Potassium voltage-gated channel subfamily A member 2

Overview
NamePotassium voltage-gated channel subfamily A member 2
Smed IDSMED30034352
Length (bp)456
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 160.229 bits (404), Expect = 1.807e-49
Identity = 77/138 (55.80%), Postives = 99/138 (71.74%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTN 405
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E    +S   SIP AFWWA+++M TVGYGD VP    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T 
Sbjct:   31 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE 168          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 159.458 bits (402), Expect = 2.226e-48
Identity = 77/138 (55.80%), Postives = 99/138 (71.74%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTN 405
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E    +S   SIP AFWWA+++M TVGYGD VP    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T 
Sbjct:   91 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE 228          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: GALNT8 (polypeptide N-acetylgalactosaminyltransferase 8 [Source:HGNC Symbol;Acc:HGNC:4130])

HSP 1 Score: 162.925 bits (411), Expect = 8.685e-48
Identity = 79/137 (57.66%), Postives = 99/137 (72.26%), Query Frame = 1
Query:    7 SASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNR 408
            + SLA LRVI+L+R   IFKL++HS GLQ+L KT +AS+  LGL +  L + VILFSSA+Y+ E   +DS   SIP AFWWA++TM TVGYGD  P    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T +
Sbjct:  335 AMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDDDSLFPSIPDAFWWAVVTMTTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQ 471          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: KCNA6 (potassium voltage-gated channel subfamily A member 6 [Source:HGNC Symbol;Acc:HGNC:6225])

HSP 1 Score: 162.925 bits (411), Expect = 8.685e-48
Identity = 79/137 (57.66%), Postives = 99/137 (72.26%), Query Frame = 1
Query:    7 SASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNR 408
            + SLA LRVI+L+R   IFKL++HS GLQ+L KT +AS+  LGL +  L + VILFSSA+Y+ E   +DS   SIP AFWWA++TM TVGYGD  P    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T +
Sbjct:  335 AMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDDDSLFPSIPDAFWWAVVTMTTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQ 471          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Match: KCNA2 (potassium voltage-gated channel subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:6220])

HSP 1 Score: 159.458 bits (402), Expect = 9.818e-48
Identity = 77/138 (55.80%), Postives = 99/138 (71.74%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTN 405
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E    +S   SIP AFWWA+++M TVGYGD VP    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T 
Sbjct:  163 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE 300          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 141.739 bits (356), Expect = 6.570e-40
Identity = 65/140 (46.43%), Postives = 102/140 (72.86%), Query Frame = 1
Query:    4 NSASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTY--EDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI 417
            N  S+ F  +I+++R+FKLT+HS+GL++L++TF+AS + L L V  + + +++F++ +YY E     E++   SIP   WWA+IT+CT+G+GD VPQ  LG++VGS CA+ GVLT+A+PVP+I  NF  FYSH   R+++
Sbjct:  387 NRDSVEFFSIIRILRLFKLTQHSTGLKILIQTFKASAQELFLLVFFVLLGIVIFAALVYYAERVEHNEENQFSSIPVGLWWAVITICTIGFGDLVPQTSLGRLVGSVCALMGVLTIALPVPVIVSNFAMFYSHAQARSKL 526          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shw-3 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A0A3B1DVP6])

HSP 1 Score: 137.887 bits (346), Expect = 4.049e-39
Identity = 69/139 (49.64%), Postives = 100/139 (71.94%), Query Frame = 1
Query:    7 SASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVE--NTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI 417
            +A L F  +I+++R+FKLT H+SGL++L+ TFRAS + L L V  L + V++F+S +YY E   + ED+   SIP   WWAI+TM T+GYGD  P  +LG+++GS CA+AGVLT+A+PVP+I  NF  FYSH   R+++
Sbjct:  290 TADLEFFSIIRIMRLFKLTHHNSGLKILMHTFRASAKELMLLVFFLVLGVVVFASLVYYAERVESNEDNQFVSIPIGLWWAIVTMTTIGYGDITPHTYLGRLIGSICALAGVLTIALPVPVIVSNFAMFYSHTQARSKM 428          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shw-3 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A0A3B1DVP6])

HSP 1 Score: 137.887 bits (346), Expect = 4.685e-39
Identity = 69/139 (49.64%), Postives = 100/139 (71.94%), Query Frame = 1
Query:    7 SASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVE--NTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI 417
            +A L F  +I+++R+FKLT H+SGL++L+ TFRAS + L L V  L + V++F+S +YY E   + ED+   SIP   WWAI+TM T+GYGD  P  +LG+++GS CA+AGVLT+A+PVP+I  NF  FYSH   R+++
Sbjct:  308 TADLEFFSIIRIMRLFKLTHHNSGLKILMHTFRASAKELMLLVFFLVLGVVVFASLVYYAERVESNEDNQFVSIPIGLWWAIVTMTTIGYGDITPHTYLGRLIGSICALAGVLTIALPVPVIVSNFAMFYSHTQARSKM 446          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shw-3 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A0A3B1DVP6])

