTVNEDNKREYFFDRHPTAFCQVLNFYRTGKLHCPTEMCGPMFEEELIFWGIDEKQMEPCCWGTYTQHREAEENLKAFVGPGFNDLKDEPAENHM-GSYG-----SINELNCWKRIQPQLWETLDEPHSSKMAKIFSYTSCLFIALSIATFCATTMPAIRKNNIM-----GSREGLDHI---------------EMFCSIFFSFELFMRLISCPSKLHFCRGIMNWIDFVAIIPFYVNIFY------PNPIVRMFLVIRIMRLFRFIKLSYGLQIMIQTLKASSHELVLLLLMVLIPMVMFSSIVYYVEVIIEGRGAQFTSVPESFWWCLITMTTVGYGDMTPQTWPGKIIGGACAICGVLIVALPISVIGSNFNLYYAHAQARLKLPVKQRR 409          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO45172 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTZ3])

HSP 1 Score: 305.834 bits (782), Expect = 1.399e-97
Identity = 180/433 (41.57%), Postives = 262/433 (60.51%), Query Frame = 2
Query:  140 NRVILNVGGIRHETYKATLKKIPATRLSRLTEALA---NYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILD----RVDIDKDKKTEIELYGKF-GLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRI 1414
             R+ LNVGG +HETY +T++  P TRL  + E +    +Y     E FFDRHP +F Q+LNYYRTGKLH P DVCGPLFEEEL +W +D  ++EPCCW TYT HR+ +  L+  +      DID D++ E E   K  GL           W K +P++WA+LEE  SS  AK    LS+  I++S+   C  T P F +        + +  +  F VI             E++C +WF+IE+ LRL+  P    FFK +   +D+ +++ FYV L   +     +   + + +IR++RLF+  R +YGL++++ T KAS+ EL LL+  L++ +V+F+++IYY E+        F SIP   WW+++TMTTVGYGDM P+T+ G +IG  CA+ GVL ++LP+ VI SNFS++Y+H QAR KLPKK+ +I
Sbjct:   10 KRITLNVGGQKHETYLSTIRNYPDTRLYWVVENVTKAIDYHSEKIELFFDRHPKIFDQVLNYYRTGKLHCPNDVCGPLFEEELAYWGIDEKEMEPCCWTTYTQHREAEHNLKSFNVTDFSTDIDSDRQEETETTSKAKGLHP--------FWVKYQPRIWAILEEPRSSRTAKAFWILSVLLIVLSVATACAITLPQFATEGGSVSSESSAYVA--FTVI-------------EYICGVWFTIELGLRLLFCPNKRTFFKSYSFWVDVLSVIPFYVRLIFPH----EHDLADALQVIRLLRLFRFFRLLYGLQVIMHTLKASSYELFLLLLILLIPVVLFSSIIYYVEKNIDGKTTKFRSIPESFWWSLITMTTVGYGDMTPRTWEGKIIGGACAIFGVLMVALPISVIGSNFSLYYAHAQARLKLPKKKTKI 415          
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Match: EDO48066 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJZ5])

HSP 1 Score: 301.982 bits (772), Expect = 1.597e-96
Identity = 187/443 (42.21%), Postives = 266/443 (60.05%), Query Frame = 2
Query:  128 SGIDNRVILNVGGIRHETYKATLKKIPATRLSRLTE---ALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNND-LTNWQKLK-PKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNPFIEFISIIRIMRLFKLTRH---IYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTS-------NPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRR 1411
            SG D RVILNVGG RHETY +TL+ +P +RL+ + E     A+YDP  NE FFDRHPGVFA +LNYYRTGKLH P DVCGPLFEEEL FW ++  Q+EPCCW  YT HRD Q TL+  + +  D +             + EY+  + L   QK K  + WALLE+  SS  A+I++ +S+  I++S+  FC+++ P          F +               A+   F   E L  +WF+ E   R I  P    F K+F+  +D+ +++  Y+           +  ++F+ ++R++R+F+L R    + G++++  T +ASA+EL LLV  L++ +V+F+ L++YAE+  S       N   +F SIP+  WWAI+TMTTVGYGD+ PKT  G  IG LCA  GVL ++LPV VI SNF++FYSH QA+ KLPKK+ +
Sbjct:    3 SGKD-RVILNVGGYRHETYLSTLRVVPDSRLAWIGENASKQADYDPETNEIFFDRHPGVFANVLNYYRTGKLHCPGDVCGPLFEEELAFWGIEELQMEPCCWSNYTQHRDAQATLKAFEGLQKDTE-------------DSEYEAGERLARRQKTKMQQFWALLEQPYSSKYAQILAMVSLVIIILSVTTFCIESMP----------FAD---------------AFKKEFQILEILYCVWFTFEFVARAIACPSKVEFIKNFMTWVDVLSIIPLYISF------AKGDQTLDFLFVLRLVRIFRLFRFFRTMSGMQVIGHTLRASARELFLLVLILLIPMVIFSTLVFYAEKSVSKFLNQRINSKGEFPSIPDAFWWAIITMTTVGYGDVTPKTPHGRFIGTLCACIGVLIVALPVSVIGSNFTLFYSHAQAQLKLPKKKHK 400          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: ENSORLT00000045623.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:101168545])

HSP 1 Score: 360.918 bits (925), Expect = 3.897e-116
Identity = 205/445 (46.07%), Postives = 279/445 (62.70%), Query Frame = 2
