FYVE, RhoGEF and PH domain containing 6

Overview
NameFYVE, RhoGEF and PH domain containing 6
Smed IDSMED30034357
Length (bp)2016
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FYVE, RhoGEF and PH domain containing 6 (SMED30034357) t-SNE clustered cells

Violin plots show distribution of expression levels for FYVE, RhoGEF and PH domain containing 6 (SMED30034357) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FYVE, RhoGEF and PH domain containing 6 (SMED30034357) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FYVE, RhoGEF and PH domain containing 6 (SMED30034357) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034357

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30034357SMESG000070146.1 dd_Smed_v4_9886_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034357SMESG000070146.1 dd_Smed_v4_9886_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034357SMESG000070146.1 dd_Smed_v4_9886_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034357SMESG000070146.1 dd_Smed_v4_9886_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Human
Match: FGD6 (FYVE, RhoGEF and PH domain containing 6 [Source:HGNC Symbol;Acc:HGNC:21740])

HSP 1 Score: 70.8626 bits (172), Expect = 7.512e-13
Identity = 57/216 (26.39%), Postives = 107/216 (49.54%), Query Frame = 2
Query:  830 ISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEI---PPKNI----------ASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHK 1438
            ++G  + ++    F+ +GI   L++K  +  R+  LF+D L  T+ P   +G  K+   LS++ + + +  ++          L I + E +F     +    ++W   ++  ++++++  I   P +++           S +G  AP W  D+ A  C    C+ +FT   RRHHCRA G + C +C+S K  L +LKN  ++VCE C++ L K
Sbjct:   73 LNGHHEIVQPGRVFLKEGILMKLSRKVMQP-RMFFLFNDALLYTT-PVQ-SGMYKLNNMLSLAGMKVRKPTQEAYQN-----ELKIESVERSFILSASSATERDEWLEAISRAIEEYAKKRITFCPSRSLDEADSENKEEVSPLGSKAPIWIPDTRATMC--MICTSEFTLTWRRHHCRACGKIVCQACSSNKYGLDYLKNQPARVCEHCFQELQK 278          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Human
Match: FGD6 (FYVE, RhoGEF and PH domain containing 6 [Source:HGNC Symbol;Acc:HGNC:21740])

HSP 1 Score: 72.4034 bits (176), Expect = 2.366e-12
Identity = 90/373 (24.13%), Postives = 156/373 (41.82%), Query Frame = 2
Query:  830 ISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCL-YVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFS-------------EAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNS---------------------HALNEAKKNLKTVFDLK-----TRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTE 1828
            ++G  + ++    F+ +GI   L++K  +  R+  LF+D L Y T +    +G  K+   LS++ + + +  ++          L I + E +F     +    ++W   ++  +++++             EA+   K   S +G  AP W  D+ A  C    C+ +FT   RRHHCRA G + C +C+S K  L +LKN  ++VCE C++ L K  H                       H++   +K  K    LK     T   + SG+L     N +      P K+F    +K+  L  Y   ED        L+G ++          K+    F + H++    Y+FK   A   QKW++   E
Sbjct: 1077 LNGHHEIVQPGRVFLKEGILMKLSRKVMQP-RMFFLFNDALLYTTPV---QSGMYKLNNMLSLAGMKVRKPTQEAYQN-----ELKIESVERSFILSASSATERDEWLEAISRAIEEYAKKRITFCPSRSLDEADSENKEEVSPLGSKAPIWIPDTRATMC--MICTSEFTLTWRRHHCRACGKIVCQACSSNKYGLDYLKNQPARVCEHCFQELQKLDHQHSPRIGSPGNHKSPSSALSSVLHSIPSGRKQKKIPAALKEVSANTEDSSMSGYLYRSKGNKK------PWKHFW-FVIKNKVLYTYAASEDVAALESQPLLGFTVIQVKDENSESKV----FQLLHKNM-LFYVFKAEDAHSAQKWIEAFQE 1426          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Human
Match: FGD6 (FYVE, RhoGEF and PH domain containing 6 [Source:HGNC Symbol;Acc:HGNC:21740])

HSP 1 Score: 69.3218 bits (168), Expect = 1.953e-11
Identity = 57/204 (27.94%), Postives = 99/204 (48.53%), Query Frame = 2
Query:  869 FIYKGITFCLNKKDEKIFRILVLFSDCL-YVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFS-------------EAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHK 1438
            F+ +GI   L++K  +  R+  LF+D L Y T +    +G  K+   LS++ + + +  ++          L I + E +F     +    ++W   ++  +++++             EA+   K   S +G  AP W  D+ A  C    C+ +FT   RRHHCRA G + C +C+S K  L +LKN  ++VCE C++ L K
Sbjct: 1090 FLKEGILMKLSRKVMQP-RMFFLFNDALLYTTPV---QSGMYKLNNMLSLAGMKVRKPTQEAYQN-----ELKIESVERSFILSASSATERDEWLEAISRAIEEYAKKRITFCPSRSLDEADSENKEEVSPLGSKAPIWIPDTRATMC--MICTSEFTLTWRRHHCRACGKIVCQACSSNKYGLDYLKNQPARVCEHCFQELQK 1282          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Human
Match: FGD4 (FYVE, RhoGEF and PH domain containing 4 [Source:HGNC Symbol;Acc:HGNC:19125])

HSP 1 Score: 64.3142 bits (155), Expect = 5.738e-10
Identity = 98/463 (21.17%), Postives = 192/463 (41.47%), Query Frame = 2
Query:  494 LDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRY-NKCFDESNELRKKGKEVEXXXXXXXXXXXXXQKQIFLAQK-ELSLISGRSKDL-KLNSRFIYKGITFCLNKKDEKIF-RILVLFSDCLYVTSLPGNITGA-CKVKEELSMSNLIITRTIEDE-SNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPPKNI------------ASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRR-HHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHP-YLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYL 1822
            L +Y  ++  + N+ + + +M      F  + E ++K+K I   +TL   +      +  + M L  Y  K   +S +     K +E I     +  +  +K   L +  E+  + G  +D+   ++  I +G    L  ++     R L LF++ L       ++ G+   V+  + +  + I  T  +E  + F+      ++ +E T +    +     +W   L +T+  F +     +N              + +G+ APRW +D+    C    C + F  + RR HHCRA G + C  C+ +K +L++     SKVC+ CY+I+      S   +  +K  K + ++++ + + +  +   +   EK    P  K +C +  + P  L +Y   +D R    I L+G  +     S       P  F +        + F  +S E  QKW+  +
Sbjct:  203 LKMYGEYVKGFDNAMELVKNMTERIPQFKSVVEEIQKQK-ICGSLTLQHHMLEPVQRIPRYEMLLKDYLRKLPPDSLDWNDAKKSLEIISTAASHSNSAIRKMENLKKLLEIYEMLGEEEDIVNPSNELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPKFSLVGSKFTVRTRVGIDGMKIVETQNEEYPHTFQ------VSGKERTLELQASSAQDKEEWIKALQETIDAFHQRHETFRNAIAKDNDIHSEVSTAELGKRAPRWIRDNEVTMC--MKCKEPFNALTRRRHHCRACGYVVCWKCSDYKAQLEYDGGKLSKVCKDCYQII------SGFTDSEEKKRKGILEIESAEVSGNSVVCSFLQYMEKS--KPWQKAWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYVVDEMPRSADL----PHSFKLTQSKS--VHSFAADSEELKQKWLKVI 642          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Human
Match: ZFYVE9 (zinc finger FYVE-type containing 9 [Source:HGNC Symbol;Acc:HGNC:6775])

HSP 1 Score: 63.5438 bits (153), Expect = 1.055e-9
Identity = 32/73 (43.84%), Postives = 45/73 (61.64%), Query Frame = 2
Query: 1214 STIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRIL 1432
            +T+GE AP W  DS A  C    C  +FT   RRHHCRA G ++C SC S K KL ++   +++VC +C+ +L
Sbjct:  687 TTLGEVAPVWVPDSQAPNC--MKCEARFTFTKRRHHCRACGKVFCASCCSLKCKLLYMDRKEARVCVICHSVL 757          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Fly
Match: Sara (gene:FBgn0026369 transcript:FBtr0071641)

HSP 1 Score: 63.5438 bits (153), Expect = 6.173e-10
Identity = 33/79 (41.77%), Postives = 45/79 (56.96%), Query Frame = 2
Query: 1214 STIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHN 1450
            + +G+  P W  D+ AG C    C QKFT + RRHHCRA G + C  C S + +L+F    +S+VC  CY IL +   N
Sbjct:  519 ANLGKVPPIWVPDNMAGQC--MQCQQKFTMIKRRHHCRACGKVLCSVCCSQRFRLEFATEPESRVCVQCYMILSERQAN 595          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Fly
Match: fab1 (gene:FBgn0028741 transcript:FBtr0089555)

HSP 1 Score: 49.6766 bits (117), Expect = 9.841e-6
Identity = 25/65 (38.46%), Postives = 37/65 (56.92%), Query Frame = 2
Query: 1241 WQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXX-NSDSKVCELCYRIL 1432
            W  DS A  C  Y+CSQKF+   R+HHCR  G ++C  C +  +    ++ + D KVC  C +I+
Sbjct:  183 WMPDSKAKEC--YDCSQKFSTFRRKHHCRLCGQIFCSKCCNQVVPGMIIRCDGDLKVCNYCSKIV 245          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Fly
Match: fab1 (gene:FBgn0028741 transcript:FBtr0089554)

HSP 1 Score: 49.6766 bits (117), Expect = 9.841e-6
Identity = 25/65 (38.46%), Postives = 37/65 (56.92%), Query Frame = 2
Query: 1241 WQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXX-NSDSKVCELCYRIL 1432
            W  DS A  C  Y+CSQKF+   R+HHCR  G ++C  C +  +    ++ + D KVC  C +I+
Sbjct:  183 WMPDSKAKEC--YDCSQKFSTFRRKHHCRLCGQIFCSKCCNQVVPGMIIRCDGDLKVCNYCSKIV 245          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Zebrafish
Match: fgd6 (FYVE, RhoGEF and PH domain containing 6 [Source:ZFIN;Acc:ZDB-GENE-041210-200])

HSP 1 Score: 68.5514 bits (166), Expect = 2.332e-11
Identity = 110/478 (23.01%), Postives = 202/478 (42.26%), Query Frame = 2
Query:  494 LDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFDESNELRKKG-------KEVEXXXXXXXXXXXXXQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCL-YVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKW----KNLLNDTVKK----FSEAEIPPKNIAS---TIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCY-RILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSE-----------KGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTESM 1834
            L +Y +++ ++  +   + + CR+N  F  +        +   +  L   L      +  + + L  Y K   E +   K         KEV +   D++   +  QK   L Q + SL +G  + ++    F+ +G    L++K  +  R+  LF+D L Y T +    +G  KV   LS++ + +++  ++          LNI + E +F     +    ++W       ++D  +K    FS      + I+     +G  AP W  D     C    C+ +FT   RRHHCRA G + C +C+S K  L++LKN  ++VC+ CY ++ HK   ++   + + +     F  K +K   +  L+E   N+E           KG   P  + +    +K+  L  Y   ED        L+G  +R +      G  +  QF + H++    Y+F+       Q+W++   E+M
Sbjct:  861 LKMYSTYIREFDRNVALLDEQCRKNPPFSSVVRQFETSPRCASL-ALKHYLLKPVQRIPQYQLLLTDYLKNLPEDSSDYKDTQTALSVVKEVANHANDIMKQGDNFQK---LMQVQYSL-NGHHEIVQPGRVFLKEGTLMKLSRKVMQP-RMFFLFNDILLYTTPV---QSGQYKVNSMLSLAGMKVSKPSQEAYQN-----ELNIESVERSFILSANSATERDEWLEAIATAIDDYTRKKISFFSSRSQELEGISDDGLPLGSKAPIWIPDLRTTMC--MICTCEFTLTWRRHHCRACGKVVCQACSSNKFYLEYLKNQLARVCDHCYIKLQHKGDQSNVTFSPSGRGSTFAFSRKQKKIPSA--LKEVSANTENSSMSGYLHRSKGHKKPWKRLW--FVIKNKVLYTYAASEDVAALESQPLLGFFLREE----KTGPAQKLQFKLYHKNT-LYYIFRAEDIPTAQRWIEAFQEAM 1313          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Zebrafish
Match: plekhf2 (pleckstrin homology domain containing, family F (with FYVE domain) member 2 [Source:NCBI gene;Acc:393214])

HSP 1 Score: 64.6994 bits (156), Expect = 4.745e-11
Identity = 45/133 (33.83%), Postives = 59/133 (44.36%), Query Frame = 2
Query: 1037 TIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQ-KFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRIL 1432
            T+EDE    +  W   I     +F  Y       ++W + +N  V    E     K+  S  GE A  W  DS A  C    C + KFTPV RRHHCR  G + C  C+  K  L    +   +VCE CY+ L
Sbjct:   89 TVEDEGE-LRNGW--LIKTPTKSFAVYAATATEKSEWMSHINKCVSDLLE-----KSGKSPTGEHAAVWVPDSEATVC--MRCQKMKFTPVNRRHHCRKCGFVVCGPCSEKKFLLPSQSSKPVRVCEFCYKQL 211          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Zebrafish
Match: plekhf2 (pleckstrin homology domain containing, family F (with FYVE domain) member 2 [Source:NCBI gene;Acc:393214])