HSP 1 Score: 137.887 bits (346), Expect = 5.499e-39
Identity = 69/139 (49.64%), Postives = 100/139 (71.94%), Query Frame = 1
Query:    7 SASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVE--NTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI 417
            +A L F  +I+++R+FKLT H+SGL++L+ TFRAS + L L V  L + V++F+S +YY E   + ED+   SIP   WWAI+TM T+GYGD  P  +LG+++GS CA+AGVLT+A+PVP+I  NF  FYSH   R+++
Sbjct:  311 TADLEFFSIIRIMRLFKLTHHNSGLKILMHTFRASAKELMLLVFFLVLGVVVFASLVYYAERVESNEDNQFVSIPIGLWWAIVTMTTIGYGDITPHTYLGRLIGSICALAGVLTIALPVPVIVSNFAMFYSHTQARSKM 449          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 135.576 bits (340), Expect = 3.632e-38
Identity = 61/137 (44.53%), Postives = 99/137 (72.26%), Query Frame = 1
Query:   13 SLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTY--EDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI 417
            +L FL +I ++R+FKLT+H SGL++L++TF+AS + L L V  + + +++F++ +YY E +   +D+   SIP   WW+++T+ TVG+GD VP+ +LG +VGS CA+ GVLT+A+PVP+I  NF+  YSH   R ++
Sbjct:  295 TLDFLSMICVLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKL 431          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0089660)

HSP 1 Score: 161.77 bits (408), Expect = 2.223e-47
Identity = 78/142 (54.93%), Postives = 102/142 (71.83%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI 417
              + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + V+LFSSA+Y+ E   E+S  KSIP AFWWA++TM TVGYGD  P  F GKIVGS C +AGVLT+A+PVP+I  NFN FY   T++  +
Sbjct:  308 NQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGFWGKIVGSLCVIAGVLTIALPVPVIVSNFNYFYHRETDQEEM 449          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0346703)

HSP 1 Score: 162.155 bits (409), Expect = 2.553e-47
Identity = 78/141 (55.32%), Postives = 102/141 (72.34%), Query Frame = 1
Query:    4 NSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI 417
             + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + V+LFSSA+Y+ E   E+S  KSIP AFWWA++TM TVGYGD  P  F GKIVGS C +AGVLT+A+PVP+I  NFN FY   T++  +
Sbjct:  354 QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGFWGKIVGSLCVIAGVLTIALPVPVIVSNFNYFYHRETDQEEM 494          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0089658)

HSP 1 Score: 162.155 bits (409), Expect = 2.553e-47
Identity = 78/141 (55.32%), Postives = 102/141 (72.34%), Query Frame = 1
Query:    4 NSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI 417
             + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + V+LFSSA+Y+ E   E+S  KSIP AFWWA++TM TVGYGD  P  F GKIVGS C +AGVLT+A+PVP+I  NFN FY   T++  +
Sbjct:  354 QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGFWGKIVGSLCVIAGVLTIALPVPVIVSNFNYFYHRETDQEEM 494          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0346705)

HSP 1 Score: 161.77 bits (408), Expect = 2.982e-47
Identity = 78/142 (54.93%), Postives = 102/142 (71.83%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI 417
              + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + V+LFSSA+Y+ E   E+S  KSIP AFWWA++TM TVGYGD  P  F GKIVGS C +AGVLT+A+PVP+I  NFN FY   T++  +
Sbjct:  341 NQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGFWGKIVGSLCVIAGVLTIALPVPVIVSNFNYFYHRETDQEEM 482          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Match: Sh (gene:FBgn0003380 transcript:FBtr0089657)

HSP 1 Score: 160.999 bits (406), Expect = 8.405e-47
Identity = 78/141 (55.32%), Postives = 102/141 (72.34%), Query Frame = 1
Query:    4 NSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI 417
             + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + V+LFSSA+Y+ E   E+S  KSIP AFWWA++TM TVGYGD  P    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T++  +
Sbjct:  354 QAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGRTLKASMRELGLLIFFLFIGVVLFSSAVYFAEAGSENSFFKSIPDAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQEEM 494          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: kcna2a (potassium voltage-gated channel, shaker-related subfamily, member 2a [Source:ZFIN;Acc:ZDB-GENE-131113-1])

HSP 1 Score: 160.614 bits (405), Expect = 2.182e-47
Identity = 77/137 (56.20%), Postives = 99/137 (72.26%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRT 402
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E    +S   SIP AFWWA+++M TVGYGD VP    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T
Sbjct:  280 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESQFYSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: kcna2a (potassium voltage-gated channel, shaker-related subfamily, member 2a [Source:ZFIN;Acc:ZDB-GENE-131113-1])

HSP 1 Score: 160.614 bits (405), Expect = 2.182e-47
Identity = 77/137 (56.20%), Postives = 99/137 (72.26%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRT 402
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E    +S   SIP AFWWA+++M TVGYGD VP    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T
Sbjct:  280 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESQFYSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: kcna2b (potassium voltage-gated channel, shaker-related subfamily, member 2b [Source:ZFIN;Acc:ZDB-GENE-080204-89])