Query:  143 RVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFG----LEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSN----PFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILP 1420
            ++++N GGIRHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP  FA ILNYYRTGKLH P+DVCGPLFEEEL FW +D   VE CCWM Y  HRD +E L   +  + D  +          G    L  +      T WQ  +P +WAL E+  SS  A+ V+  S+ FIL+SI  FCL+T+  F +    T  V     + + IV    +       Y E +C IWF+IE+  R+I  P    FF+  +N+ID  A+V FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  ++PN+        F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLPKKR + +P
Sbjct:   10 KIVINCGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKSDEFFFDRHPATFAFILNYYRTGKLHCPSDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPDAPEDDPALTGCADGDLKRLCMQEDGRRATRWQVWQPWMWALFEDPYSSKYARYVAFASLFFILLSISTFCLETHEAFNTIYNKTENVTVGNFTHEEIVYE--VVTDGWLTYVEGVCVIWFTIEVMARVIFCPDKAEFFRSALNIIDFVAIVPFYLEVALSGLSSKTAKDILSFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPNDPTAAAHTTFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKRNKHIP 452          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101165633])

HSP 1 Score: 353.984 bits (907), Expect = 1.044e-113
Identity = 199/462 (43.07%), Postives = 287/462 (62.12%), Query Frame = 2
Query:  122 SMSGIDNRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRV------------DIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVN--DSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILP 1420
             +S   +R+++NVGGIRH+TY++TL+ +P TRLS L E  A    +YD  + E+FFDRHPGVFA ILNYYRTGKLH P DVCGPL+EEEL FW +D   VEPCCWMTY  HR+ +E L                  + +  +    E+  +    D       + W + + ++WAL E+  SS  A+ ++  S+ FIL+SI  FCL+T+  F +P +   +V   D+ ++ +    +   AY     Y E +C +WF+ E  +R+   P  + F ++ +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  +NPN+        F +IP G WWA+VTMTT+GYGDM PKT  GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLPKK+ R +P
Sbjct:    2 GLSDDKDRIVINVGGIRHQTYRSTLRTLPGTRLSWLAEPDAPNHFDYDAKIEEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGGLLDLGSDDPDPEPEHTEDEVDEMTRRLAQGDSPDARSGSLWSRWQKRVWALFEDPYSSKYARWIALASLFFILVSITTFCLETHEAF-NPIVNRTYVEHLDNITTENTYQETETAAY---LTYIEGVCVVWFTFEFLMRITFCPNKFDFIRNALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPRASDHTQFKNIPIGFWWAVVTMTTLGYGDMYPKTTFGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNRHIP 459          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101165633])

HSP 1 Score: 353.599 bits (906), Expect = 1.952e-113
Identity = 199/462 (43.07%), Postives = 287/462 (62.12%), Query Frame = 2
Query:  122 SMSGIDNRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRV------------DIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVN--DSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILP 1420
             +S   +R+++NVGGIRH+TY++TL+ +P TRLS L E  A    +YD  + E+FFDRHPGVFA ILNYYRTGKLH P DVCGPL+EEEL FW +D   VEPCCWMTY  HR+ +E L                  + +  +    E+  +    D       + W + + ++WAL E+  SS  A+ ++  S+ FIL+SI  FCL+T+  F +P +   +V   D+ ++ +    +   AY     Y E +C +WF+ E  +R+   P  + F ++ +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  +NPN+        F +IP G WWA+VTMTT+GYGDM PKT  GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A+ KLPKK+ R +P