HSP 1 Score: 64.6994 bits (156), Expect = 4.745e-11
Identity = 45/133 (33.83%), Postives = 59/133 (44.36%), Query Frame = 2
Query: 1037 TIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQ-KFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRIL 1432
            T+EDE    +  W   I     +F  Y       ++W + +N  V    E     K+  S  GE A  W  DS A  C    C + KFTPV RRHHCR  G + C  C+  K  L    +   +VCE CY+ L
Sbjct:   89 TVEDEGE-LRNGW--LIKTPTKSFAVYAATATEKSEWMSHINKCVSDLLE-----KSGKSPTGEHAAVWVPDSEATVC--MRCQKMKFTPVNRRHHCRKCGFVVCGPCSEKKFLLPSQSSKPVRVCEFCYKQL 211          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Zebrafish
Match: fgd6 (FYVE, RhoGEF and PH domain containing 6 [Source:ZFIN;Acc:ZDB-GENE-041210-200])

HSP 1 Score: 67.3958 bits (163), Expect = 4.981e-11
Identity = 110/478 (23.01%), Postives = 202/478 (42.26%), Query Frame = 2
Query:  494 LDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFDESNELRKKG-------KEVEXXXXXXXXXXXXXQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCL-YVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKW----KNLLNDTVKK----FSEAEIPPKNIAS---TIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCY-RILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSE-----------KGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTESM 1834
            L +Y +++ ++  +   + + CR+N  F  +        +   +  L   L      +  + + L  Y K   E +   K         KEV +   D++   +  QK   L Q + SL +G  + ++    F+ +G    L++K  +  R+  LF+D L Y T +    +G  KV   LS++ + +++  ++          LNI + E +F     +    ++W       ++D  +K    FS      + I+     +G  AP W  D     C    C+ +FT   RRHHCRA G + C +C+S K  L++LKN  ++VC+ CY ++ HK   ++   + + +     F  K +K   +  L+E   N+E           KG   P  + +    +K+  L  Y   ED        L+G  +R +      G  +  QF + H++    Y+F+       Q+W++   E+M
Sbjct:  809 LKMYSTYIREFDRNVALLDEQCRKNPPFSSVVRQFETSPRCASL-ALKHYLLKPVQRIPQYQLLLTDYLKNLPEDSSDYKDTQTALSVVKEVANHANDIMKQGDNFQK---LMQVQYSL-NGHHEIVQPGRVFLKEGTLMKLSRKVMQP-RMFFLFNDILLYTTPV---QSGQYKVNSMLSLAGMKVSKPSQEAYQN-----ELNIESVERSFILSANSATERDEWLEAIATAIDDYTRKKISFFSSRSQELEGISDDGLPLGSKAPIWIPDLRTTMC--MICTCEFTLTWRRHHCRACGKVVCQACSSNKFYLEYLKNQLARVCDHCYIKLQHKGDQSNVTFSPSGRGSTFAFSRKQKKIPSA--LKEVSANTENSSMSGYLHRSKGHKKPWKRLW--FVIKNKVLYTYAASEDVAALESQPLLGFFLREE----KTGPAQKLQFKLYHKNT-LYYIFRAEDIPTAQRWIEAFQEAM 1261          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Zebrafish
Match: fgd6 (FYVE, RhoGEF and PH domain containing 6 [Source:ZFIN;Acc:ZDB-GENE-041210-200])

HSP 1 Score: 62.7734 bits (151), Expect = 1.114e-9
Identity = 91/367 (24.80%), Postives = 162/367 (44.14%), Query Frame = 2
Query:  806 LAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCL-YVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKW----KNLLNDTVKK----FSEAEIPPKNIAS---TIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCY-RILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSE-----------KGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTESM 1834
            L Q + SL +G  + ++    F+ +G    L++K  +  R+  LF+D L Y T +    +G  KV   LS++ + +++  ++          LNI + E +F     +    ++W       ++D  +K    FS      + I+     +G  AP W  D     C    C+ +FT   RRHHCRA G + C +C+S K  L++LKN  ++VC+ CY ++ HK   ++   + + +     F  K +K   +  L+E   N+E           KG   P  + +    +K+  L  Y   ED        L+G  +R +      G  +  QF + H++    Y+F+       Q+W++   E+M
Sbjct:  943 LMQVQYSL-NGHHEIVQPGRVFLKEGTLMKLSRKVMQP-RMFFLFNDILLYTTPV---QSGQYKVNSMLSLAGMKVSKPSQEAYQN-----ELNIESVERSFILSANSATERDEWLEAIATAIDDYTRKKISFFSSRSQELEGISDDGLPLGSKAPIWIPDLRTTMC--MICTCEFTLTWRRHHCRACGKVVCQACSSNKFYLEYLKNQLARVCDHCYIKLQHKGDQSNVTFSPSGRGSTFAFSRKQKKIPSA--LKEVSANTENSSMSGYLHRSKGHKKPWKRLW--FVIKNKVLYTYAASEDVAALESQPLLGFFLREE----KTGPAQKLQFKLYHKNT-LYYIFRAEDIPTAQRWIEAFQEAM 1288          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Xenopus
Match: mc3r (melanocortin 3 receptor [Source:Xenbase;Acc:XB-GENE-986713])

HSP 1 Score: 70.8626 bits (172), Expect = 6.446e-12
Identity = 90/402 (22.39%), Postives = 174/402 (43.28%), Query Frame = 2
Query:  494 LDIYKSFLNQYSNSAKWISDMCRENEIFLEI---------CETVRKR----KQIQEI----ITLDSSLYTIFNSLFSF--SMFLHRYNKCFDESNELRKKGKEVEXXXXXXXXXXXXXQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCL-YVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEI---PPKNIAS---------TIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRIL-------------HKDLHNS-----HALNEAKKNLKTVFDLKTRKGTK----SGWLE 1537
            L +Y +++ ++  +   + D C++N  F  +         C  +  +    K +Q I    + L   L  IF S ++   S  L    +  + +N++ K+G   +                  L Q + SL +G  + ++    F+ +G    L++K  +  R+  LF+D L Y T +    +G  K+   LS++ + + +  ++          LNI + E +F     +    + W   ++  ++++++ +I   P K++           T+G TAP W  D     C    C+ +FT   RRHHCRA G + C +C++ K  L++LKN  ++VC+ C+++L             HK   ++     H++   +K  K    LK    T+    SG+L+
Sbjct:  881 LKMYSTYIREFDRNITLLDDQCKKNPGFAAVVRYFEMSPRCANLALKHYLLKPVQRIPQYRLLLTGMLNVIFTSYYTVKPSSALSVVIEVANHANDILKQGDNFQK-----------------LIQIQYSL-NGHHEIVQPGRVFLKEGTLMKLSRKVMQP-RMFYLFNDALLYTTPV---QSGMYKLNNMLSLAGMKVRKPTQEAYQN-----ELNIESVERSFILSASSASERDDWLEAISLAIEEYAKKKITFNPTKSLEEADPGEKEDCTLGSTAPIWIPDGRVTMC--MICTSEFTLTWRRHHCRACGKIICQACSTNKHSLEYLKNHLARVCDRCFQVLQNLSTPKIGSPANHKSPSHALSTVLHSIPSGRKQKKIPAALKVSASTEDSSMSGYLQ 1253          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Xenopus
Match: ZFYVE9 (zinc finger FYVE-type containing 9 [Source:NCBI gene;Acc:100496662])

HSP 1 Score: 62.003 bits (149), Expect = 2.967e-9
Identity = 32/80 (40.00%), Postives = 48/80 (60.00%), Query Frame = 2
Query: 1193 IPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRIL 1432
            +P     +T+GE AP W  DS A  C    C  +FT   RRHHCRA G ++C +C S K KL+++   +++VC +C+ +L
Sbjct:  586 VPISKPFTTLGEVAPVWVPDSHAPNC--MKCEARFTFTKRRHHCRACGKVFCAACCSLKCKLQYMDKKEARVCVICHSVL 663          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Xenopus
Match: ZFYVE9 (zinc finger FYVE-type containing 9 [Source:NCBI gene;Acc:100496662])

HSP 1 Score: 61.6178 bits (148), Expect = 3.900e-9
Identity = 32/80 (40.00%), Postives = 48/80 (60.00%), Query Frame = 2
Query: 1193 IPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRIL 1432
            +P     +T+GE AP W  DS A  C    C  +FT   RRHHCRA G ++C +C S K KL+++   +++VC +C+ +L
Sbjct:  574 VPISKPFTTLGEVAPVWVPDSHAPNC--MKCEARFTFTKRRHHCRACGKVFCAACCSLKCKLQYMDKKEARVCVICHSVL 651          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Xenopus
Match: ZFYVE9 (zinc finger FYVE-type containing 9 [Source:NCBI gene;Acc:100496662])

HSP 1 Score: 61.6178 bits (148), Expect = 4.116e-9
Identity = 32/80 (40.00%), Postives = 48/80 (60.00%), Query Frame = 2
Query: 1193 IPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRIL 1432
            +P     +T+GE AP W  DS A  C    C  +FT   RRHHCRA G ++C +C S K KL+++   +++VC +C+ +L
Sbjct:  586 VPISKPFTTLGEVAPVWVPDSHAPNC--MKCEARFTFTKRRHHCRACGKVFCAACCSLKCKLQYMDKKEARVCVICHSVL 663          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Xenopus
Match: ZFYVE9 (zinc finger FYVE-type containing 9 [Source:NCBI gene;Acc:100496662])

HSP 1 Score: 61.6178 bits (148), Expect = 4.367e-9
Identity = 32/80 (40.00%), Postives = 48/80 (60.00%), Query Frame = 2
Query: 1193 IPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRIL 1432
            +P     +T+GE AP W  DS A  C    C  +FT   RRHHCRA G ++C +C S K KL+++   +++VC +C+ +L
Sbjct:  586 VPISKPFTTLGEVAPVWVPDSHAPNC--MKCEARFTFTKRRHHCRACGKVFCAACCSLKCKLQYMDKKEARVCVICHSVL 663          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Mouse
Match: Fgd6 (FYVE, RhoGEF and PH domain containing 6 [Source:MGI Symbol;Acc:MGI:1261419])

HSP 1 Score: 67.0106 bits (162), Expect = 7.188e-11
Identity = 107/487 (21.97%), Postives = 202/487 (41.48%), Query Frame = 2
Query:  494 LDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFDESNELRKKGKEVEXXXXXXXXXXXXXQKQIFLAQKELSL---ISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCL-YVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEI---PPKNI---------ASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHN---------------------SHALNEAKKNLKTVFDLK-----TRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTE 1828
            L +Y +++ ++  +   + + C++N  F  +        +   +  L   L      +  + + L  Y K   E +   +  ++   ++ ++ N  N   KQ    QK + +   +SG  + ++    F+ +G    L++K  +  R+  LF+D L Y T +    +G  K+   LS++ + + +  ++          L I + E +F     +    + W   ++ +++++++  I   P +++          S +G  AP W  D+ A  C    C+ +FT   RRHHCRA G + C +C+S K  L +LK   ++VCE C++ L K  H                       H++   +K  K    LK     T   T SG+L  R   S+K     P K+   + +K+  L  Y   ED        L+G ++          K+    F + H+     Y+FK + A   Q+W+D   E
Sbjct:  933 LKMYSTYIKEFDKNVALLDEQCKKNPGFAAVVREFEMSPRCANL-ALKHYLLKPVQRIPQYRLLLTDYLKNLLEDSVDHRDTQDALAVVIEVANHANDTMKQGDNFQKLMQIQYSLSGHHEIVQPGRVFLKEGTLMKLSRKVMQP-RMFFLFNDALLYTTPM---QSGMYKLNNMLSLAGMKVRKPTQEAYQNE-----LKIESVERSFILSASSAAERDDWLEAISSSIEEYAKKRITFCPSRSLDEDSERKEEVSPLGAKAPIWIPDTRATMC--MICTSEFTLTWRRHHCRACGKIVCQACSSNKYGLDYLKGQLARVCEHCFQELQKLDHQLSPRVGSPGNHKSPSSALSSVLHSIPSGRKQKKIPAALKEVSANTEDSTMSGYL-YRSKGSKK-----PWKHLWFV-IKNKVLYTYAASEDVAALESQPLLGFTVTLVKDENSESKV----FQLLHKGM-VFYVFKADDAHSTQRWIDAFQE 1395          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Mouse
Match: Fgd4 (FYVE, RhoGEF and PH domain containing 4 [Source:MGI Symbol;Acc:MGI:2183747])