HSP 1 Score: 160.229 bits (404), Expect = 3.653e-47
Identity = 78/138 (56.52%), Postives = 99/138 (71.74%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTN 405
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E    DS   SIP AFWWA+++M TVGYGD VP    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T 
Sbjct:  281 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPDSQFVSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE 418          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: CABZ01113981.1 (pep scaffold:GRCz11:KN150008.1:12653:14179:-1 gene:ENSDARG00000102982.2 transcript:ENSDART00000162692.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01113981.1)

HSP 1 Score: 158.688 bits (400), Expect = 7.210e-47
Identity = 78/141 (55.32%), Postives = 98/141 (69.50%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNR 414
            + + SLA LRVI+L+R   IFKL++HS GLQ+L KT +AS+  LGL +  L + VILFSSA+Y+ E    DS   SIP AFWWA+++M TVGYGD  P    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T    
Sbjct:  269 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAETDDPDSGFSSIPDAFWWAVVSMTTVGYGDMCPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEHEE 409          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 159.073 bits (401), Expect = 8.542e-47
Identity = 77/135 (57.04%), Postives = 98/135 (72.59%), Query Frame = 1
Query:    7 SASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRT 402
            + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E   +DS   SIP AFWWA+++M TVGYGD  P    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T
Sbjct:  283 ATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEKDSFFTSIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 417          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: KCNA2 (potassium channel, voltage gated shaker related subfamily A, member 3 [Source:NCBI gene;Acc:100496794])

HSP 1 Score: 163.31 bits (412), Expect = 4.110e-48
Identity = 78/137 (56.93%), Postives = 99/137 (72.26%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRT 402
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E    DS   SIP AFWWA+++M TVGYGD VP    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T
Sbjct:  285 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: ENSXETT00000049277.1 (potassium channel, voltage gated shaker related subfamily A, member 6 [Source:NCBI gene;Acc:100492986])

HSP 1 Score: 160.229 bits (404), Expect = 2.470e-47
Identity = 77/138 (55.80%), Postives = 99/138 (71.74%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTN 405
            + + SLA LRVI+L+R   IFKL++HS GLQ+L KT +AS+  LGL +  L + VILFSSA+Y+ E    +S   SIP AFWWA+++M TVGYGD  P    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T+
Sbjct:  258 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAETDDPESLFTSIPDAFWWAVVSMTTVGYGDMYPMTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETD 395          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: fastkd3 (FAST kinase domains 3 [Source:Xenbase;Acc:XB-GENE-5998409])

HSP 1 Score: 157.147 bits (396), Expect = 1.850e-46
Identity = 75/138 (54.35%), Postives = 101/138 (73.19%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTN 405
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E  +ED+   SIP AFWWA++TM TVGYGD  P+   GK+VGS CA+AGVLT+++PVP+I  NF+ FY   T 
Sbjct:  249 QPAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADHEDTKFTSIPEAFWWAVVTMTTVGYGDMSPETVGGKLVGSLCAIAGVLTISLPVPVIVSNFSYFYHRETE 386          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: KCNA1 (potassium channel, voltage gated shaker related subfamily A, member 1 [Source:NCBI gene;Acc:100492822])

HSP 1 Score: 158.303 bits (399), Expect = 2.011e-46
Identity = 76/137 (55.47%), Postives = 99/137 (72.26%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRT 402
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E   ++S   SIP AFWWA+++M TVGYGD  P    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T
Sbjct:  277 EQATSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEDESHFASIPDAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 413          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Match: fastkd3 (FAST kinase domains 3 [Source:Xenbase;Acc:XB-GENE-5998409])

HSP 1 Score: 157.147 bits (396), Expect = 5.824e-46
Identity = 75/138 (54.35%), Postives = 101/138 (73.19%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTN 405
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E  +ED+   SIP AFWWA++TM TVGYGD  P+   GK+VGS CA+AGVLT+++PVP+I  NF+ FY   T 
Sbjct:  270 QPAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADHEDTKFTSIPEAFWWAVVTMTTVGYGDMSPETVGGKLVGSLCAIAGVLTISLPVPVIVSNFSYFYHRETE 407          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna2 (potassium voltage-gated channel, shaker-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96659])

HSP 1 Score: 162.54 bits (410), Expect = 5.100e-48
Identity = 78/137 (56.93%), Postives = 99/137 (72.26%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRT 402
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E    DS   SIP AFWWA+++M TVGYGD VP    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T
Sbjct:  285 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna2 (potassium voltage-gated channel, shaker-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96659])

HSP 1 Score: 162.54 bits (410), Expect = 5.100e-48
Identity = 78/137 (56.93%), Postives = 99/137 (72.26%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRT 402
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E    DS   SIP AFWWA+++M TVGYGD VP    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T
Sbjct:  285 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna2 (potassium voltage-gated channel, shaker-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:96659])

HSP 1 Score: 162.54 bits (410), Expect = 5.100e-48
Identity = 78/137 (56.93%), Postives = 99/137 (72.26%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRT 402
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E    DS   SIP AFWWA+++M TVGYGD VP    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T
Sbjct:  285 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna6 (potassium voltage-gated channel, shaker-related, subfamily, member 6 [Source:MGI Symbol;Acc:MGI:96663])