Sbjct:    2 GLSDDKDRIVINVGGIRHQTYRSTLRTLPGTRLSWLAEPDAPNHFDYDAKIEEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGGLLDLGSDDPDPEPEHTEDEVDEMTRRLAQGDSPDARSGSLWSRWQKRVWALFEDPYSSKYARWIALASLFFILVSITTFCLETHEAF-NPIVNRTYVEHLDNITTENTYQETETAAY---LTYIEGVCVVWFTFEFLMRITFCPNKFDFIRNALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPRASDHTQFKNIPIGFWWAVVTMTTLGYGDMYPKTTFGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNRHIP 459          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: kcnc2 (potassium voltage-gated channel subfamily C member 2 [Source:NCBI gene;Acc:101159160])

HSP 1 Score: 341.658 bits (875), Expect = 5.830e-109
Identity = 194/441 (43.99%), Postives = 268/441 (60.77%), Query Frame = 2
Query:  137 DNRVILNVGGIRHETYKATLKKIPATRLSRLTE---------------ALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 1381
            + R+ILNVGG RHETYK+TLK +P TRL+ L                     Y+    +YFFDRHPGVFA +LNYYRTGKLH P DVCGPLFEEEL FW +D   VEPCCWMTY  HRD +E L + +    + D+  ++       +ED + + +   W+K +P +W L E+  SS  A+ V+  S+ FIL+SI  FCL+T+  F   N      N   +S   +V    I   P   Y E +C  WF+IE  +R+   P    F K+ +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  +  N+        F +IP G WWA+VTMTT+GYGDM P+T+ GM++GALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    7 NERIILNVGGTRHETYKSTLKTLPGTRLALLASDSDIDSVLDQLQQVPGFIEYNARTKQYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEALDVFELNVDNGDEDDDVGGGLG--IEDVHVDGNAGLWRKWQPVIWNLFEDPYSSRAARFVAFASLFFILVSITTFCLETHEAF---NTIINKTNMRNNSCQDLVPQYEIETDPALTYVEGVCVFWFTIEFLVRVTFCPVKLEFVKNVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAKANDPTASQHTKFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMVVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 442          
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Match: ENSORLT00000008692.2 (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101159863])

HSP 1 Score: 339.732 bits (870), Expect = 1.270e-108
Identity = 198/436 (45.41%), Postives = 274/436 (62.84%), Query Frame = 2
Query:  143 RVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFG-LEDEYQNNDLTN---WQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPV----FFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNP----FIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNN-------DFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 1381
            ++++N GG+RHETY++TLK +P TRLS LTE  A    +YDP L+E+FFDRHP VF+ ILNYYRTGKLH P DVCGPLFEEEL FW +D   VE CCWM Y  HRD +E L   +          +  L G  G L+      D      W+  +P++WAL E+  SS  A+ V+ +S+ FILISI  FC++T+  F +        N + + +   V    I Y  V      Y E +C IWF+IE+ LR+   P    FFK  +N+ID  A++ FY+++ L  L+  +      F+  +  +RI+R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER  ++P++       +F +IP G WWA+VTMTT+GYGDM P+T+ GML+GALCA+ GVLTI++PVPVIV+NF M+YS   A
Sbjct:    9 KIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKLDEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFE-TPEPDAPDDDPALGGADGDLKRLCMQEDARRAGWWKTWQPRIWALFEDPYSSKYARYVAFMSLFFILISISTFCMETHEAFNT------IYNKTENVTIGNVTREEIVYEVVTDSWLTYVEGVCVIWFTIEVLLRVTFCPDKLEFFKSALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 437          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000015781.1 (SMESG000015781.1)

HSP 1 Score: 766.918 bits (1979), Expect = 0.000e+0
Identity = 406/407 (99.75%), Postives = 407/407 (100.00%), Query Frame = 2
Query:  125 MSGIDNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIV 1345
            MSGIDNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKIVSTLSITFILISIVAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSLLVFFLVVFIVVFAALIYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVI+