HSP 1 Score: 65.4698 bits (158), Expect = 1.560e-10
Identity = 98/460 (21.30%), Postives = 193/460 (41.96%), Query Frame = 2
Query:  494 LDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRY-NKCFDESNELRKKGKEVEXXXXXXXXXXXXXQKQIFLAQK-ELSLISGRSKDL-KLNSRFIYKGITFCLNKKDEKIF-RILVLFSDCLYVTSLPGNITGA-CKVKEELSMSNLIITRTIEDE-SNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKF------------SEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRR-HHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHP-YLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWV 1813
            L +Y  ++  + N+ + +  M      F  + E ++K+K I   +TL   +      +  + M L  Y  K   +S +     K +E I     +  +  +K   L +  E+  + G  +D+   ++  I +G    L  ++     R L LF++ L       ++ G+   V+  + +  + I  T  +E  + F+      I+ +E T +    +E    +W   L +++  F             E +IP +   + +G+ APRW +D+    C    C + F  + RR HHCRA G + C  C+ +K +L++     +KVC+ CY+I+      S   +  +K  + + ++++ + + +  +   +   EK    P  K +C +  + P  L +Y   +D R    I L+G  +     S       P  F +        + F  ++ E  QKW+
Sbjct:  296 LKMYGEYVKGFDNAVELVKTMTERVPQFKSVTEEIQKQK-ICGSLTLQHHMLEPIQRIPRYEMLLKDYLKKLSPDSPDWNDAKKSLEIISTAASHSNSAIRKMENLKKLLEIYEMLGEEEDIVNPSNELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPRFSLVGSKFTVRTRVGIDGMKIVETHNEEYPHTFQ------ISGKERTLELQASSEQDKEEWIKALQESIDAFHQRHETFRNAIAKENDIPLEVSTAELGKRAPRWIRDNEVTMC--MKCKESFNALTRRRHHCRACGHVVCWKCSDYKAQLEYDGGRLNKVCKDCYQII------SGFTDSEEKKRRGILEIESAEVSGNSEVCSFLQYMEKS--KPWQKIWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYVVDDMPKSADL----PHSFKLTQSKS--VHSFAADNEELKQKWL 732          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Mouse
Match: Fgd4 (FYVE, RhoGEF and PH domain containing 4 [Source:MGI Symbol;Acc:MGI:2183747])

HSP 1 Score: 65.0846 bits (157), Expect = 2.001e-10
Identity = 98/460 (21.30%), Postives = 193/460 (41.96%), Query Frame = 2
Query:  494 LDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRY-NKCFDESNELRKKGKEVEXXXXXXXXXXXXXQKQIFLAQK-ELSLISGRSKDL-KLNSRFIYKGITFCLNKKDEKIF-RILVLFSDCLYVTSLPGNITGA-CKVKEELSMSNLIITRTIEDE-SNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKF------------SEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRR-HHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHP-YLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWV 1813
            L +Y  ++  + N+ + +  M      F  + E ++K+K I   +TL   +      +  + M L  Y  K   +S +     K +E I     +  +  +K   L +  E+  + G  +D+   ++  I +G    L  ++     R L LF++ L       ++ G+   V+  + +  + I  T  +E  + F+      I+ +E T +    +E    +W   L +++  F             E +IP +   + +G+ APRW +D+    C    C + F  + RR HHCRA G + C  C+ +K +L++     +KVC+ CY+I+      S   +  +K  + + ++++ + + +  +   +   EK    P  K +C +  + P  L +Y   +D R    I L+G  +     S       P  F +        + F  ++ E  QKW+
Sbjct:  296 LKMYGEYVKGFDNAVELVKTMTERVPQFKSVTEEIQKQK-ICGSLTLQHHMLEPIQRIPRYEMLLKDYLKKLSPDSPDWNDAKKSLEIISTAASHSNSAIRKMENLKKLLEIYEMLGEEEDIVNPSNELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPRFSLVGSKFTVRTRVGIDGMKIVETHNEEYPHTFQ------ISGKERTLELQASSEQDKEEWIKALQESIDAFHQRHETFRNAIAKENDIPLEVSTAELGKRAPRWIRDNEVTMC--MKCKESFNALTRRRHHCRACGHVVCWKCSDYKAQLEYDGGRLNKVCKDCYQII------SGFTDSEEKKRRGILEIESAEVSGNSEVCSFLQYMEKS--KPWQKIWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYVVDDMPKSADL----PHSFKLTQSKS--VHSFAADNEELKQKWL 732          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Mouse
Match: Fgd4 (FYVE, RhoGEF and PH domain containing 4 [Source:MGI Symbol;Acc:MGI:2183747])

HSP 1 Score: 65.0846 bits (157), Expect = 2.001e-10
Identity = 98/460 (21.30%), Postives = 193/460 (41.96%), Query Frame = 2
Query:  494 LDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRY-NKCFDESNELRKKGKEVEXXXXXXXXXXXXXQKQIFLAQK-ELSLISGRSKDL-KLNSRFIYKGITFCLNKKDEKIF-RILVLFSDCLYVTSLPGNITGA-CKVKEELSMSNLIITRTIEDE-SNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKF------------SEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRR-HHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHP-YLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWV 1813
            L +Y  ++  + N+ + +  M      F  + E ++K+K I   +TL   +      +  + M L  Y  K   +S +     K +E I     +  +  +K   L +  E+  + G  +D+   ++  I +G    L  ++     R L LF++ L       ++ G+   V+  + +  + I  T  +E  + F+      I+ +E T +    +E    +W   L +++  F             E +IP +   + +G+ APRW +D+    C    C + F  + RR HHCRA G + C  C+ +K +L++     +KVC+ CY+I+      S   +  +K  + + ++++ + + +  +   +   EK    P  K +C +  + P  L +Y   +D R    I L+G  +     S       P  F +        + F  ++ E  QKW+
Sbjct:  296 LKMYGEYVKGFDNAVELVKTMTERVPQFKSVTEEIQKQK-ICGSLTLQHHMLEPIQRIPRYEMLLKDYLKKLSPDSPDWNDAKKSLEIISTAASHSNSAIRKMENLKKLLEIYEMLGEEEDIVNPSNELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPRFSLVGSKFTVRTRVGIDGMKIVETHNEEYPHTFQ------ISGKERTLELQASSEQDKEEWIKALQESIDAFHQRHETFRNAIAKENDIPLEVSTAELGKRAPRWIRDNEVTMC--MKCKESFNALTRRRHHCRACGHVVCWKCSDYKAQLEYDGGRLNKVCKDCYQII------SGFTDSEEKKRRGILEIESAEVSGNSEVCSFLQYMEKS--KPWQKIWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYVVDDMPKSADL----PHSFKLTQSKS--VHSFAADNEELKQKWL 732          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Mouse
Match: Fgd2 (FYVE, RhoGEF and PH domain containing 2 [Source:MGI Symbol;Acc:MGI:1347084])