HSP 1 Score: 162.155 bits (409), Expect = 1.347e-47
Identity = 79/139 (56.83%), Postives = 99/139 (71.22%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNR 408
            + + SLA LRVI+L+R   IFKL++HS GLQ+L KT +AS+  LGL +  L + VILFSSA+Y+ E    DS   SIP AFWWA++TM TVGYGD  P    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T +
Sbjct:  333 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDVDSLFPSIPDAFWWAVVTMTTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQ 471          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Match: Kcna6 (potassium voltage-gated channel, shaker-related, subfamily, member 6 [Source:MGI Symbol;Acc:MGI:96663])

HSP 1 Score: 162.155 bits (409), Expect = 1.347e-47
Identity = 79/139 (56.83%), Postives = 99/139 (71.22%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNR 408
            + + SLA LRVI+L+R   IFKL++HS GLQ+L KT +AS+  LGL +  L + VILFSSA+Y+ E    DS   SIP AFWWA++TM TVGYGD  P    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T +
Sbjct:  333 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDVDSLFPSIPDAFWWAVVTMTTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQ 471          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|Q09081|KCNA2_RABIT (Potassium voltage-gated channel subfamily A member 2 OS=Oryctolagus cuniculus OX=9986 GN=KCNA2 PE=1 SV=2)

HSP 1 Score: 162.925 bits (411), Expect = 3.079e-47
Identity = 78/137 (56.93%), Postives = 99/137 (72.26%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRT 402
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E    DS   SIP AFWWA+++M TVGYGD VP    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T
Sbjct:  285 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|P63142|KCNA2_RAT (Potassium voltage-gated channel subfamily A member 2 OS=Rattus norvegicus OX=10116 GN=Kcna2 PE=1 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 3.567e-47
Identity = 78/137 (56.93%), Postives = 99/137 (72.26%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRT 402
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E    DS   SIP AFWWA+++M TVGYGD VP    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T
Sbjct:  285 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|P63141|KCNA2_MOUSE (Potassium voltage-gated channel subfamily A member 2 OS=Mus musculus OX=10090 GN=Kcna2 PE=1 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 3.567e-47
Identity = 78/137 (56.93%), Postives = 99/137 (72.26%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRT 402
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E    DS   SIP AFWWA+++M TVGYGD VP    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T
Sbjct:  285 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|P17658|KCNA6_HUMAN (Potassium voltage-gated channel subfamily A member 6 OS=Homo sapiens OX=9606 GN=KCNA6 PE=1 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 4.171e-47
Identity = 79/137 (57.66%), Postives = 99/137 (72.26%), Query Frame = 1
Query:    7 SASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNR 408
            + SLA LRVI+L+R   IFKL++HS GLQ+L KT +AS+  LGL +  L + VILFSSA+Y+ E   +DS   SIP AFWWA++TM TVGYGD  P    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T +
Sbjct:  335 AMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDDDSLFPSIPDAFWWAVVTMTTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQ 471          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Match: sp|P17659|KCNA6_RAT (Potassium voltage-gated channel subfamily A member 6 OS=Rattus norvegicus OX=10116 GN=Kcna6 PE=1 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 9.364e-47
Identity = 79/139 (56.83%), Postives = 99/139 (71.22%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNR 408
            + + SLA LRVI+L+R   IFKL++HS GLQ+L KT +AS+  LGL +  L + VILFSSA+Y+ E    DS   SIP AFWWA++TM TVGYGD  P    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T +
Sbjct:  334 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDVDSLFPSIPDAFWWAVVTMTTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQ 472          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: A0A430PX56 (Ion_trans domain-containing protein (Fragment) OS=Schistosoma bovis OX=6184 GN=DC041_0001353 PE=3 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 1.894e-65
Identity = 101/138 (73.19%), Postives = 118/138 (85.51%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNR 414
            KNSASLAFLRVI+LIR+FKLTKHSSGLQVL+ TF+ SIE L LF+VA  + +++FSS +YYVE   + S I+SIP AFWWA+ITMCTVGYGD VP+  LGK+VGS CAVAGVLTLAIPVPIITENFNKFY+H+T R R
Sbjct:  170 KNSASLAFLRVIRLIRVFKLTKHSSGLQVLVLTFKESIEGLSLFLVAFIVCILVFSSTIYYVEIDRKGSQIESIPDAFWWAVITMCTVGYGDKVPKGPLGKVVGSVCAVAGVLTLAIPVPIITENFNKFYAHKTGRGR 307          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: A0A1I8F333 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 9.789e-65
Identity = 101/136 (74.26%), Postives = 120/136 (88.24%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNR 408
            K+SASLAFLRV++LIR+FKLTKHS+ LQVL+ TFRASIE LGLF+VAL + ++LFSS +YYVE+  + S I+SIP AFWWA+ITMCTVGYGD VP+  LGK+VGS CAVAGVLTLAIPVPIITENFNKFY+H+T R
Sbjct:  492 KSSASLAFLRVVRLIRVFKLTKHSADLQVLVLTFRASIEGLGLFLVALIVCILLFSSTIYYVESEVKGSQIESIPDAFWWAVITMCTVGYGDKVPKGPLGKVVGSVCAVAGVLTLAIPVPIITENFNKFYTHKTGR 627          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: A0A267H803 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000942g2 PE=3 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 6.213e-63
Identity = 100/138 (72.46%), Postives = 118/138 (85.51%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNR 414
            K+SASLAFLRV++LIR+FKLTKH  GLQVL+ TFRASIE LGLF+VAL + ++LFSS +YYVE   + S I+SIP AFWWA+ITMCTVGYGD VP+  LG +VGS CA+AGVLTLAIPVPIITENFNKFY+H+T R R
Sbjct:  364 KSSASLAFLRVVRLIRVFKLTKHFDGLQVLVLTFRASIEGLGLFLVALIVCILLFSSTIYYVEAEVKGSQIESIPDAFWWAVITMCTVGYGDKVPKGPLGMVVGSVCAIAGVLTLAIPVPIITENFNKFYTHKTGRGR 501          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: A0A267DW52 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000942g3 PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 8.843e-63
Identity = 100/138 (72.46%), Postives = 118/138 (85.51%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNR 414
            K+SASLAFLRV++LIR+FKLTKH  GLQVL+ TFRASIE LGLF+VAL + ++LFSS +YYVE   + S I+SIP AFWWA+ITMCTVGYGD VP+  LG +VGS CA+AGVLTLAIPVPIITENFNKFY+H+T R R
Sbjct:  364 KSSASLAFLRVVRLIRVFKLTKHFDGLQVLVLTFRASIEGLGLFLVALIVCILLFSSTIYYVEAEVKGSQIESIPDAFWWAVITMCTVGYGDKVPKGPLGMVVGSVCAIAGVLTLAIPVPIITENFNKFYTHKTGRGR 501          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Match: A0A210PGX2 (Potassium voltage-gated channel subfamily A member 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT03312 PE=3 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 1.206e-61
Identity = 96/138 (69.57%), Postives = 119/138 (86.23%), Query Frame = 1
Query:    4 NSASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI 417
            + ASLAFLRV++L+RIFKLTKHS+GLQVL+ TF+ASI+ L LF+VA+ + V+LFSSA+YY E+   D+ IKSIP  FWWA+ITMCTVGYGD VP   LGK++GS CA+AGVLTLAIPVPIITENFNKFY+H+T R+R+
Sbjct:  312 SGASLAFLRVVRLVRIFKLTKHSAGLQVLILTFKASIQGLMLFLVAMVVCVLLFSSAIYYAEHGIPDAQIKSIPDGFWWAVITMCTVGYGDKVPVGPLGKLIGSVCALAGVLTLAIPVPIITENFNKFYAHKTGRSRM 449          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: kcna2a (potassium voltage-gated channel subfamily A member 2 [Source:NCBI gene;Acc:103030675])