Sbjct:    1 MSGIDNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKIVSTLSITFILISIVAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSLLVFFLVVFIVVFAALIYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVII 407          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000054802.1 (SMESG000054802.1)

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 339/496 (68.35%), Postives = 395/496 (79.64%), Query Frame = 2
Query:  125 MSGIDNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVIS---RGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVRPKLKESRN----INNMLFNQQFFPGKSNSDQKSNEERVQRMVRSSALQQMMPFTSL 1591
            M+  +NRVILNVGGIRHETYKATLKKIPATRLS+LTEALANYDP+LNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFW LDSNQVEPCCWMTYT HR TQ+TLQILDR+DID ++ +E ELY +FGLE+E+++N+L+ WQK +P++W++LEE  SS  AK+VS + I+ ILISI++FC+KT P +  P +     N S     F   S   + I  H VFFY E +CN WFSIE+ LR+IV+     FF D +N+IDI AL+SFY+D+   Y N+  +  IEF+SI+RIMRLFKLTRHI GLKILILTFKASAKELSLLVFFLVVFI VFAALIYYAE+FT N  NDF SIPNGLWWAI TMTTVGYGDMVPKTYPGML+GALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRR+LPVEAVRPK K + N     +N  + Q      +       +E++QR+    ALQQ++P  SL
Sbjct:    1 MTDAENRVILNVGGIRHETYKATLKKIPATRLSKLTEALANYDPMLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTAHRSTQDTLQILDRIDIDTERTSESELYKRFGLEEEFEDNELSFWQKWRPRIWSVLEEPYSSVLAKLVSGIGISIILISIISFCMKTYPGYSIPLILNHTYNVSIGGDLFQSWSLSQKEIQPHTVFFYTECICNAWFSIELILRMIVTASCRSFFHDVLNIIDIFALLSFYIDVSFVYFNIEKSHLIEFMSILRIMRLFKLTRHISGLKILILTFKASAKELSLLVFFLVVFIAVFAALIYYAEKFTKNELNDFTSIPNGLWWAICTMTTVGYGDMVPKTYPGMLVGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKFKGAPNNFLTSSNAAWVQNRRLAITGKGPSLIDEKLQRL----ALQQLIPMKSL 492          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000054802.1 (SMESG000054802.1)

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 327/448 (72.99%), Postives = 374/448 (83.48%), Query Frame = 2
Query:  125 MSGIDNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVIS---RGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVRPKLKESRN 1459
            M+  +NRVILNVGGIRHETYKATLKKIPATRLS+LTEALANYDP+LNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFW LDSNQVEPCCWMTYT HR TQ+TLQILDR+DID ++ +E ELY +FGLE+E+++N+L+ WQK +P++W++LEE  SS  AK+VS + I+ ILISI++FC+KT P +  P +     N S     F   S   + I  H VFFY E +CN WFSIE+ LR+IV+     FF D +N+IDI AL+SFY+D+   Y N+  +  IEF+SI+RIMRLFKLTRHI GLKILILTFKASAKELSLLVFFLVVFI VFAALIYYAE+FT N  NDF SIPNGLWWAI TMTTVGYGDMVPKTYPGML+GALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRR+LPVEAVRPK K + N
Sbjct:    1 MTDAENRVILNVGGIRHETYKATLKKIPATRLSKLTEALANYDPMLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTAHRSTQDTLQILDRIDIDTERTSESELYKRFGLEEEFEDNELSFWQKWRPRIWSVLEEPYSSVLAKLVSGIGISIILISIISFCMKTYPGYSIPLILNHTYNVSIGGDLFQSWSLSQKEIQPHTVFFYTECICNAWFSIELILRMIVTASCRSFFHDVLNIIDIFALLSFYIDVSFVYFNIEKSHLIEFMSILRIMRLFKLTRHISGLKILILTFKASAKELSLLVFFLVVFIAVFAALIYYAEKFTKNELNDFTSIPNGLWWAICTMTTVGYGDMVPKTYPGMLVGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKFKGAPN 448          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000028623.1 (SMESG000028623.1)

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 327/454 (72.03%), Postives = 378/454 (83.26%), Query Frame = 2
Query:  125 MSGIDNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKT-EIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVN----------DSTSSS--DFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNPFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVRPKLK 1447