HSP 1 Score: 61.2326 bits (147), Expect = 1.227e-9
Identity = 60/259 (23.17%), Postives = 104/259 (40.15%), Query Frame = 2
Query: 1085 INAQEGTFDFYFENEDSMNKWKNLLN---DTVKKFSE-----AEIP------PKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRR-HHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHP-YLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWV 1813
            ++ ++ T +    + D M  W        D V+K SE      + P      PK     +G  AP+W +D     C    C + F  + RR HHCRA G + C  C+ ++ +LK+  N  ++VC  CY  L  ++      ++ +  L+        +     +L+      +K   + P + +C +    P  L +Y   +D + H  I L+G  + S               + + Q   + Y FK  S E   +WV
Sbjct:   50 VSGKQRTLELQARSRDEMVSWMQACQAAIDQVEKRSETFKAAVQGPQGDTQEPKPQVEELGLRAPQWVRDKMVTMC--MRCQEPFNALTRRRHHCRACGYVVCAKCSDYRAELKYDSNRPNRVCLTCYTFLTGNVLPQGKEDKRRGILEKEASAAPEQSLVCSFLQ---LIGDKCSRSLP-RSWCVIPRDDPLVLYVYAAPQDTKAHTSIPLLGYQVISGPQG--------DPRVFQLQQSGQQYTFKAESVELQGRWV 294          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. UniProt/SwissProt
Match: sp|Q6ZV73|FGD6_HUMAN (FYVE, RhoGEF and PH domain-containing protein 6 OS=Homo sapiens OX=9606 GN=FGD6 PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 1.136e-11
Identity = 90/373 (24.13%), Postives = 156/373 (41.82%), Query Frame = 2
Query:  830 ISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCL-YVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFS-------------EAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNS---------------------HALNEAKKNLKTVFDLK-----TRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTE 1828
            ++G  + ++    F+ +GI   L++K  +  R+  LF+D L Y T +    +G  K+   LS++ + + +  ++          L I + E +F     +    ++W   ++  +++++             EA+   K   S +G  AP W  D+ A  C    C+ +FT   RRHHCRA G + C +C+S K  L +LKN  ++VCE C++ L K  H                       H++   +K  K    LK     T   + SG+L     N +      P K+F    +K+  L  Y   ED        L+G ++          K+    F + H++    Y+FK   A   QKW++   E
Sbjct: 1077 LNGHHEIVQPGRVFLKEGILMKLSRKVMQP-RMFFLFNDALLYTTPV---QSGMYKLNNMLSLAGMKVRKPTQEAYQN-----ELKIESVERSFILSASSATERDEWLEAISRAIEEYAKKRITFCPSRSLDEADSENKEEVSPLGSKAPIWIPDTRATMC--MICTSEFTLTWRRHHCRACGKIVCQACSSNKYGLDYLKNQPARVCEHCFQELQKLDHQHSPRIGSPGNHKSPSSALSSVLHSIPSGRKQKKIPAALKEVSANTEDSSMSGYLYRSKGNKK------PWKHFW-FVIKNKVLYTYAASEDVAALESQPLLGFTVIQVKDENSESKV----FQLLHKNM-LFYVFKAEDAHSAQKWIEAFQE 1426          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. UniProt/SwissProt
Match: sp|Q7ZUV1|PKHF2_DANRE (Pleckstrin homology domain-containing family F member 2 OS=Danio rerio OX=7955 GN=plekhf2 PE=2 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 3.582e-10
Identity = 45/133 (33.83%), Postives = 59/133 (44.36%), Query Frame = 2
Query: 1037 TIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQ-KFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRIL 1432
            T+EDE    +  W   I     +F  Y       ++W + +N  V    E     K+  S  GE A  W  DS A  C    C + KFTPV RRHHCR  G + C  C+  K  L    +   +VCE CY+ L
Sbjct:   89 TVEDEGE-LRNGW--LIKTPTKSFAVYAATATEKSEWMSHINKCVSDLLE-----KSGKSPTGEHAAVWVPDSEATVC--MRCQKMKFTPVNRRHHCRKCGFVVCGPCSEKKFLLPSQSSKPVRVCEFCYKQL 211          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. UniProt/SwissProt
Match: sp|Q69ZL1|FGD6_MOUSE (FYVE, RhoGEF and PH domain-containing protein 6 OS=Mus musculus OX=10090 GN=Fgd6 PE=1 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 5.028e-10
Identity = 107/487 (21.97%), Postives = 202/487 (41.48%), Query Frame = 2
Query:  494 LDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFDESNELRKKGKEVEXXXXXXXXXXXXXQKQIFLAQKELSL---ISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCL-YVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEI---PPKNI---------ASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHN---------------------SHALNEAKKNLKTVFDLK-----TRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTE 1828
            L +Y +++ ++  +   + + C++N  F  +        +   +  L   L      +  + + L  Y K   E +   +  ++   ++ ++ N  N   KQ    QK + +   +SG  + ++    F+ +G    L++K  +  R+  LF+D L Y T +    +G  K+   LS++ + + +  ++          L I + E +F     +    + W   ++ +++++++  I   P +++          S +G  AP W  D+ A  C    C+ +FT   RRHHCRA G + C +C+S K  L +LK   ++VCE C++ L K  H                       H++   +K  K    LK     T   T SG+L  R   S+K     P K+   + +K+  L  Y   ED        L+G ++          K+    F + H+     Y+FK + A   Q+W+D   E
Sbjct:  933 LKMYSTYIKEFDKNVALLDEQCKKNPGFAAVVREFEMSPRCANL-ALKHYLLKPVQRIPQYRLLLTDYLKNLLEDSVDHRDTQDALAVVIEVANHANDTMKQGDNFQKLMQIQYSLSGHHEIVQPGRVFLKEGTLMKLSRKVMQP-RMFFLFNDALLYTTPM---QSGMYKLNNMLSLAGMKVRKPTQEAYQNE-----LKIESVERSFILSASSAAERDDWLEAISSSIEEYAKKRITFCPSRSLDEDSERKEEVSPLGAKAPIWIPDTRATMC--MICTSEFTLTWRRHHCRACGKIVCQACSSNKYGLDYLKGQLARVCEHCFQELQKLDHQLSPRVGSPGNHKSPSSALSSVLHSIPSGRKQKKIPAALKEVSANTEDSTMSGYL-YRSKGSKK-----PWKHLWFV-IKNKVLYTYAASEDVAALESQPLLGFTVTLVKDENSESKV----FQLLHKGM-VFYVFKADDAHSTQRWIDAFQE 1395          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. UniProt/SwissProt
Match: sp|O88387|FGD4_RAT (FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Fgd4 PE=1 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.935e-10
Identity = 99/460 (21.52%), Postives = 196/460 (42.61%), Query Frame = 2
Query:  494 LDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRY-NKCFDESNELRKKGKEVEXXXXXXXXXXXXXQKQIFLAQK-ELSLISGRSKDL-KLNSRFIYKGITFCLNKKDEKIF-RILVLFSDCLYVTSLPGNITGAC-KVKEELSMSNLIITRTIEDE-SNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKF------------SEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRR-HHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHP-YLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWV 1813
            L +Y  ++  + N+ + + +M      F  + E ++K+K I   +TL   +      +  + M L  Y  K   ++ +     K +E I     +  +  +K   L +  E+  + G  +D+   ++  I +G    L  ++     R L LF++ L       ++ G+   V+  + +  + I  T  +E  + F+      ++ +E T +    +E    +W   L +++  F             E +IP +   + +G+ APRW +D+    C    C + F  + RR HHCRA G + C  C+ +K +L++     +KVC+ CY+I+     +  A +E KK  + + ++++ + + +  +   +   EK    P  K +C +  + P  L +Y   +D R    I L+G  +     S       P  F +        + F  +S E  QKW+
Sbjct:  296 LKMYGEYVKGFDNAVELVKNMTERVPQFKSVTEEIQKQK-ICGSLTLQHHMLEPIQRIPRYEMLLKDYLKKLSPDAPDWNDAKKSLEIISTAASHSNSAIRKMENLKKLLEIYEMLGEEEDIVNPSNELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPRFSLVGSKFTVRTRVGIDGMKIVETHNEEYPHTFQ------VSGKERTLELQASSEQDKEEWIKALQESIDAFHQRHETFRNAIAKENDIPLEVSTAELGKRAPRWIRDNEVTMC--MKCKESFNALTRRRHHCRACGHVVCWKCSDYKAQLEYDGGRLNKVCKDCYQIM-----SGFAESEEKKR-RGILEIESAEVSGNSEVCSFLQYMEKS--KPWQKIWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYIVDDMPKSADL----PHSFKLTQSKS--VHSFAADSEELKQKWL 732          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. UniProt/SwissProt
Match: sp|Q91ZT5|FGD4_MOUSE (FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus OX=10090 GN=Fgd4 PE=1 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.400e-9
Identity = 98/460 (21.30%), Postives = 193/460 (41.96%), Query Frame = 2
Query:  494 LDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRY-NKCFDESNELRKKGKEVEXXXXXXXXXXXXXQKQIFLAQK-ELSLISGRSKDL-KLNSRFIYKGITFCLNKKDEKIF-RILVLFSDCLYVTSLPGNITGA-CKVKEELSMSNLIITRTIEDE-SNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKF------------SEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRR-HHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHP-YLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWV 1813
            L +Y  ++  + N+ + +  M      F  + E ++K+K I   +TL   +      +  + M L  Y  K   +S +     K +E I     +  +  +K   L +  E+  + G  +D+   ++  I +G    L  ++     R L LF++ L       ++ G+   V+  + +  + I  T  +E  + F+      I+ +E T +    +E    +W   L +++  F             E +IP +   + +G+ APRW +D+    C    C + F  + RR HHCRA G + C  C+ +K +L++     +KVC+ CY+I+      S   +  +K  + + ++++ + + +  +   +   EK    P  K +C +  + P  L +Y   +D R    I L+G  +     S       P  F +        + F  ++ E  QKW+
Sbjct:  296 LKMYGEYVKGFDNAVELVKTMTERVPQFKSVTEEIQKQK-ICGSLTLQHHMLEPIQRIPRYEMLLKDYLKKLSPDSPDWNDAKKSLEIISTAASHSNSAIRKMENLKKLLEIYEMLGEEEDIVNPSNELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPRFSLVGSKFTVRTRVGIDGMKIVETHNEEYPHTFQ------ISGKERTLELQASSEQDKEEWIKALQESIDAFHQRHETFRNAIAKENDIPLEVSTAELGKRAPRWIRDNEVTMC--MKCKESFNALTRRRHHCRACGHVVCWKCSDYKAQLEYDGGRLNKVCKDCYQII------SGFTDSEEKKRRGILEIESAEVSGNSEVCSFLQYMEKS--KPWQKIWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYVVDDMPKSADL----PHSFKLTQSKS--VHSFAADNEELKQKWL 732          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. TrEMBL
Match: A0A504YG18 (FYVE RhoGEF and PH domain-containing protein 2 (Fragment) OS=Fasciola gigantica OX=46835 GN=FGIG_09716 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 6.047e-20
Identity = 106/441 (24.04%), Postives = 194/441 (43.99%), Query Frame = 2
Query:  182 YKDYSDSNSETETGISLTVEYISNECLDFIHSVLRALSFLNDFYRELSKENLDVETSHRFSQVFRDIEPLEKLYRFIVDKISDAKV-LGTFYLPCIFLDDDVRGSLDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQE--IITLDSSLYTIFNSLFSFSMFLHRYNKCF---DESNELRKKGKEVEXXXXXXXXXXXXXQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKD---EKIFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTV---KKFSEAEIP---PKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHA 1459
            Y +  D  SE        ++YI  E + F    L  L  L     E++      + S+   ++FRDI  L +L++ I  K+ + +  +    LP  F+DD     L+IYKSF+ +Y+N+   +      ++ F  +C  + +  + +E  I  +    + +  SL  F +   +  +     D++ E  KK  +V + +  +     + Q +I  AQ   + I GR  + +     + +G    + ++      + R L LF+  L +T +  N  G  +VK EL +S + ++   ED+           I A E   +  F +E    +W + +   +   +   ++ IP      I  T   +A  W KD  +  C    C  +FT + RRHHCRA G ++C SC++++  + +L     +VC + Y ++H DL    A
Sbjct:  110 YIESEDQKSEVVEKNKKKIKYIFEEMVHFERRFLETLRLLKLISDEVNSRFSSRDASN-LREIFRDIPSLYQLHQIICQKLDELQPDISGNLLPSAFVDDKEVPFLNIYKSFMCRYANNYPALVSHWNGDKEFAALCRNILQTSKYEEQRIQDVCGMYFGVHCSLTRFRLLFTKLKEALSPGDKNMENVKKALKVLNDLLQISEGEVLRQDKISDAQVAFAKIDGREMNFRHIPPLLREGPCKKIPRRSSHKRNLDRHLFLFAGYLVITEV-ANPIGRYQVKSELLLSGMNLSEVSEDDE--ISTPHCFRIKATELCVELAFASEKEKTEWWDDIQSAISEERDRKDSIIPISSTDKIEGTTATSAAEWVKDEQSTMCA--ECYAQFTVLNRRHHCRACGKVFCGSCSAYRAPIAYLGGKVKRVCVIDYYLIHGDLKPPTA 544          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. TrEMBL
Match: A0A4S2KKS6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010870 PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.501e-18
Identity = 98/420 (23.33%), Postives = 190/420 (45.24%), Query Frame = 2
Query:  236 VEYISNECLDFIHSVLRALSFLNDFYRELSKENLDVETSHRFSQVFRDIEPLEKLYRFIVDKISDAKVLGTF-YLPCIFLDDDVRGSLDIYKSFLNQYSNSAKWISDMCRENEIFLEICE--TVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFDESN-ELR--KKGKEVEXXXXXXXXXXXXXQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEK---IFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKK--------FSEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDL 1444
            + +I  E L F   +L +L  L +    +  +N   + S    ++F+DI  L +L++ +   +   +   +   LP +F+       L+IYKSF+ +Y+ +   ++++  +++ F  +C    +  + + Q I  +      + +S+  F + + +  +   E +  +R  +K  +V D +        + Q QI  A    S I GR  + +     + +G    + ++  +   + R L LFSD L +T +P N  G  +VK E+ ++ + +    ED+  G    +   I A+E   +  F NE    +W N L   + +         S      +N+    G +A  W KD  +  C    CS +FT   RRHHCRA G ++C +C+ ++  + F  N + +VC + Y +++  L
Sbjct:   85 LRFILEEMLHFERRLLESLRILTEINSTICDKN-SGKDSTVLREIFKDIPSLYQLHQHLSSGLDSLRATSSPDILPSVFISSKEIPYLNIYKSFMCRYATNYPKLTNLVLKDKEFRNMCTRCIISSKYEEQRIQDVCGMYLGVHSSVTRFKLLISKIEEALAEDDVRIRDVRKALKVLDELLANSEGEIVRQDQILDAHAAFSKIDGRQTEFRHIPPLLKEGPCKKIPRRSSQKRILDRHLFLFSDYLVIT-MPVNHLGRYQVKSEVMLNGMKLLEIAEDDDIGIP--FCFRIKAKELCVELAFGNEAEKTEWWNQLQAAINQELRQLNSVPSSINATDQNLEPVSGSSAIEWVKDEQSTMC--AECSAEFTVFNRRHHCRACGKVFCGTCSDYRAPIAFQGNKE-RVCVIDYYLINSHL 497          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. TrEMBL
Match: A0A4S2KK81 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010870 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.761e-18
Identity = 98/420 (23.33%), Postives = 190/420 (45.24%), Query Frame = 2
Query:  236 VEYISNECLDFIHSVLRALSFLNDFYRELSKENLDVETSHRFSQVFRDIEPLEKLYRFIVDKISDAKVLGTF-YLPCIFLDDDVRGSLDIYKSFLNQYSNSAKWISDMCRENEIFLEICE--TVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFDESN-ELR--KKGKEVEXXXXXXXXXXXXXQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEK---IFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKK--------FSEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDL 1444
            + +I  E L F   +L +L  L +    +  +N   + S    ++F+DI  L +L++ +   +   +   +   LP +F+       L+IYKSF+ +Y+ +   ++++  +++ F  +C    +  + + Q I  +      + +S+  F + + +  +   E +  +R  +K  +V D +        + Q QI  A    S I GR  + +     + +G    + ++  +   + R L LFSD L +T +P N  G  +VK E+ ++ + +    ED+  G    +   I A+E   +  F NE    +W N L   + +         S      +N+    G +A  W KD  +  C    CS +FT   RRHHCRA G ++C +C+ ++  + F  N + +VC + Y +++  L
Sbjct:   85 LRFILEEMLHFERRLLESLRILTEINSTICDKN-SGKDSTVLREIFKDIPSLYQLHQHLSSGLDSLRATSSPDILPSVFISSKEIPYLNIYKSFMCRYATNYPKLTNLVLKDKEFRNMCTRCIISSKYEEQRIQDVCGMYLGVHSSVTRFKLLISKIEEALAEDDVRIRDVRKALKVLDELLANSEGEIVRQDQILDAHAAFSKIDGRQTEFRHIPPLLKEGPCKKIPRRSSQKRILDRHLFLFSDYLVIT-MPVNHLGRYQVKSEVMLNGMKLLEIAEDDDIGIP--FCFRIKAKELCVELAFGNEAEKTEWWNQLQAAINQELRQLNSVPSSINATDQNLEPVSGSSAIEWVKDEQSTMC--AECSAEFTVFNRRHHCRACGKVFCGTCSDYRAPIAFQGNKE-RVCVIDYYLINSHL 497          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. TrEMBL
Match: A0A5K4E8Y7 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.236e-18
Identity = 104/389 (26.74%), Postives = 170/389 (43.70%), Query Frame = 2
Query:  368 VFRDIEPLEKLYRFIVDKISDAKVLGTFYLPCIFLDDDVRGSLDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQE--IITLDSSLYTIFNSLFSFSMFLHRYNKCFDESNE---------------LRKKGKEV---EXXXXXXXXXXXXXQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDES-NGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPPKN---------IASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDL 1444
            +F+DI  L KL+  + +   D++      LP  F  D     L+IYKSFL +Y+ + K  S+M   NE    IC+ +  + Q QE  I  +    Y +  +L  +   ++R       S+                L +  +E+   E +         ++  ++   Q  L  + G +K  KL  R I++ +          + R L LFS+ L +T  P N  G  +VK E+ ++ + +    +DE  N   C     I A+E   +  F N+D    W   L   +    E   P  N          A+ +GE A +W KD ++  C   NC  +FT + RRHHCRA G L+C SC+++K  L+       +VC + Y +L+K+ 
Sbjct:  140 MFKDIPSLFKLHEHLTESF-DSREAEDVELPSAFTSDKEMQILNIYKSFLCRYAVNFKAFSEMYSTNEELQNICKGIVAKSQYQEQRIQNVPGMFYGVSTALTRYKDLIYRLKGTMLPSDPEYTNVTKAWNFIKDLLDRSEQEIILQEKMSNAREALGKLDGLRVKYTQIPLLHLEGPAK--KLPRRSIHRRL----------LDRYLFLFSEYLVMTESP-NAVGRYQVKSEIGLAGMTLCEVKDDEEINVEHC---FRIKAKELCVEVAFSNDDEKQLWWRELQQAID--CECNRPNSNGFNEKKSIMSANNLGEVAAQWVKDESSTMCT--NCCTEFTTLNRRHHCRACGKLFCGSCSAYKAPLESCGGKYQRVCVVDYYLLNKNF 507          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. TrEMBL
Match: A0A5K4E8F1 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 2.599e-18
Identity = 104/389 (26.74%), Postives = 170/389 (43.70%), Query Frame = 2
Query:  368 VFRDIEPLEKLYRFIVDKISDAKVLGTFYLPCIFLDDDVRGSLDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQE--IITLDSSLYTIFNSLFSFSMFLHRYNKCFDESNE---------------LRKKGKEV---EXXXXXXXXXXXXXQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDES-NGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPPKN---------IASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDL 1444
            +F+DI  L KL+  + +   D++      LP  F  D     L+IYKSFL +Y+ + K  S+M   NE    IC+ +  + Q QE  I  +    Y +  +L  +   ++R       S+                L +  +E+   E +         ++  ++   Q  L  + G +K  KL  R I++ +          + R L LFS+ L +T  P N  G  +VK E+ ++ + +    +DE  N   C     I A+E   +  F N+D    W   L   +    E   P  N          A+ +GE A +W KD ++  C   NC  +FT + RRHHCRA G L+C SC+++K  L+       +VC + Y +L+K+ 
Sbjct:  140 MFKDIPSLFKLHEHLTESF-DSREAEDVELPSAFTSDKEMQILNIYKSFLCRYAVNFKAFSEMYSTNEELQNICKGIVAKSQYQEQRIQNVPGMFYGVSTALTRYKDLIYRLKGTMLPSDPEYTNVTKAWNFIKDLLDRSEQEIILQEKMSNAREALGKLDGLRVKYTQIPLLHLEGPAK--KLPRRSIHRRL----------LDRYLFLFSEYLVMTESP-NAVGRYQVKSEIGLAGMTLCEVKDDEEINVEHC---FRIKAKELCVEVAFSNDDEKQLWWRELQQAID--CECNRPNSNGFNEKKSIMSANNLGEVAAQWVKDESSTMCT--NCCTEFTTLNRRHHCRACGKLFCGSCSAYKAPLESCGGKYQRVCVVDYYLLNKNF 507          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Cavefish
Match: ENSAMXT00000014177.2 (FYVE, RhoGEF and PH domain-containing protein 6-like [Source:NCBI gene;Acc:103024376])