HSP 1 Score: 160.999 bits (406), Expect = 1.467e-47
Identity = 77/137 (56.20%), Postives = 99/137 (72.26%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRT 402
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E    +S   SIP AFWWA+++M TVGYGD VP    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T
Sbjct:  280 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESQFYSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 416          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: kcna2b (potassium voltage-gated channel subfamily A member 2 [Source:NCBI gene;Acc:103039676])

HSP 1 Score: 159.458 bits (402), Expect = 4.937e-47
Identity = 78/138 (56.52%), Postives = 99/138 (71.74%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTN 405
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E    DS   SIP AFWWA+++M TVGYGD VP    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T 
Sbjct:  280 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEADSQFVSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE 417          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: ENSAMXT00000014366.2 (potassium voltage-gated channel subfamily A member 3-like [Source:NCBI gene;Acc:103034012])

HSP 1 Score: 159.073 bits (401), Expect = 5.570e-47
Identity = 76/137 (55.47%), Postives = 105/137 (76.64%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRT 402
            ++ +SLA +RVI+L+R   IFKL++HS GLQ+L +TF+AS+  LGL +  L + VILFSSA+Y+ E+ +E S  +SIPHAFWWA++TM TVGYGD  P+   GK+VGS CA+AGVLT+++PVP+I  NF+ FY   T
Sbjct:  289 RSKSSLAIVRVIRLVRVFRIFKLSRHSKGLQILGQTFQASMRELGLLIFFLLIGVILFSSAIYFAESDHEGSSFESIPHAFWWAVVTMTTVGYGDMYPETVWGKMVGSMCAIAGVLTISLPVPVIVSNFSYFYHRAT 425          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:NCBI gene;Acc:103031324])

HSP 1 Score: 158.303 bits (399), Expect = 2.475e-46
Identity = 77/138 (55.80%), Postives = 98/138 (71.01%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTN 405
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E     S   SIP AFWWA++TM TVGYGD  P    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T+
Sbjct:  318 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPASSFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETD 455          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Match: KCNA5 (potassium voltage-gated channel subfamily A member 5 [Source:HGNC Symbol;Acc:HGNC:6224])