            M+  D+RVILNVGGIRHETYKATLKKIPATRLS+LTEALANYDP+LNEYFFDRHPGVF QILNYYR+GKLHYPTDVCGPLFEEELEFW LDSNQVEPCCWMTYT HR+TQETLQILDRVDID  ++T + +LY KFGLE+EY++NDLT WQ  +P +W+++EE  S+  AK +S LSI+FILISI + CLKT   +  P + T+ +           D+ SSS   F  ++R    H +F   E  CNIWF+IEI LRL V+P + +FF+DF+N IDI AL+SFY+++   +   +SN  +EF++I R+MRLFKLTRHI GLKILILTFKASAKELSLLVFFLVVFIVVFAALIYYAERFT NP NDF+SIPNGLWWA+VTMTTVGYGDMVPKTYPGML+GALCA+TGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRR+LPVEAVRPK K
Sbjct:    1 MTDADHRVILNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPGVFGQILNYYRSGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTAHRNTQETLQILDRVDIDNSERTNDYDLYKKFGLEEEYEDNDLTFWQMWRPLIWSMMEEPYSTRLAKAISGLSISFILISITSLCLKTYSGYTIPIIVTMPIGNRSVYLDGLRDTFSSSVWSFQCLTR--KPHHIFVLIEMGCNIWFTIEIILRLSVTPSLMKFFQDFLNFIDIVALLSFYIEIAFIWFRANSNQLVEFLAIFRVMRLFKLTRHISGLKILILTFKASAKELSLLVFFLVVFIVVFAALIYYAERFTKNPTNDFISIPNGLWWALVTMTTVGYGDMVPKTYPGMLVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKAK 452          
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Match: SMESG000071446.1 (SMESG000071446.1)

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 297/439 (67.65%), Postives = 359/439 (81.78%), Query Frame = 2
Query:  137 DNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCWMTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQKLKPKLWALLEESNSSHGAKXXXXXXXXXXXXXXXAFCLKTNPNFKSPNLFTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSPFVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSN----PFIEFISIIRIMRLFKLTRHIYGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFTSNPNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVRPK 1441
            +NRVILN+GG RHETYKATLKKIPATRLS+LTEALANYDPVLNEYFFDRHPGVF+Q+LNYYRTGKLHYPTDVCGPL+EEELEFW LDSNQVEPCCWMTYT HR T+ETLQIL+ +DID DK ++ +LY KFGLE+++Q+ D+  W+KL+ K+WA+ E+  SS  +KIV+ +++ FI+ISI++FCLKT  +F+ PNL  + V+D++S   + +       H +F Y E++CN+WF+IEI +R +V+P  + F K  +N+ID  AL+SFY+D+ L  +  S        +EF SIIRIMRLFKLTRHI GL IL+ TF+AS KEL LLVFFL VFIV+FAAL+YYAERF  N  N F SIP GLWWAIVTMTTVGYGDMVP TY GM +GALCA+TGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRR+LPVE+VRPK
Sbjct:   53 ENRVILNIGGFRHETYKATLKKIPATRLSKLTEALANYDPVLNEYFFDRHPGVFSQVLNYYRTGKLHYPTDVCGPLYEEELEFWGLDSNQVEPCCWMTYTRHRSTEETLQILNDIDIDTDKVSKDDLYAKFGLEEKHQSGDIQWWEKLQVKIWAIFEDPYSSTSSKIVAVITVFFIVISILSFCLKTASHFRIPNLHNISVSDNSS---WAISKSSPQTHQIFSYVEYICNLWFTIEIIIRSLVAPSKFIFLKSPVNIIDFLALLSFYLDIILSNMWESGQMENLEMLEFFSIIRIMRLFKLTRHIAGLNILVHTFRASLKELVLLVFFLCVFIVIFAALMYYAERFQHNSKNHFNSIPQGLWWAIVTMTTVGYGDMVPHTYIGMTVGALCAITGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVESVRPK 488          
The following BLAST results are available for this feature:
BLAST of Voltage gated potassium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNC23.470e-11542.23potassium voltage-gated channel subfamily C member... [more]
KCNC27.906e-11542.23potassium voltage-gated channel subfamily C member... [more]
KCNC27.987e-11542.23potassium voltage-gated channel subfamily C member... [more]
KCNC27.987e-11542.23potassium voltage-gated channel subfamily C member... [more]
KCNC21.382e-11442.23potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shw-37.294e-17858.96SHaW family of potassium channels [Source:UniProt... [more]
shw-38.528e-17859.96SHaW family of potassium channels [Source:UniProt... [more]
shw-31.196e-17759.96SHaW family of potassium channels [Source:UniProt... [more]
shw-14.286e-17459.73SHaW family of potassium channels [Source:UniProt... [more]
shw-13.134e-17256.01SHaW family of potassium channels [Source:UniProt... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Shaw0.000e+066.29gene:FBgn0003386 transcript:FBtr0289989[more]