HSP 1 Score: 82.8037 bits (203), Expect = 6.479e-16
Identity = 118/478 (24.69%), Postives = 211/478 (44.14%), Query Frame = 2
Query:  494 LDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTI--FNSLFSFSMFLHRYNKCFDE-------SNELRKKGKEVEXXXXXXXXXXXXXQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCL-YVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKW----KNLLNDTVKK---FSEAEIPPKN----IASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTK-SGWLEERIYNSEKGIFN-------PPVKYFCEL--DLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTESM 1834
            L +Y S++ ++  +   + + CR+N  F ++   VR+ +       L    Y +     L  + + L  Y K  +E       + +  K  K+V +   + +   +  QK   L Q + SL+ G  + +K     + +G    L++K  +  R+  LF+D L Y T L    TG  K+  ELS++ + +++  ++   G +    LNI + E +F     +  + ++W       +ND  KK   F  +  P +     + + +G  AP W  D  A  C    C+ +FT   RRHHCRA G + C +C++ K  L++LK    +VC+ C+  L    HNS   +    N KT+     R+  K +  L+E   N+++   +       P  K +  L   +K+  L  Y   ED      + L+G S++              QF + H+DK   Y+FK + +    +W++   E+M
Sbjct:  711 LKMYSSYICEFDKNVALLEEQCRKNPAFAKV---VREFESSPCCANLAVKHYMLKPVQRLPQYQLLLSDYVKNLNENSPHYKDTQDALKLVKDVANHANETMRKGDNFQK---LIQVQYSLM-GHHEIVKPGRTLLKEGTLMKLSRKVMQP-RMFFLFNDTLLYTTPL---QTGQYKLNNELSLAGMKVSKPSQE---GHQNE--LNIESVERSFILSASSPTARDEWLEAISAAINDYTKKMISFGSSRSPEEGGKDTVDAQLGSKAPIWIPDLRATMC--MICTCEFTLTWRRHHCRACGKVVCQACSTNKYPLEYLKYHPERVCDQCFETLQ---HNSSGSSILSPNAKTLGGFHFRRQRKIAAALKEVSANTDESSMSGYLERNKPKKKQWKRLWFVIKNKVLYTYAASEDVAALESLPLLGFSLKEDQSESS------QQFKLYHKDK-LIYIFKTDDSNIHHRWIEAFREAM 1160          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Cavefish
Match: fgd6 (FYVE, RhoGEF and PH domain containing 6 [Source:NCBI gene;Acc:103037109])

HSP 1 Score: 68.1662 bits (165), Expect = 2.392e-11
Identity = 107/487 (21.97%), Postives = 202/487 (41.48%), Query Frame = 2
Query:  494 LDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFDESNELRKKG-------KEVEXXXXXXXXXXXXXQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCL-YVTSLPGNITGACKVKEELSMSNLIITR-TIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEI-----------------PPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHA---LNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSE-----------KGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTESM 1834
            L +Y +++ ++  +   + + CR+N  F  +        +   +  L   L      +  + + L  Y K   E +   K         KEV +   D++   +  QK   L Q + SL +G  + ++    F+ +G    L++K  +  R+  LF+D L Y T +    +G  KV   LS++ + +++ ++E   N       LNI + E +F     +    ++W   +   ++ ++  +I                 PP      +G  AP W  D     C    C+ +FT   RRHHCRA G + C +C+S K  L++LKN  ++VC+ CY  L +      +   ++ + ++  + F    ++      L+E   N+E           KG   P  + +    +K+  L  Y   ED        L+G  +R +      G  +  QF + H++    Y+F+ +     Q+W++   E+M
Sbjct:  828 LKMYSTYIREFDRNVALLDEQCRKNPAFATVVRQFETSPRCASL-ALKHYLLKPVQRIPQYQLLLTDYLKNLPEDSSDYKDTQTALGVVKEVANHANDIMKQGDNFQK---LMQVQYSL-NGHHEIVQPGRVFLKEGTLMKLSRKVMQP-RMFFLFNDILLYTTPV---QSGQYKVNSMLSLAGMKVSKPSLEAYQNE------LNIESVERSFILSASSATERDEWLEAIATAIEDYTRKKISFISSRSQESEGLSVDGPP------LGSKAPIWIPDLRTTMC--MICTCEFTLTWRRHHCRACGKVVCQACSSNKYYLEYLKNQLARVCDQCYAKLQQKDKGDQSEVCVSPSGRSSGSAFSFSRKQKKIPSALKEVSANTENSSMSGYLHRSKGNKKPWKRLW--FVIKNKVLYTYAASEDVAALESQPLLGFFLREE----KSGPAQKLQFKLYHKNT-LYYIFRADDIPTAQRWIEAFQEAM 1284          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Cavefish
Match: plekhf2 (pleckstrin homology and FYVE domain containing 2 [Source:NCBI gene;Acc:103028556])

HSP 1 Score: 64.3142 bits (155), Expect = 5.241e-11
Identity = 63/217 (29.03%), Postives = 91/217 (41.94%), Query Frame = 2
Query:  815 KELSLISG----RSKDLKLNSR-FIYKGITFCLNKKDEKIFRILVLFSDCLYVTSLPGNITGACKV--KEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQ-KFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKD 1441
            K ++++ G      + L +  R  I +G+   L +K  K  R   LF+D L      GNI    K   K+ +     +   T+ DE +  +  W   I     +F  Y       ++W N ++  V    E     K+  S  GE A  W  DS A  C    C + KFTPV RRHHCR  G + C  C+  K  L    +   +VCE CY  L  +
Sbjct:   13 KRIAVVEGCFGTAGQPLAIPGRVLIGEGVLTKLCRKKPKA-RQFFLFNDILVY----GNIVIQKKKYNKQHIIPLESVTIDTVADEGD-LRNGW--LIKTPTKSFAVYAATATEKSEWMNHISKCVSDLLE-----KSGKSPTGEHAAVWVPDSEASVC--MRCQKVKFTPVSRRHHCRKCGFVVCGPCSEKKFLLPSQSSKPVRVCEFCYEQLSTE 214          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Cavefish
Match: fgd5b (FYVE, RhoGEF and PH domain containing 5b [Source:ZFIN;Acc:ZDB-GENE-130925-3])

HSP 1 Score: 58.5362 bits (140), Expect = 1.182e-8
Identity = 88/358 (24.58%), Postives = 148/358 (41.34%), Query Frame = 2
Query:  830 ISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPP-------KNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDL-----HNSHALNEAKKNLKTVFDLKTRKGT------------KSGWLEERIYNSEKGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTES 1831
            + G    L+ N  F+ +G    +++K ++  R L L SD +  T    +  G  ++   L+++ + +T+ + D +        L I  ++        + +  + W   LN T+         P       + + + +GE AP     S    C   NC  +F+   RRHHCRA G + C  C   K+ LK+LKN  +KVC+ CY  L+K +      +S  L+   +N+      + RKG              SG L ER  NS +   +    +F    LK   L  Y + E++     + L+G S+R +         + S F + H+     Y FK       Q WV  + E+
Sbjct:   52 VLGLKNLLQPNRVFVKEGTLMKVSRKSKQP-RHLFLMSDIMLYTYPQQD--GKYRLINTLTLTGMEVTKLMIDNTQH-----ALKIELKDTCITLSTSSIER-DDWFVTLNRTIADLGSVLGEPTGCLEFGETVEACLGENAPPLVSVSQVSVC--MNCPVRFSLTHRRHHCRACGKVVCRDCCRNKVPLKYLKNRRAKVCDKCYSELYKPVAMGTGSSSRPLSAVFQNIHPTSLWRGRKGQLTFNQGIGPEGEMSGTL-ERSRNSRRSWKS---LWFL---LKDKVLYTYPQPEERIACESLPLLGFSVRPEIEG------ESSVFQLYHKT-TLYYTFKAQDTHTAQ-WVSAMEEA 383          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Cavefish
Match: fgd4b (FYVE, RhoGEF and PH domain containing 4b [Source:ZFIN;Acc:ZDB-GENE-110421-6])

HSP 1 Score: 57.7658 bits (138), Expect = 3.071e-8
Identity = 83/403 (20.60%), Postives = 168/403 (41.69%), Query Frame = 2
Query:  494 LDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFDESNELRKKG-KEVEXXXXXXXXXXXXXQKQIFLAQK-ELSLISGRSKDL-KLNSRFIYKGITFCLNKKDEKIF-RILVLFSDCLYVTSLPGNITGA-CKVKEELSMSNLIITRTIEDE-SNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRR-HHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHP-YLNLYEKYEDKRNHHGIILIG 1678
            L +Y  ++  +  + + +      +  F  + + + +R++I   +TL   +      +  + + L  Y K   +    R +  K ++ I     +     QK   L +  E+  + G  +D+   ++  I +G    L+ ++     R L LF++ L V     ++ G    V+  + +  + +  T+ D+  + F+      ++ +E T +    +E    +W       +K F    +  +N    +G  APRW +D+    C    C + F  + RR HHCRA G + C  C+  K  L++  N  +KVC+ CY IL     +       K+    + +++  + + S  +   +  SEK    P  + +C +  K    L +Y   +D +    I L+G
Sbjct:  161 LRMYAEYVKNFDKAMELLKQWTERSAQFSAVIQEI-QRQEICGSLTLQHHMLEPVQRVPRYELLLKDYLKRLPQEAPDRSQAEKSLQTISMAATHSNTAIQKMENLKKLLEIYEMLGAEEDIVNASNELIKEGQILKLSSRNTSAMERYLYLFNNMLLVCVPKFSLLGQKFTVRTRVGIEGIKVVATVNDDYPHTFQ------VSGKERTLELQASSEQDKEEW-------IKVFIILPLCVQN--EELGRRAPRWIRDNEVTMC--MKCKEPFNALTRRRHHCRACGYVVCWKCSENKAALEYDGNKMNKVCKDCYSILTGRAASEETTGAKKRG---ILEIEAAQFSGSSLMCGFLLYSEKA--RPWQRVWCVIPQKEAVVLYVYGAPQDVKAQSTIPLLG 540          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005437.1 (pep scaffold:Pmarinus_7.0:GL486528:10206:16522:1 gene:ENSPMAG00000004933.1 transcript:ENSPMAT00000005437.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 5.713e-12
Identity = 40/133 (30.08%), Postives = 56/133 (42.11%), Query Frame = 2
Query: 1103 TFDFYFENEDSMNKWKNLLNDTVKKFSEAE-------------IPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRR-HHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHA 1459
            T DF    E+    W   +N+ +K F E E              PP      +G+ AP W +D     C    C   FT + RR HHCRA G + C  C+  ++ L +      +VCE CY  L ++   S A
Sbjct:  169 TIDFQARTEEEKQDWMKAINEVIKTFREKEETFMGHTANVSDVSPPATQGMELGQRAPMWVRDVNVTLC--MTCQDPFTTLTRRRHHCRACGKVVCWKCSDHRVLLAYEPRKLQRVCEACYAQLTEEARTSTA 299          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Sea Lamprey
Match: fgd1 (FYVE, RhoGEF and PH domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-081104-33])

HSP 1 Score: 54.299 bits (129), Expect = 6.842e-8
Identity = 54/222 (24.32%), Postives = 93/222 (41.89%), Query Frame = 2
Query: 1193 IPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRR-HHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIY-----NSEKGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIR----SKCH-SRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLT 1825
            IPP + A+ +G  AP   ++ +   C   +CS+ F  + RR HHCRA G + C  C+ +K +L++     ++VC  CY +L       H   E   +++        +   S      I       SE+G+      +F     +   L +YE  +D +    I L G +I     S  H +R+  K+  S+         +   F  +  E  ++W+ YL 
Sbjct:  573 IPPPHPATELGRRAPHLVRERSVSEC--MSCSEPFNALTRRKHHCRACGHVVCGKCSEYKAQLEYEGGKLARVCHDCYGVLRPQQQQQHETEELPDDVRRARVAAVAERRASADPAGSILCGFLSLSERGVKASHRAWFTVPRSEPLVLYMYETAKDAKPMRTIPLPGYAISPLEASDPHEARHAFKMTQSR---------QTLYFGTDGEESQRRWMGYLA 783          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Sea Lamprey
Match: zfyve9a (zinc finger, FYVE domain containing 9a [Source:ZFIN;Acc:ZDB-GENE-070705-182])

HSP 1 Score: 53.5286 bits (127), Expect = 1.292e-7
Identity = 27/67 (40.30%), Postives = 41/67 (61.19%), Query Frame = 2
Query: 1223 GETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCY 1423
            G +AP W  D+ A  C    C  +FT   RRHHCRA G ++C  C S K +L++++N +++VC  C+
Sbjct:    4 GTSAPMWVPDAEAPNC--MRCKARFTFTRRRHHCRACGKVFCAPCCSQKSRLRYMENKEARVCIRCH 68          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Yeast
Match: PIB1 (RING-type ubiquitin ligase of the endosomal and vacuolar membranes; binds phosphatidylinositol(3)-phosphate; contains a FYVE finger domain [Source:SGD;Acc:S000002721])