HSP 1 Score: 156.762 bits (395), Expect = 9.526e-46
Identity = 76/139 (54.68%), Postives = 101/139 (72.66%), Query Frame = 1
Query:    7 SASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNR 414
            + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+++ E    +S   SIP AFWWA++TM TVGYGD  P    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T++++
Sbjct:  356 AMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVFFAEADEPESHFSSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQDQ 494          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 161.384 bits (407), Expect = 1.780e-48
Identity = 79/141 (56.03%), Postives = 104/141 (73.76%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNR 414
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E  +++S+ +SIP AFWWA++TM TVGYGD  P    GKIVGS CA+AGVLT+A+PVP+I  NFN FY HR   N 
Sbjct:  274 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADHQNSEFRSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFY-HRETDNE 413          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 153.68 bits (387), Expect = 5.313e-46
Identity = 77/136 (56.62%), Postives = 99/136 (72.79%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHR 399
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T RAS+  LGL +  L + VILFSSA+Y+ E    ++   SIP AFWW+++TM TVGYGD  P    GKIVGS CA+AGVLT+A+PVP+I  NFN FY HR
Sbjct:  247 QQTMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLRASMRELGLLIFFLFIGVILFSSAIYFAEVDDPNTHFHSIPEAFWWSLVTMTTVGYGDMFPVTLGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFY-HR 381          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 150.984 bits (380), Expect = 2.299e-44
Identity = 73/138 (52.90%), Postives = 99/138 (71.74%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTN 405
            + + SLA LRVI+L+R   IFKL++HS GLQ+L  T  AS+  LGL +  L + VILFSSA+++ E   + ++ +SIP AFWW+++TM TVGYGD  P+   GKIVGS CA+AGVLT+++PVP+I  NFN FY   T 
Sbjct:  283 QQTMSLAILRVIRLVRVFRIFKLSRHSKGLQILGHTLHASMRELGLLIFFLFIGVILFSSAVFFAEVDSKKTEFQSIPDAFWWSLVTMTTVGYGDMSPKTVGGKIVGSLCAIAGVLTVSLPVPVIVSNFNYFYQRETE 420          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001869.1 (pep scaffold:Pmarinus_7.0:GL480351:152:3521:-1 gene:ENSPMAG00000001700.1 transcript:ENSPMAT00000001869.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.206 bits (365), Expect = 1.537e-43
Identity = 62/129 (48.06%), Postives = 91/129 (70.54%), Query Frame = 1
Query:   28 RVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNR 414
            R+++++RI KL +HS+GLQ L  T R S   LGL ++ L+M +++FSS +++ E   +D+  +SIP +FWWA ITM TVGYGD  PQ  LGKIVG  C +AGVL +A+P+PII  NF++FY  +  + +
Sbjct:  113 RIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFRSIPASFWWATITMTTVGYGDIYPQTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEK 241          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Match: KCNA5 (potassium voltage-gated channel subfamily A member 5 [Source:HGNC Symbol;Acc:HGNC:6224])

HSP 1 Score: 144.436 bits (363), Expect = 3.224e-43
Identity = 69/119 (57.98%), Postives = 85/119 (71.43%), Query Frame = 1
Query:   52 FKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNR 408
            FKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA Y+VE    DS   SIP AFWWA++TM TVGYGD  P    GKIVGS CA+AGVLT+A+PVP+I  NFN FY    +R
Sbjct:  204 FKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAAYFVEADDPDSHFTSIPDAFWWAVVTMTTVGYGDMRPITLGGKIVGSLCAIAGVLTVALPVPVIVSNFNFFYQRERDR 322          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: SHAK4 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHB6])

HSP 1 Score: 152.14 bits (383), Expect = 4.489e-45
Identity = 80/139 (57.55%), Postives = 100/139 (71.94%), Query Frame = 1
Query:    7 SASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNR 414
            ++SL  LRVI+L+R   IFKL++HS GLQ+L  T RAS+  LGL +  L + VILFSSA+YY E   + +  KSIP AFWWA++TM TVGYGD  P    GKIVGS CA++GVLT+A+PVP+I  NFN FY HR N  R
Sbjct:  294 ASSLGVLRVIRLVRVFRIFKLSRHSRGLQILGHTLRASLRELGLLIFFLLIGVILFSSAVYYAEGGEKGTHFKSIPDAFWWAVVTMTTVGYGDMRPITVWGKIVGSLCAISGVLTIALPVPVIVSNFNYFY-HRENEQR 431          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: SHAK6 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFM4])

HSP 1 Score: 147.517 bits (371), Expect = 7.593e-44
Identity = 72/133 (54.14%), Postives = 96/133 (72.18%), Query Frame = 1
Query:   10 ASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTY-EDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSH 396
            +SLA LR ++L+R   IFKL+++S GLQ+L  T +AS+  LGL    L + VILFSSA+YY E  Y  D++  SIPH+FWW+IITM TVGYGD  P+   GK+VG FCA++GVL +A+PVP+I  NF  +YS 
Sbjct:  239 SSLAILRCVRLVRVFRIFKLSRYSRGLQILGHTLKASLRELGLLFFFLCVGVILFSSAVYYAEYNYNRDTEFLSIPHSFWWSIITMTTVGYGDMAPKTLGGKLVGCFCAISGVLAIALPVPVIVSNFAYYYSR 371          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: SHAK3 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK45])