Shaw0.000e+066.29gene:FBgn0003386 transcript:FBtr0089275[more]
Shaw0.000e+066.29gene:FBgn0003386 transcript:FBtr0332185[more]
Shaw0.000e+066.29gene:FBgn0003386 transcript:FBtr0089274[more]
Shaw0.000e+066.29gene:FBgn0003386 transcript:FBtr0332184[more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc1a9.475e-11742.32potassium voltage-gated channel, Shaw-related subf... [more]
kcnc1a1.166e-11642.32potassium voltage-gated channel, Shaw-related subf... [more]
kcnc1a1.293e-11642.32potassium voltage-gated channel, Shaw-related subf... [more]
kcnc21.572e-11344.37potassium voltage-gated channel, Shaw-related subf... [more]
kcnc23.616e-11344.37potassium voltage-gated channel, Shaw-related subf... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNC24.325e-12144.52potassium channel, voltage gated Shaw related subf... [more]
KCNC21.203e-12044.52potassium channel, voltage gated Shaw related subf... [more]
KCNC43.086e-11344.29potassium channel, voltage gated Shaw related subf... [more]
tamm413.543e-11345.98TAM41 mitochondrial translocator assembly and main... [more]
tamm413.688e-11345.98TAM41 mitochondrial translocator assembly and main... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnc17.129e-11443.67potassium voltage gated channel, Shaw-related subf... [more]
Kcnc13.920e-11343.67potassium voltage gated channel, Shaw-related subf... [more]
Kcnc21.127e-10846.77potassium voltage gated channel, Shaw-related subf... [more]
Kcnc21.300e-10846.77potassium voltage gated channel, Shaw-related subf... [more]
Kcnc47.738e-10742.05potassium voltage gated channel, Shaw-related subf... [more]
back to top
BLAST of Voltage gated potassium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P17972|KCNAW_DROME0.000e+066.29Potassium voltage-gated channel protein Shaw OS=Dr... [more]
sp|G5EFC3|KCNAG_CAEEL7.462e-16758.80Potassium voltage-gated channel protein egl-36 OS=... [more]
sp|P48547|KCNC1_HUMAN2.887e-11343.89Potassium voltage-gated channel subfamily C member... [more]
sp|P15388|KCNC1_MOUSE4.987e-11343.67Potassium voltage-gated channel subfamily C member... [more]
sp|P25122|KCNC1_RAT2.742e-11243.67Potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Voltage gated potassium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R2MT200.000e+064.47potassium voltage-gated channel protein Shaw isofo... [more]
A0A2R2MT170.000e+064.14potassium voltage-gated channel protein Shaw isofo... [more]
A0A2R2MT250.000e+064.27potassium voltage-gated channel protein Shaw isofo... [more]
A0A2R2MT020.000e+064.46potassium voltage-gated channel protein Shaw isofo... [more]
A0A2R2MTQ00.000e+069.03potassium voltage-gated channel protein Shaw isofo... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc26.087e-11144.09potassium voltage-gated channel, Shaw-related subf... [more]
ENSAMXT00000048024.11.267e-11044.95potassium voltage-gated channel subfamily C member... [more]
kcnc21.688e-11044.22potassium voltage-gated channel, Shaw-related subf... [more]
ENSAMXT00000012289.22.570e-11044.95potassium voltage-gated channel subfamily C member... [more]
ENSAMXT00000049045.12.696e-11044.95potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc1a1.491e-11747.63potassium voltage-gated channel, Shaw-related subf... [more]
ENSPMAT00000004235.12.236e-8137.16pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-... [more]
kcna1b9.042e-7238.31potassium voltage-gated channel, shaker-related su... [more]
kcna1b4.377e-7037.92potassium voltage-gated channel, shaker-related su... [more]