HSP 1 Score: 46.595 bits (109), Expect = 5.904e-6
Identity = 20/41 (48.78%), Postives = 25/41 (60.98%), Query Frame = 2
Query: 1238 RWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCT 1360
            RWQ D  A  C  + C   F+ +VRRHHCR  G ++C SCT
Sbjct:   13 RWQADEEAHSC--FQCKTNFSFLVRRHHCRCCGRIFCSSCT 51          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Nematostella
Match: EDO48232 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKE8])

HSP 1 Score: 68.1662 bits (165), Expect = 5.217e-12
Identity = 73/328 (22.26%), Postives = 137/328 (41.77%), Query Frame = 2
Query:  494 LDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFD-ESNELRKKGKEVEXXXXXXXXXXXXXQK-----QIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAE---------IPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRIL 1432
            L +Y +++N Y  +A  + +  +EN  F E+    +  K+ + ++ L+S +      + S+ + L  Y K    ES E +     ++ +     +     ++     Q+   Q  L    G  + ++    FI +G    L +KD +     +L    LY   + GN     K++E L +  +   + I  ES  F   +  +I +   +F          ++W   L   +   ++ +         I   +  + +GE AP W  D+    C    C+  FT   RRHHCR  G + C SC+     L +L  + ++VC++CY +L
Sbjct:   89 LKMYTTYINNYDKAANVLQETMKENPQFAELVLEFQASKKCKGLM-LNSFMLKPVQRIPSYRLLLIDYLKHLPPESAEYQDIKVALDIVSEVATHINESMKRVDNFEQVLRIQGSLV---GHEEIVRPGREFIKQGNLLKLCRKDMQERTFFLLTDVLLYTAPVGGN---QYKLRETLPLLGM---KVILPESQEFVNEF--SIISTTRSFTLSASTSAERDEWLEELERAINAMTKKKISFFKSKEGITQDSEDTKLGEKAPVWIPDARVTMC--MLCTDDFTVTNRRHHCRGCGKVVCGSCSDNLAPLTYLDYAQARVCDMCYEVL 402          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Nematostella
Match: EDO38501 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCW3])

HSP 1 Score: 52.7582 bits (125), Expect = 1.268e-7
Identity = 39/133 (29.32%), Postives = 59/133 (44.36%), Query Frame = 2
Query: 1037 TIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQ-KFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRIL 1432
            T+ED+ N  K  W   I + + +F  Y        +W   +N  ++     ++  K      G  A  W  DS A  C   +C + KFT + RRHHCR  G + C +C++ K  L    +   +VC  CY  L
Sbjct:   91 TLEDDGN-LKNGW--QIISTKKSFAVYAATATEKAEWMAHINKCIQ-----DLLAKTGKKAGGVHAAVWVPDSEASTC--MSCMKTKFTAINRRHHCRKCGAVVCGACSTKKFLLPAQSSKPLRVCNSCYNTL 213          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Nematostella
Match: EDO48184 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK38])

HSP 1 Score: 50.447 bits (119), Expect = 1.584e-7
Identity = 27/71 (38.03%), Postives = 37/71 (52.11%), Query Frame = 2
Query: 1220 IGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRIL 1432
            +G  AP W +D +   C    C   FT   RRHHCRA G +YC++C+  K  L++      +VC  C  IL
Sbjct:    6 LGTKAPAWIRDESVTMC--MLCDALFTLTRRRHHCRACGGIYCNACSHNKAPLEYRDGKLCRVCRSCREIL 74          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Medaka
Match: ENSORLT00000001799.2 (FYVE, RhoGEF and PH domain-containing protein 5 [Source:NCBI gene;Acc:101171656])

HSP 1 Score: 73.9442 bits (180), Expect = 4.170e-13
Identity = 113/483 (23.40%), Postives = 203/483 (42.03%), Query Frame = 2
Query:  500 IYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRY-NKCFDESNELRKKGKEVEXXXXXXXXXXXXXQKQIFLAQKELSLIS------GRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITR-TIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEI-------PPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHK------DLHNSHA--LNEAKKNLKTVFD-------LKTRKG---------TKSGWLEERIYNSEKGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTES 1831
            ++ +++  Y  S   + + C+ +  F  I   V+K ++    ++L   L  +   +  + M L  Y N    +S E     ++ +  +  + +  +     I   +  L LI+      G+   L  +  F+ +G    +++K  +  R L L +D L  T    N  G  ++K  LS++ L +++ TI++  N  K   G +I+       F  E ED    W   LN TV + +               +   +GE AP     S    C   NC+  F+  +RRHHC   G + C SC+  +  LK++K+  +KVC+ CY  L K      +L  S +  ++   + L TVF         + RKG         ++ G +   +  S+K   N    +F    LK   L  Y   E++     + L+G ++  K   +Y G+ + + F + H+D    Y FK       Q+WV+ + E+
Sbjct:  971 VFTTYIGHYDRSMSLLENSCQTSPAFAAI---VQKFEEQSSAVSLKQQLLQVIVRVARYRMLLTDYLNNLSPDSREY----EDTQAAVGIVSDIADQINDNIKHGENLLRLINIAHSVHGQRDLLHPDRVFVKEGTLMKVSRKSRQP-RHLFLMNDVLLYTYPQQN--GKYRLKNTLSLTGLKVSKPTIDNAPNALKIE-GTDISIILSASSF-LERED----WFYTLNRTVTEHTRGSAFNSCSGESRDGLKLLLGEKAPTLVPVSQVMMC--MNCTADFSLTLRRHHCHGCGRIVCRSCSRNRYPLKYMKDRMAKVCDHCYSELKKRGGEICELSGSSSPRMHRLSRPLSTVFHNIHPHNIWRNRKGIISFTQVTVSEEGSISGTLQRSKKSKKNWKRLWFL---LKDKVLYTYRAQEERIASESLPLLGFTV--KLSDKYAGEEETNVFQLYHKDT-LFYSFKAEDNFTAQRWVNAMEEA 1429          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Medaka
Match: fgd4a (FYVE, RhoGEF and PH domain containing 4 [Source:NCBI gene;Acc:101161238])

HSP 1 Score: 73.1738 bits (178), Expect = 4.589e-13
Identity = 110/467 (23.55%), Postives = 191/467 (40.90%), Query Frame = 2
Query:  494 LDIYKSFLNQYSNSA----KWISDMCRENEIFLEICETVRKRKQIQEI---ITLDSSLYTIFNSLFSFSMFLHRY-NKCFDESNELRKKGKEVEXXXXXXXXXXXXXQKQIFLAQ-KELSLISGRSKDL-KLNSRFIYKGITFCLNKKDEKIF-RILVLFSDCLYVTSLPGNITGACK--VKEELSMSNLIITRTI-EDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPPKNI--------ASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRR-HHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHP-YLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYL 1822
            L +Y  ++  + N+     +W     +   I LEI        Q QE+   +TL   +      +  + M L  Y  K  D+  + R   K +E I     +  +  +K   L +  E+  + G  +D+   ++ FI +G    L  ++     R L LF++ L +  +P    G  K  V+  + +  + +  T  ED  + F+      ++ +E T +    +E     W     +T++ F +     KN          + +G+ APRW +D+    C    C + F  + RR HHCRA G + C  C+  K  L++  N  +KVC  CY  L  +        + KK  K + +++  K T+S  +   + +S+KG      K +C +  K    L LY   +D +    I L+G S+     S       PS      Q K   Y F   + E  Q+W+  +
Sbjct:  238 LKMYAEYVKNFDNAMELLKQWSDRSPQFKAIILEI--------QSQEVCGCLTLQHHMLEPVQRIPRYEMLLKDYLKKLPDKHPDERDAQKSLEIIATAATHSNSAIRKSENLKKLMEIYEMLGEEEDIVNPSNEFIREGHILKLAARNTSAMERYLFLFNNML-LYCVPKFSLGGPKYTVRTRIGIEGMTVRETSNEDYPHTFQ------VSGKERTLELQASSEQDKAGWIKAFQETIEVFQQKNESFKNALKEVEEVSKAELGKRAPRWIRDNEVTMC--MKCKESFNALTRRRHHCRACGYVVCWKCSDNKAPLEYDGNKMNKVCRDCYSTLTGE----RVTEDGKKERKGILEIEAAKFTESSIICGFLQHSDKGKLW--QKVWCVIPEKDSLVLYLYGAPQDVKAQGSIPLVGYSVDESNRS-----TDPSHSFHLSQSKSVHY-FAAENDEAKQRWLKVI 675          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Medaka
Match: FGD6 (FYVE, RhoGEF and PH domain-containing protein 6 [Source:NCBI gene;Acc:101155348])

HSP 1 Score: 73.1738 bits (178), Expect = 6.087e-13
Identity = 90/375 (24.00%), Postives = 170/375 (45.33%), Query Frame = 2
Query:  494 LDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNK-------CFDESNELRKKGKEVEXXXXXXXXXXXXXQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIP-----PKNIA-----STIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHK---DLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSE 1558
            L +Y +++ ++  +   + +  R+N  F  + +   K  +   +  L   L      +  + + L  Y K        ++E+       KEV +   D++   +  QK I +  +    ++G  + ++    F  +GI   L++K  +  R+  LF+D L  T      TG  K+K  LS++ + +++  ++          LNI + E +F     +    + W N ++  +  F++ +I      P N A     + +G  AP W  D     C    C+ +FT   RRHHCRA G + C  C+S K  L+++K SD +VC+LC++ L +   +L N+ +L+   K+  T+   K +K  K   L+E   ++E
Sbjct:  723 LKMYSTYIREFDKNVALLEEQSRKNLAFGAVVKEFEKSPRCANL-ALKHYLLKPVQRIPQYQLLLTDYLKNLSEGTDGYEETKAALSLVKEVANHANDIMKHGDNFQKLIDVQHR----LNGNHQIIQPGRIFFKEGILMKLSRKVMQP-RMFFLFNDILLYTK--PVQTGQYKLKNMLSLAGMKVSKPNQEAYQN-----ELNIESVERSFILSASSATERDDWLNSISAAINDFTKKKITFLSGNPANEADLTDGTPLGSKAPIWIPDPRTTMC--MICTSEFTLTWRRHHCRACGKVICQGCSSNKHYLQYMKKSD-RVCDLCFQTLRQQKCELDNTMSLSPGLKS--TMAFSKRQKKIKPAALKEVSASTE 1079          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Medaka
Match: FGD6 (FYVE, RhoGEF and PH domain-containing protein 6 [Source:NCBI gene;Acc:101155348])

HSP 1 Score: 73.1738 bits (178), Expect = 6.800e-13
Identity = 90/375 (24.00%), Postives = 170/375 (45.33%), Query Frame = 2
Query:  494 LDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNK-------CFDESNELRKKGKEVEXXXXXXXXXXXXXQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIP-----PKNIA-----STIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHK---DLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSE 1558
            L +Y +++ ++  +   + +  R+N  F  + +   K  +   +  L   L      +  + + L  Y K        ++E+       KEV +   D++   +  QK I +  +    ++G  + ++    F  +GI   L++K  +  R+  LF+D L  T      TG  K+K  LS++ + +++  ++          LNI + E +F     +    + W N ++  +  F++ +I      P N A     + +G  AP W  D     C    C+ +FT   RRHHCRA G + C  C+S K  L+++K SD +VC+LC++ L +   +L N+ +L+   K+  T+   K +K  K   L+E   ++E
Sbjct:  721 LKMYSTYIREFDKNVALLEEQSRKNLAFGAVVKEFEKSPRCANL-ALKHYLLKPVQRIPQYQLLLTDYLKNLSEGTDGYEETKAALSLVKEVANHANDIMKHGDNFQKLIDVQHR----LNGNHQIIQPGRIFFKEGILMKLSRKVMQP-RMFFLFNDILLYTK--PVQTGQYKLKNMLSLAGMKVSKPNQEAYQN-----ELNIESVERSFILSASSATERDDWLNSISAAINDFTKKKITFLSGNPANEADLTDGTPLGSKAPIWIPDPRTTMC--MICTSEFTLTWRRHHCRACGKVICQGCSSNKHYLQYMKKSD-RVCDLCFQTLRQQKCELDNTMSLSPGLKS--TMAFSKRQKKIKPAALKEVSASTE 1077          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Medaka
Match: fgd4a (FYVE, RhoGEF and PH domain containing 4 [Source:NCBI gene;Acc:101161238])