HSP 1 Score: 147.902 bits (372), Expect = 8.418e-44
Identity = 74/132 (56.06%), Postives = 91/132 (68.94%), Query Frame = 1
Query:   13 SLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHR 399
            SLA LRVI+L+R   IFKL++HS GLQVL  T RAS   L + +  L + V+LFSSA+YY E     S   SIP AFWWA++TM TVGYGD  P    GK+VGS CA++GVLT+A+PVP+I  NFN FY   
Sbjct:  247 SLAVLRVIRLVRVFRIFKLSRHSRGLQVLGHTLRASSRELAMLIFFLLISVVLFSSAVYYAEEEEAASKFSSIPDAFWWAVVTMTTVGYGDMYPVTPWGKLVGSICAISGVLTIALPVPVIVSNFNYFYKRE 378          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: SHAK5 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAS8])

HSP 1 Score: 141.354 bits (355), Expect = 2.242e-41
Identity = 69/132 (52.27%), Postives = 94/132 (71.21%), Query Frame = 1
Query:   13 SLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDI-KSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSH 396
            SLAFLR+++L+R   IFKL++HSSGLQ+L  T R S+  LGL +  L + V++FSS  YY E   +D+ + +SIP  FWWA++TM TVGYGD VP+   GK+VGS CA+ GVL +A+PVP+I  NF+  Y  
Sbjct:  249 SLAFLRILRLVRVFRIFKLSRHSSGLQILGLTLRKSLRELGLLIFFLFIGVVIFSSMAYYAEAGTKDTHLGRSIPDTFWWALVTMTTVGYGDLVPKTLWGKLVGSCCALCGVLAIALPVPVIVSNFDAIYKK 380          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Match: EDO39804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8W8])

HSP 1 Score: 141.739 bits (356), Expect = 3.406e-41
Identity = 68/141 (48.23%), Postives = 97/141 (68.79%), Query Frame = 1
Query:    4 NSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI 417
            N  ++  LRV++LIR   IFKL++HS GLQ+L  T R+S   L L V  L++ V++FSS ++Y E   + +   +IPH FWWA++TM T+GYGD VP  + G+IVGS CAV GVL +A+PVP+I  NF+ +YSH   R ++
Sbjct:  273 NFKTIVVLRVVRLIRVFRIFKLSRHSYGLQILGHTLRSSCSELFLLVFFLTIGVVIFSSVIFYAEKDTKGTHFTTIPHTFWWAVVTMTTLGYGDMVPITWQGQIVGSLCAVCGVLMIALPVPVIVSNFSLYYSHAKARMKL 413          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: ENSORLT00000004658.2 (pep primary_assembly:ASM223467v1:6:13425755:13435070:-1 gene:ENSORLG00000003738.2 transcript:ENSORLT00000004658.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.229 bits (404), Expect = 1.327e-47
Identity = 81/150 (54.00%), Postives = 104/150 (69.33%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI*FNKSH*H 441
            + +ASLA LRVI+L+R   IFKL++HS GLQ+L +T RAS+  LGL +  L + V+LFSS++Y+ E    +S+  SIP AFWWA++TM TVGYGD  P    GK VGS CA+AGVLT+A+PVP+I  NFN FY HR N      N  H H
Sbjct:  275 QQAASLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLRASLRELGLLIFFLIIGVVLFSSSVYFAEVEDPNSEFSSIPDAFWWAVVTMTTVGYGDMCPTTIGGKFVGSLCAIAGVLTIALPVPVIVSNFNYFY-HRENEEEE--NVQHVH 421          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: KCNA5 (potassium voltage-gated channel subfamily A member 1-like [Source:NCBI gene;Acc:105353871])

HSP 1 Score: 162.54 bits (410), Expect = 3.894e-47
Identity = 77/141 (54.61%), Postives = 102/141 (72.34%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNR 414
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E    +S   SIP AFWWA++TM TVGYGD  P    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T++++
Sbjct:  496 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESHFSSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQDQ 636          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: kcna2a (potassium voltage-gated channel, shaker-related subfamily, member 2a [Source:ZFIN;Acc:ZDB-GENE-131113-1])

HSP 1 Score: 159.073 bits (401), Expect = 5.054e-47
Identity = 77/138 (55.80%), Postives = 100/138 (72.46%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTN 405
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E    +S  +SIP AFWWA+++M TVGYGD VP    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T 
Sbjct:  282 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEPESQFESIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE 419          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: ENSORLT00000010657.2 (potassium voltage-gated channel subfamily A member 2 [Source:NCBI gene;Acc:101157775])