kcna1b6.631e-7037.92potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO398049.943e-12045.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427246.377e-11950.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382373.884e-11043.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451721.399e-9741.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480661.597e-9642.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Voltage gated potassium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000045623.13.897e-11646.07potassium voltage-gated channel subfamily C member... [more]
kcnc1b1.044e-11343.07potassium voltage-gated channel subfamily C member... [more]
kcnc1b1.952e-11343.07potassium voltage-gated channel subfamily C member... [more]
kcnc25.830e-10943.99potassium voltage-gated channel subfamily C member... [more]
ENSORLT00000008692.21.270e-10845.41potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Voltage gated potassium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015781.10.000e+099.75SMESG000015781.1[more]
SMESG000054802.10.000e+068.35SMESG000054802.1[more]
SMESG000054802.10.000e+072.99SMESG000054802.1[more]
SMESG000028623.10.000e+072.03SMESG000028623.1[more]
SMESG000071446.10.000e+067.65SMESG000071446.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034362 ID=SMED30034362|Name=Voltage gated potassium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=1951bp
CCGCTATAAATCATTAGTTAGATTTCCAAACAGATTCTTCTTCCAACAGA
AATATTTTTATCGGAATTAAGATGAAGAAAGCTCTTTGACAAGACCGTTT
TATTTAATCTTTGCCGGTTTTTCCATGAGTGGCATTGACAATCGAGTTAT
TCTAAATGTCGGGGGGATCCGGCATGAGACTTATAAAGCCACGTTGAAAA
AGATTCCTGCAACACGTTTGTCTCGATTGACCGAGGCGCTTGCCAACTAT
GACCCGGTTTTAAATGAATATTTCTTTGATCGACATCCAGGAGTATTTGC
TCAAATTCTCAACTATTATCGGACTGGGAAACTTCATTATCCAACTGATG
TTTGTGGTCCGCTTTTCGAGGAGGAATTGGAATTTTGGAGTCTTGATTCT
AACCAAGTTGAACCTTGTTGTTGGATGACTTATACAATTCACAGAGATAC
ACAAGAGACTCTACAAATTCTTGACAGAGTTGACATTGACAAAGACAAGA
AAACTGAAATCGAACTTTATGGAAAGTTTGGACTGGAAGACGAATACCAA
AATAATGATCTAACCAATTGGCAAAAGCTGAAACCAAAGTTGTGGGCTTT
GTTGGAAGAATCAAATTCTTCTCATGGAGCTAAGATAGTTTCTACTCTCA
GCATCACATTCATATTAATTTCAATTGTGGCCTTCTGTCTTAAAACGAAT
CCTAATTTTAAGTCACCAAATTTATTTACAGTATTCGTAAATGATTCGAC
TTCCTCCAGTGATTTCATTGTCATTTCTCGAGGAATTGCGTATCATCCTG
TTTTTTTCTATGCGGAATTTCTTTGCAACATTTGGTTCAGTATTGAGATC
TCTCTCCGGTTGATCGTTTCTCCGTTTGTATACAGATTTTTCAAAGATTT
CATCAATCTCATAGACATTGCCGCGCTGGTTTCATTCTATGTTGATTTAT
TCTTATTCTATCTCAATGTTTCATCGAATCCTTTCATCGAGTTCATCAGT
ATTATTAGAATTATGAGATTGTTTAAATTAACTCGTCACATTTACGGTTT
GAAGATTTTGATATTGACATTTAAGGCGAGTGCAAAAGAATTATCTTTGT
TGGTTTTTTTCCTGGTTGTTTTTATTGTGGTTTTTGCGGCGTTAATTTAT
TATGCTGAAAGATTCACCAGTAATCCGAATAATGACTTTGTATCTATTCC
AAATGGCTTGTGGTGGGCCATAGTTACCATGACAACTGTCGGATATGGTG
ACATGGTACCAAAAACCTATCCTGGAATGTTAATCGGAGCGTTATGTGCC
GTAACAGGAGTGCTGACAATATCTTTGCCAGTTCCAGTTATTGTTAGTAA
TTTCTCCATGTTTTATTCTCATACCCAAGCTAGATCTAAGCTACCCAAAA
AAAGAAGACGAATTCTTCCAGTCGAAGCTGTACGGCCTAAATTAAAAGAA
TCTAGAAACATTAATAATATGTTGTTTAATCAACAGTTCTTTCCTGGCAA
ATCAAATAGTGATCAAAAATCGAATGAAGAAAGAGTTCAAAGAATGGTGC
GATCTTCAGCGCTCCAACAAATGATGCCATTCACCAGTTTAAATGCTTTA
AATCCTGGTGTGTTTGCCTTGTCTTCTTCGATTCCTTTGCCGAAATTAAA
GCCTCAACCTCAATTGCCCATAAATTTGGAAATCGGAAACAATTCCAAAA
CATCCAAAAGAAAAAGTCTCAAAGACCTACCATTGGTAAATGAGAACATT
AAACCGGAAACGACAAAATTTATTCAAAATTTAATCGAAGAACCCAATGA
CTCCGAAAAGAAATTTACAAAACGAAGAATTTCTAATTTTTTAAACCGAA
AGTCTTCTCAAAATAACACAGTTTGTTCAACGATATCGGAAAATGAAGAC
TAATTAATTTCTTATAATTTTAATACATAATCTATAGGTAAAAAAAAACA
A
back to top

protein sequence of SMED30034362-orf-1