HSP 1 Score: 72.4034 bits (176), Expect = 7.746e-13
Identity = 110/467 (23.55%), Postives = 191/467 (40.90%), Query Frame = 2
Query:  494 LDIYKSFLNQYSNSA----KWISDMCRENEIFLEICETVRKRKQIQEI---ITLDSSLYTIFNSLFSFSMFLHRY-NKCFDESNELRKKGKEVEXXXXXXXXXXXXXQKQIFLAQ-KELSLISGRSKDL-KLNSRFIYKGITFCLNKKDEKIF-RILVLFSDCLYVTSLPGNITGACK--VKEELSMSNLIITRTI-EDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPPKNI--------ASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRR-HHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHP-YLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYL 1822
            L +Y  ++  + N+     +W     +   I LEI        Q QE+   +TL   +      +  + M L  Y  K  D+  + R   K +E I     +  +  +K   L +  E+  + G  +D+   ++ FI +G    L  ++     R L LF++ L +  +P    G  K  V+  + +  + +  T  ED  + F+      ++ +E T +    +E     W     +T++ F +     KN          + +G+ APRW +D+    C    C + F  + RR HHCRA G + C  C+  K  L++  N  +KVC  CY  L  +        + KK  K + +++  K T+S  +   + +S+KG      K +C +  K    L LY   +D +    I L+G S+     S       PS      Q K   Y F   + E  Q+W+  +
Sbjct:  262 LKMYAEYVKNFDNAMELLKQWSDRSPQFKAIILEI--------QSQEVCGCLTLQHHMLEPVQRIPRYEMLLKDYLKKLPDKHPDERDAQKSLEIIATAATHSNSAIRKSENLKKLMEIYEMLGEEEDIVNPSNEFIREGHILKLAARNTSAMERYLFLFNNML-LYCVPKFSLGGPKYTVRTRIGIEGMTVRETSNEDYPHTFQ------VSGKERTLELQASSEQDKAGWIKAFQETIEVFQQKNESFKNALKEVEEVSKAELGKRAPRWIRDNEVTMC--MKCKESFNALTRRRHHCRACGYVVCWKCSDNKAPLEYDGNKMNKVCRDCYSTLTGE----RVTEDGKKERKGILEIEAAKFTESSIICGFLQHSDKGKLW--QKVWCVIPEKDSLVLYLYGAPQDVKAQGSIPLVGYSVDESNRS-----TDPSHSFHLSQSKSVHY-FAAENDEAKQRWLKVI 699          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Planmine SMEST
Match: SMESG000070146.1 (SMESG000070146.1)

HSP 1 Score: 1129.01 bits (2919), Expect = 0.000e+0
Identity = 573/576 (99.48%), Postives = 574/576 (99.65%), Query Frame = 2
Query:  128 MEYLGDQLDNISLNYGDGYKDYSDSNSETETGISLTVEYISNECLDFIHSVLRALSFLNDFYRELSKENLDVETSHRFSQVFRDIEPLEKLYRFIVDKISDAKVLGTFYLPCIFLDDDVRGSLDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFDESNELRKKGKEVEXXXXXXXXXXXXXQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTESMKNYCSTI 1855
            MEYLGDQLDNISLNYGDGYKDYSDSNSETETGISLTVEYISNECLDFIHSVLRALSFLNDFYRELSKENLDVETSHRFSQVFRDIEPLEKLYRFIVDKISDAKVLGTFYLPCIFLDDDVRGSLDIYKSFLNQYSNSAKWISDMCRE EI+LEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFDESNELRKKGKEVE IIADLLNDININQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSFKLKLKFLKNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTESMKNYCSTI
Sbjct:    1 MEYLGDQLDNISLNYGDGYKDYSDSNSETETGISLTVEYISNECLDFIHSVLRALSFLNDFYRELSKENLDVETSHRFSQVFRDIEPLEKLYRFIVDKISDAKVLGTFYLPCIFLDDDVRGSLDIYKSFLNQYSNSAKWISDMCREKEIYLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFDESNELRKKGKEVEGIIADLLNDININQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSFKLKLKFLKNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTESMKNYCSTI 576          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Planmine SMEST
Match: SMESG000070146.1 (SMESG000070146.1)

HSP 1 Score: 1102.04 bits (2849), Expect = 0.000e+0
Identity = 555/576 (96.35%), Postives = 556/576 (96.53%), Query Frame = 2
Query:  128 MEYLGDQLDNISLNYGDGYKDYSDSNSETETGISLTVEYISNECLDFIHSVLRALSFLNDFYRELSKENLDVETSHRFSQVFRDIEPLEKLYRFIVDKISDAKVLGTFYLPCIFLDDDVRGSLDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFDESNELRKKGKEVEXXXXXXXXXXXXXQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTESMKNYCSTI 1855
            MEYLGDQLDNISLNYGDGYKDYSDSNSETETGISLTVEYISNECLDFIHSVLRALSFLNDFYRELSKENLDVETSHRFSQVFRDIEPLEKLYRFIVDKISDAKVLGTFYLPCIFLDDDVRGSLDIYKSFLNQYSNSAKWISDMCRE EI+LEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFDESNELRKKGKEVE IIADLLNDININQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLY                  SKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTESMKNYCSTI
Sbjct:    1 MEYLGDQLDNISLNYGDGYKDYSDSNSETETGISLTVEYISNECLDFIHSVLRALSFLNDFYRELSKENLDVETSHRFSQVFRDIEPLEKLYRFIVDKISDAKVLGTFYLPCIFLDDDVRGSLDIYKSFLNQYSNSAKWISDMCREKEIYLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFDESNELRKKGKEVEGIIADLLNDININQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEKIFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYY-----------------SKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTESMKNYCSTI 559          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Planmine SMEST
Match: SMESG000036666.1 (SMESG000036666.1)

HSP 1 Score: 490.73 bits (1262), Expect = 2.595e-166
Identity = 272/595 (45.71%), Postives = 387/595 (65.04%), Query Frame = 2
Query:  104 LILIVFSSMEYLGDQLDNISLN---YGDGYKDYSDSNSETETGISLTVEYISNECLDFIHSVLRALSFLNDFYRELSKENLD-VETSHRFSQVFRDIEPLEKLYRFIVDKISDAKVLGTFYLPCIFLDDDVRGSLDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFDESNELRKKGKEVEXXXXXXXXXXXXX--QKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEKIF-RILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPPKNIASTI-----GETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTESMKNYCST 1852
            ++ I  SS E     +DN S N        K  SD+ S+ E      ++ I+NEC++FI+++L++LS+L +F   L  E  D  E S   + VFR+IEPL  LY+ +++KI++ K  GTF LP +FLD++++G L+IYKSF  QYS ++KW+ +  + N    E+C+ V+ R QI E++TL+S LYT+F SLFSF +F++RY  CF E +E R+K ++V+  I+ LL+ IN N  Q+   L  KEL+L++GRS++ K+ ++FIYKG    L+++D+++  R L+LFSDCLY                ELS+  + I++ I  E +     WGLNI  +E   DFYFE+E++MN W + L   +    E  + P +++  I     GE  PRWQKD  + +CNG+NC+Q+F+  VRRHHCR DGLLYCDSC S K  LKF KN +S+VCE CY IL++D  +   + EA+K L+TV++ KTRKG K  WLEERIYN EKG+FN  VKYFCEL  +HP+L LY+K EDK  HHGI+L+ M++  K  SR+  KLKP QF IEH DK+EAYLF   S E C +WV  L E+++NYCS+
Sbjct:   44 VVWIKHSSSE--NSSIDNKSENCTSSNPSLKGRSDTESDAECEYVSKLDNITNECVNFINNILKSLSYLMEFKAALHAEFHDNKEISSYLTSVFREIEPLHMLYKLVLEKITELKDKGTFCLPDLFLDNEIKGPLNIYKSFFGQYSINSKWLGEFIKSNTACQEVCKQVKDRLQIGELLTLESCLYTVFGSLFSFDLFINRYASCFGEKDEARQKAEDVKTQISSLLSIINKNLDQENFLLTHKELNLMTGRSRETKIATKFIYKGNASKLSRRDQRMLPRQLMLFSDCLY----------------ELSLDTMQISKII-SEDDKISLKWGLNIFTREALQDFYFEDEETMNLWISKLQLVI---GEKAVVPNDVSKAISILKIGEEPPRWQKDCNSNFCNGHNCNQRFSSTVRRHHCRTDGLLYCDSCCSLKAVLKFEKNCESRVCEPCYVILNRDKISPQEVKEAEKQLETVYEKKTRKGMKMDWLEERIYNCEKGVFNSSVKYFCELHNEHPFLALYDKLEDKNKHHGIMLLRMTVCIKKQSRFIRKLKPQQFTIEHMDKNEAYLFDTPSPESCNEWVQCLNENIRNYCSS 616          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Planmine SMEST
Match: SMESG000036666.1 (SMESG000036666.1)

HSP 1 Score: 488.034 bits (1255), Expect = 1.712e-165
Identity = 262/564 (46.45%), Postives = 375/564 (66.49%), Query Frame = 2
Query:  188 DYSDSNSETETGISLTVEYISNECLDFIHSVLRALSFLNDFYRELSKENLD-VETSHRFSQVFRDIEPLEKLYRFIVDKISDAKVLGTFYLPCIFLDDDVRGSLDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFDESNELRKKGKEVEXXXXXXXXXXXXX--QKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDEKIF-RILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKKFSEAEIPPKNIASTI-----GETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTESMKNYCST 1852
            D  ++ S+ E      ++ I+NEC++FI+++L++LS+L +F   L  E  D  E S   + VFR+IEPL  LY+ +++KI++ K  GTF LP +FLD++++G L+IYKSF  QYS ++KW+ +  + N    E+C+ V+ R QI E++TL+S LYT+F SLFSF +F++RY  CF E +E R+K ++V+  I+ LL+ IN N  Q+   L  KEL+L++GRS++ K+ ++FIYKG    L+++D+++  R L+LFSDCLY                ELS+  + I++ I  E +     WGLNI  +E   DFYFE+E++MN W + L   +    E  + P +++  I     GE  PRWQKD  + +CNG+NC+Q+F+  VRRHHCR DGLLYCDSC S K  LKF KN +S+VCE CY IL++D  +   + EA+K L+TV++ KTRKG K  WLEERIYN EKG+FN  VKYFCEL  +HP+L LY+K EDK  HHGI+L+ M++  K  SR+  KLKP QF IEH DK+EAYLF   S E C +WV  L E+++NYCS+
Sbjct:   58 DNKNTESDAECEYVSKLDNITNECVNFINNILKSLSYLMEFKAALHAEFHDNKEISSYLTSVFREIEPLHMLYKLVLEKITELKDKGTFCLPDLFLDNEIKGPLNIYKSFFGQYSINSKWLGEFIKSNTACQEVCKQVKDRLQIGELLTLESCLYTVFGSLFSFDLFINRYASCFGEKDEARQKAEDVKTQISSLLSIINKNLDQENFLLTHKELNLMTGRSRETKIATKFIYKGNASKLSRRDQRMLPRQLMLFSDCLY----------------ELSLDTMQISKII-SEDDKISLKWGLNIFTREALQDFYFEDEETMNLWISKLQLVI---GEKAVVPNDVSKAISILKIGEEPPRWQKDCNSNFCNGHNCNQRFSSTVRRHHCRTDGLLYCDSCCSLKAVLKFEKNCESRVCEPCYVILNRDKISPQEVKEAEKQLETVYEKKTRKGMKMDWLEERIYNCEKGVFNSSVKYFCELHNEHPFLALYDKLEDKNKHHGIMLLRMTVCIKKQSRFIRKLKPQQFTIEHMDKNEAYLFDTPSPESCNEWVQCLNENIRNYCSS 601          
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Planmine SMEST
Match: SMESG000014968.1 (SMESG000014968.1)

HSP 1 Score: 362.073 bits (928), Expect = 1.370e-116
Identity = 215/540 (39.81%), Postives = 327/540 (60.56%), Query Frame = 2
Query:  245 ISNECLDFIHSVLRALSFLNDFYRELSKE-NLDVETSHRFSQVFRDIEPLEKLYRFIVDKISDAKVLGTFYLPCIFLDDDVRGSLDIYKSFLNQYSNSAKWISDMCRENEIFLEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFDESNELRKKGKEVEXXXXXXXXXXXXXQKQIFLAQKELSLISGRSKDLKLNSRFIYKGITFCLNKKDE-KIFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLIITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKK----FSEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCRADGLLYCDSCTSXXXXXXXXXNSDSKVCELCYRILHKDLHNSHALNEAKKNLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHPYLNLYEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLFKVNSAEYCQKWVDYLTESMKNYC 1846
            I+ EC+DF++++ + LS L  F  EL KE   D E   + + VFRDI PL+ +Y+ I   + D +      LP +FL  +++ SL+ YKSFL+QY+ ++KWI  + + N      C+   +R   +E ++L+S  Y++FNSLFS  + + R++KCF E +    K +EV+ I+ ++L  +  +Q+       EL+L+ GRS   K+++RFI K      + KD  ++ R+LVLFSDCLYV     N  G  +V++ELS+  + +++  ++ S   K   GLNIN  E    FYFE+ + +  W  L+   +      FS ++ P     + +GE+ P WQKD+A GYCNG+NC  +FT   RRHHCRADGL+YC+SC+S+++KLKF K++ S+VC+LCY+IL     NS  + + KK+L +VFD KTRKG K  WL+     S K       +YFCELD + P+L LY  +EDK     IIL+GM I +  +S+Y+  +KP++F IEH D+ E YLFK   +E C +WV+ L  S+  +C
Sbjct:   74 IAQECVDFLYNISKCLSQLKKFKDELEKEFAEDFELKIQITGVFRDIVPLDSVYKLIEKSLGDIQNQNECLLPDLFLHQEIKSSLNFYKSFLSQYAVNSKWIVQLNKTNVK----CQRACQRSIQEENLSLESCHYSVFNSLFSLELIIERFSKCFQEQDPEYTKAREVKTILRNILLSVPQDQEIFIKTHHELNLLIGRSVVPKVSTRFISKVTVKKYSSKDNTELTRLLVLFSDCLYVAIPSHNNQGISRVRQELSLRYMRVSKIPDEVSIKGKEGCGLNINTLEMNKAFYFEDINMLKSWMELIKKAIGSVNTLFSNSKPP-----AILGESEPVWQKDNATGYCNGFNCLSQFTFSNRRHHCRADGLIYCESCSSYRIKLKFGKSNTSRVCDLCYKIL---TENSDQVAQYKKDLNSVFDRKTRKGVKLSWLKVADMKSPKTY----SEYFCELDKEDPFLKLYRNFEDKVRSFDIILLGMKIATGKNSKYFPNMKPNKFTIEHIDRFEGYLFKALDSENCNEWVECLQRSLDKFC 597          
The following BLAST results are available for this feature:
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FGD67.512e-1326.39FYVE, RhoGEF and PH domain containing 6 [Source:HG... [more]
FGD62.366e-1224.13FYVE, RhoGEF and PH domain containing 6 [Source:HG... [more]
FGD61.953e-1127.94FYVE, RhoGEF and PH domain containing 6 [Source:HG... [more]
FGD45.738e-1021.17FYVE, RhoGEF and PH domain containing 4 [Source:HG... [more]
ZFYVE91.055e-943.84zinc finger FYVE-type containing 9 [Source:HGNC Sy... [more]
back to top
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Sara6.173e-1041.77gene:FBgn0026369 transcript:FBtr0071641[more]
fab19.841e-638.46gene:FBgn0028741 transcript:FBtr0089555[more]
fab19.841e-638.46gene:FBgn0028741 transcript:FBtr0089554[more]
back to top
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgd62.332e-1123.01FYVE, RhoGEF and PH domain containing 6 [Source:ZF... [more]
plekhf24.745e-1133.83pleckstrin homology domain containing, family F (w... [more]
plekhf24.745e-1133.83pleckstrin homology domain containing, family F (w... [more]
fgd64.981e-1123.01FYVE, RhoGEF and PH domain containing 6 [Source:ZF... [more]
fgd61.114e-924.80FYVE, RhoGEF and PH domain containing 6 [Source:ZF... [more]
back to top
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mc3r6.446e-1222.39melanocortin 3 receptor [Source:Xenbase;Acc:XB-GEN... [more]
ZFYVE92.967e-940.00zinc finger FYVE-type containing 9 [Source:NCBI ge... [more]
ZFYVE93.900e-940.00zinc finger FYVE-type containing 9 [Source:NCBI ge... [more]
ZFYVE94.116e-940.00zinc finger FYVE-type containing 9 [Source:NCBI ge... [more]
ZFYVE94.367e-940.00zinc finger FYVE-type containing 9 [Source:NCBI ge... [more]
back to top
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fgd67.188e-1121.97FYVE, RhoGEF and PH domain containing 6 [Source:MG... [more]
Fgd41.560e-1021.30FYVE, RhoGEF and PH domain containing 4 [Source:MG... [more]
Fgd42.001e-1021.30FYVE, RhoGEF and PH domain containing 4 [Source:MG... [more]
Fgd42.001e-1021.30FYVE, RhoGEF and PH domain containing 4 [Source:MG... [more]
Fgd21.227e-923.17FYVE, RhoGEF and PH domain containing 2 [Source:MG... [more]
back to top
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6ZV73|FGD6_HUMAN1.136e-1124.13FYVE, RhoGEF and PH domain-containing protein 6 OS... [more]
sp|Q7ZUV1|PKHF2_DANRE3.582e-1033.83Pleckstrin homology domain-containing family F mem... [more]
sp|Q69ZL1|FGD6_MOUSE5.028e-1021.97FYVE, RhoGEF and PH domain-containing protein 6 OS... [more]
sp|O88387|FGD4_RAT7.935e-1021.52FYVE, RhoGEF and PH domain-containing protein 4 OS... [more]
sp|Q91ZT5|FGD4_MOUSE1.400e-921.30FYVE, RhoGEF and PH domain-containing protein 4 OS... [more]
back to top
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YG186.047e-2024.04FYVE RhoGEF and PH domain-containing protein 2 (Fr... [more]
A0A4S2KKS61.501e-1823.33Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2KK811.761e-1823.33Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5K4E8Y72.236e-1826.74Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4E8F12.599e-1826.74Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000014177.26.479e-1624.69FYVE, RhoGEF and PH domain-containing protein 6-li... [more]
fgd62.392e-1121.97FYVE, RhoGEF and PH domain containing 6 [Source:NC... [more]
plekhf25.241e-1129.03pleckstrin homology and FYVE domain containing 2 [... [more]
fgd5b1.182e-824.58FYVE, RhoGEF and PH domain containing 5b [Source:Z... [more]
fgd4b3.071e-820.60FYVE, RhoGEF and PH domain containing 4b [Source:Z... [more]
back to top
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000005437.15.713e-1230.08pep scaffold:Pmarinus_7.0:GL486528:10206:16522:1 g... [more]
fgd16.842e-824.32FYVE, RhoGEF and PH domain containing 1 [Source:ZF... [more]
zfyve9a1.292e-740.30zinc finger, FYVE domain containing 9a [Source:ZFI... [more]
back to top
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PIB15.904e-648.78RING-type ubiquitin ligase of the endosomal and va... [more]
back to top
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO482325.217e-1222.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385011.268e-729.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481841.584e-738.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000001799.24.170e-1323.40FYVE, RhoGEF and PH domain-containing protein 5 [S... [more]
fgd4a4.589e-1323.55FYVE, RhoGEF and PH domain containing 4 [Source:NC... [more]
FGD66.087e-1324.00FYVE, RhoGEF and PH domain-containing protein 6 [S... [more]
FGD66.800e-1324.00FYVE, RhoGEF and PH domain-containing protein 6 [S... [more]
fgd4a7.746e-1323.55FYVE, RhoGEF and PH domain containing 4 [Source:NC... [more]
back to top
BLAST of FYVE, RhoGEF and PH domain containing 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070146.10.000e+099.48SMESG000070146.1[more]
SMESG000070146.10.000e+096.35SMESG000070146.1[more]
SMESG000036666.12.595e-16645.71SMESG000036666.1[more]
SMESG000036666.11.712e-16546.45SMESG000036666.1[more]
SMESG000014968.11.370e-11639.81SMESG000014968.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034357 ID=SMED30034357|Name=FYVE, RhoGEF and PH domain containing 6|organism=Schmidtea mediterranea sexual|type=transcript|length=2016bp
AAATAATATTCGCTATTATTATTTATCATTATTTTAAAACTAACAAAATT
TATAATTTACCTAGAAAACTTTCTTTTTTCATTTATTATTTGCCTATATT
GGTTTGATTTTAATCGTATTCTCCTCAATGGAGTATTTAGGAGATCAGTT
GGACAATATAAGTCTTAATTATGGTGATGGATATAAAGATTATTCTGACA
GCAATAGTGAGACTGAAACTGGAATCAGTTTAACAGTGGAATATATTAGT
AATGAATGTTTGGATTTTATTCACTCTGTACTAAGGGCTTTATCTTTTCT
CAATGATTTCTACAGAGAATTGTCGAAAGAAAATCTCGACGTAGAGACTA
GTCATCGATTTTCTCAGGTTTTCCGCGACATTGAGCCGCTAGAAAAGTTG
TATCGATTTATTGTCGACAAAATATCCGATGCAAAAGTTCTCGGAACGTT
TTATTTGCCTTGTATATTTCTCGATGACGATGTGAGAGGATCGCTGGATA
TTTACAAATCATTTCTCAACCAGTACTCAAATAGTGCTAAATGGATATCC
GATATGTGCAGGGAAAATGAAATTTTTTTGGAAATCTGTGAAACTGTCAG
GAAGCGCAAACAAATCCAGGAAATAATCACATTAGACAGCAGTTTGTATA
CTATTTTCAATAGTTTATTCAGTTTTTCCATGTTTTTACACAGATATAAC
AAATGTTTTGATGAAAGTAACGAATTACGGAAAAAAGGAAAAGAGGTAGA
AGATATCATTGCAGATCTTCTAAATGATATCAATATCAATCAAAAACAAA
TATTTCTTGCCCAAAAAGAGTTGAGTTTAATAAGTGGTAGAAGCAAAGAT
TTAAAGTTAAATTCGAGATTTATTTATAAAGGAATCACATTTTGTTTGAA
TAAGAAAGATGAAAAAATATTTCGAATCCTCGTACTATTTTCAGATTGCC
TTTATGTGACATCATTGCCAGGGAATATCACTGGTGCTTGTAAGGTCAAG
GAAGAATTATCAATGTCTAATTTGATTATTACAAGAACTATTGAAGATGA
ATCGAATGGATTTAAGTGCAATTGGGGATTAAACATAAATGCTCAAGAAG
GAACTTTTGATTTCTATTTTGAGAATGAAGATTCGATGAACAAGTGGAAA
AATCTATTAAATGATACTGTTAAAAAATTTTCAGAAGCTGAGATTCCCCC
AAAAAATATCGCATCTACAATAGGTGAAACTGCCCCACGGTGGCAAAAGG
ATAGTGCAGCTGGGTATTGTAATGGATATAATTGTTCTCAGAAATTCACT
CCAGTAGTTAGGCGGCATCATTGCCGCGCCGATGGATTACTTTATTGTGA
TTCTTGTACTTCTTTTAAATTAAAACTCAAATTTCTGAAAAATTCAGATT
CTAAAGTCTGTGAATTATGCTATCGAATTCTCCACAAAGATCTTCATAAT
TCTCACGCTCTGAATGAAGCTAAAAAAAATTTGAAAACTGTTTTCGACTT
GAAAACTAGAAAAGGAACAAAATCAGGTTGGTTAGAGGAAAGAATCTATA
ATTCCGAGAAAGGAATATTCAATCCGCCAGTGAAATACTTTTGCGAACTT
GATCTTAAACATCCGTATTTGAACTTGTATGAAAAATATGAAGACAAACG
AAACCATCATGGAATTATTTTGATCGGCATGAGCATCAGATCAAAATGCC
ATTCCAGATATTATGGAAAATTGAAACCCTCTCAGTTTATCATTGAGCAT
CAAGATAAAGATGAAGCATACCTATTTAAAGTTAATTCAGCCGAATACTG
TCAAAAATGGGTTGATTATCTCACAGAAAGTATGAAAAACTATTGCAGTA
CTATTTAAATTCGACTCTCATTTTCAAAACATTCTAAGTATTTTACAAAT
TTCAAAATTATTTTTGGCTTGGCAAATCCAGCGACAAAATCAATCTTAAA
CAACCATTTTTATCTCTTGTTTATTTTTAATATATTTTTTAAAATAATAA
ATTTGTTATACTGGAC
back to top

protein sequence of SMED30034357-orf-1

>SMED30034357-orf-1 ID=SMED30034357-orf-1|Name=SMED30034357-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=577bp
MEYLGDQLDNISLNYGDGYKDYSDSNSETETGISLTVEYISNECLDFIHS
VLRALSFLNDFYRELSKENLDVETSHRFSQVFRDIEPLEKLYRFIVDKIS
DAKVLGTFYLPCIFLDDDVRGSLDIYKSFLNQYSNSAKWISDMCRENEIF
LEICETVRKRKQIQEIITLDSSLYTIFNSLFSFSMFLHRYNKCFDESNEL
RKKGKEVEDIIADLLNDININQKQIFLAQKELSLISGRSKDLKLNSRFIY
KGITFCLNKKDEKIFRILVLFSDCLYVTSLPGNITGACKVKEELSMSNLI
ITRTIEDESNGFKCNWGLNINAQEGTFDFYFENEDSMNKWKNLLNDTVKK
FSEAEIPPKNIASTIGETAPRWQKDSAAGYCNGYNCSQKFTPVVRRHHCR
ADGLLYCDSCTSFKLKLKFLKNSDSKVCELCYRILHKDLHNSHALNEAKK
NLKTVFDLKTRKGTKSGWLEERIYNSEKGIFNPPVKYFCELDLKHPYLNL
YEKYEDKRNHHGIILIGMSIRSKCHSRYYGKLKPSQFIIEHQDKDEAYLF
KVNSAEYCQKWVDYLTESMKNYCSTI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005085guanyl-nucleotide exchange factor activity
GO:0046872metal ion binding
GO:0005089Rho guanyl-nucleotide exchange factor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035899DBL_dom_sf
IPR000306Znf_FYVE
IPR001849PH_domain
IPR011993PH-like_dom_sf
IPR000219DH-domain
IPR013083Znf_RING/FYVE/PHD
IPR017455Znf_FYVE-rel
IPR011011Znf_FYVE_PHD
Vocabulary: biological process
TermDefinition
GO:0035023regulation of Rho protein signal transduction
GO:0043547positive regulation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 463..572
e-value: 0.01
score: 25.0
coord: 248..351
e-value: 0.012
score: 24.9
IPR000306FYVE zinc fingerSMARTSM00064fyve_4coord: 367..437
e-value: 1.2E-17
score: 74.6
IPR000306FYVE zinc fingerPFAMPF01363FYVEcoord: 371..436
e-value: 1.5E-12
score: 47.4
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 451..574
e-value: 7.8E-7
score: 30.7
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 242..346
e-value: 3.2E-6
score: 29.5
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 361..450
e-value: 4.3E-17
score: 63.6
NoneNo IPR availablePANTHERPTHR39490FAMILY NOT NAMEDcoord: 307..438
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 240..371
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 459..570
IPR000219Dbl homology (DH) domainPROSITEPS50010DH_2coord: 36..221
score: 9.777
IPR017455Zinc finger, FYVE-relatedPROSITEPS50178ZF_FYVEcoord: 386..436
score: 9.216
IPR035899Dbl homology (DH) domain superfamilySUPERFAMILYSSF48065DBL homology domain (DH-domain)coord: 52..224
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 370..443