>SMED30034362-orf-1 ID=SMED30034362-orf-1|Name=SMED30034362-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=593bp
MSGIDNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYF
FDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWSLDSNQVEPCCW
MTYTIHRDTQETLQILDRVDIDKDKKTEIELYGKFGLEDEYQNNDLTNWQ
KLKPKLWALLEESNSSHGAKIVSTLSITFILISIVAFCLKTNPNFKSPNL
FTVFVNDSTSSSDFIVISRGIAYHPVFFYAEFLCNIWFSIEISLRLIVSP
FVYRFFKDFINLIDIAALVSFYVDLFLFYLNVSSNPFIEFISIIRIMRLF
KLTRHIYGLKILILTFKASAKELSLLVFFLVVFIVVFAALIYYAERFTSN
PNNDFVSIPNGLWWAIVTMTTVGYGDMVPKTYPGMLIGALCAVTGVLTIS
LPVPVIVSNFSMFYSHTQARSKLPKKRRRILPVEAVRPKLKESRNINNML
FNQQFFPGKSNSDQKSNEERVQRMVRSSALQQMMPFTSLNALNPGVFALS
SSIPLPKLKPQPQLPINLEIGNNSKTSKRKSLKDLPLVNENIKPETTKFI
QNLIEEPNDSEKKFTKRRISNFLNRKSSQNNTVCSTISENED*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR015572Shaw_inv
IPR003974K_chnl_volt-dep_Kv3
IPR028325VG_K_chnl
IPR003968K_chnl_volt-dep_Kv
IPR000210BTB/POZ_dom
IPR027359Volt_channel_dom_sf
IPR003131T1-type_BTB
IPR005821Ion_trans_dom
IPR011333SKP1/BTB/POZ_sf
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005515protein binding
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005267potassium channel activity
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0051260protein homooligomerization
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0006810transport
GO:0034765regulation of ion transmembrane transport
GO:0071805potassium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003968Potassium channel, voltage dependent, KvPRINTSPR01491KVCHANNELcoord: 298..306
score: 62.41
coord: 395..406
score: 78.06
coord: 322..336
score: 45.39
coord: 48..58
score: 74.09
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 48..67
score: 64.23
coord: 322..345
score: 47.98
coord: 355..377
score: 73.2
coord: 163..191
score: 41.17
coord: 384..410
score: 63.19
coord: 229..252
score: 36.0
coord: 255..275
score: 38.0
coord: 293..319
score: 51.55
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 307..418
e-value: 5.2E-31
score: 108.6
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 3..116
e-value: 2.9E-52
score: 177.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 570..592
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 571..592
NoneNo IPR availableCDDcd18416BTB_Shaw-likecoord: 5..116
e-value: 2.07718E-87
score: 264.517
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 166..411
NoneNo IPR availableTMHMMTMhelixcoord: 226..248
NoneNo IPR availableTMHMMTMhelixcoord: 325..344
NoneNo IPR availableTMHMMTMhelixcoord: 260..282
NoneNo IPR availableTMHMMTMhelixcoord: 385..407
NoneNo IPR availableTMHMMTMhelixcoord: 356..375
IPR003974Potassium channel, voltage dependent, Kv3PRINTSPR01498SHAWCHANNELcoord: 49..62
score: 85.32
coord: 420..434
score: 57.04
coord: 64..79
score: 91.32
coord: 160..172
score: 38.89
coord: 82..103
score: 76.26
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 6..105
e-value: 3.1E-12
score: 56.6
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 141..305
e-value: 3.8E-42
score: 145.5
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 170..417
e-value: 3.6E-36
score: 124.6
IPR003131Potassium channel tetramerisation-type BTB domainPFAMPF02214BTB_2coord: 8..98
e-value: 1.3E-28
score: 99.2
IPR028325Voltage-gated potassium channelPANTHERPTHR11537VOLTAGE-GATED POTASSIUM CHANNELcoord: 4..463
IPR015572Potassium channel, voltage dependent, Shaw, invertebratePANTHERPTHR11537:SF257POTASSIUM VOLTAGE-GATED CHANNEL PROTEIN SHAWcoord: 4..463
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 5..106