HSP 1 Score: 158.688 bits (400), Expect = 9.759e-47
Identity = 77/138 (55.80%), Postives = 99/138 (71.74%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTN 405
            + + SLA LRVI+L+R   IFKL++HS GLQ+L +T +AS+  LGL +  L + VILFSSA+Y+ E   + S   SIP AFWWA+++M TVGYGD VP    GKIVGS CA+AGVLT+A+PVP+I  NFN FY   T 
Sbjct:  281 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADEKQSQFSSIPEAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE 418          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Match: ENSORLT00000025729.2 (shaker-related potassium channel tsha2 [Source:NCBI gene;Acc:101167693])

HSP 1 Score: 157.918 bits (398), Expect = 1.280e-46
Identity = 80/148 (54.05%), Postives = 102/148 (68.92%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI*FNKSH 435
            + + SLA LRVI+L+R   IFKL++HS GLQ+L KT +AS+  LGL +  L + VILFSSA+Y+ E     S   SIP AFWWA+++M TVGYGD  P    GKIVGS CA+AGVLT+A+PVP+I  NFN FY HR   +   F  +H
Sbjct:  280 QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAETDDPHSGFSSIPDAFWWAVVSMTTVGYGDMCPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFY-HRETEHEEQFQYTH 426          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000014198.1 (SMESG000014198.1)

HSP 1 Score: 284.648 bits (727), Expect = 1.440e-96
Identity = 139/139 (100.00%), Postives = 139/139 (100.00%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI 417
            KNSASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI
Sbjct:  276 KNSASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI 414          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000014206.1 (SMESG000014206.1)

HSP 1 Score: 284.648 bits (727), Expect = 1.850e-96
Identity = 139/139 (100.00%), Postives = 139/139 (100.00%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI 417
            KNSASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI
Sbjct:  276 KNSASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI 414          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000013562.1 (SMESG000013562.1)

HSP 1 Score: 221.861 bits (564), Expect = 2.740e-71
Identity = 108/138 (78.26%), Postives = 119/138 (86.23%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNR 414
            K SASLAFLRVI+LIR+FKLTKHS GLQVL+ TFRASIE LGLF+VALS+ +ILFSS +YY E    DS I+SIP AFWWAIITMCTVGYGD VPQ  LGK+VGS CAV+GVLTLAIPVPIITENFNKFYSH+T R R
Sbjct:  332 KKSASLAFLRVIRLIRVFKLTKHSPGLQVLMLTFRASIEGLGLFLVALSVSIILFSSTIYYAEVGNPDSQIESIPDAFWWAIITMCTVGYGDKVPQQILGKLVGSVCAVSGVLTLAIPVPIITENFNKFYSHKTGRLR 469          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000006565.1 (SMESG000006565.1)

HSP 1 Score: 202.216 bits (513), Expect = 3.703e-64
Identity = 94/139 (67.63%), Postives = 118/139 (84.89%), Query Frame = 1
Query:    1 KNSASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI 417
            K  +SLA LRVI+LIRIFKLTKHS+GLQVL+ TF+AS+  LG+F++A+ + ++LFSS +YY+E   +DSDI SIP AFWW +ITMCTVGYGD VP+  +G+IVGSFCAV+GVLTLA+ VPII+ENFNKFYSH+T R RI
Sbjct:  280 KGGSSLAILRVIRLIRIFKLTKHSTGLQVLILTFQASLNGLGIFLLAMLVSMLLFSSTIYYLEVDVKDSDIASIPDAFWWCVITMCTVGYGDMVPKSLMGRIVGSFCAVSGVLTLAMAVPIISENFNKFYSHKTGRGRI 418          
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Match: SMESG000079731.1 (SMESG000079731.1)

HSP 1 Score: 159.073 bits (401), Expect = 4.147e-47
Identity = 77/138 (55.80%), Postives = 100/138 (72.46%), Query Frame = 1
Query:    7 SASLAFLRVIKLIR---IFKLTKHSSGLQVLLKTFRASIESLGLFVVALSMLVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLGKIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRN 411
            + SLA LR+I+L+R   IFKL++HS GLQ+L +T RAS+E L +    L + VILFSSA+Y+VE   E S  +SIP  FWWA++TM TVGYGD +P    GK++GS CA+AGVLT+A+PVP+I  NFN FY HR   N
Sbjct:  295 TTSLAILRIIRLVRVFRIFKLSRHSKGLQILGQTLRASVEELTMLTFFLLICVILFSSAVYFVEADTETSLFRSIPDGFWWAVVTMTTVGYGDMMPVTVFGKLIGSLCAIAGVLTIALPVPVIVSNFNYFY-HREMEN 431          
The following BLAST results are available for this feature:
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNA21.807e-4955.80potassium voltage-gated channel subfamily A member... [more]
KCNA22.226e-4855.80potassium voltage-gated channel subfamily A member... [more]
GALNT88.685e-4857.66polypeptide N-acetylgalactosaminyltransferase 8 [S... [more]
KCNA68.685e-4857.66potassium voltage-gated channel subfamily A member... [more]
KCNA29.818e-4855.80potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shw-16.570e-4046.43SHaW family of potassium channels [Source:UniProt... [more]
shw-34.049e-3949.64SHaW family of potassium channels [Source:UniProt... [more]
shw-34.685e-3949.64SHaW family of potassium channels [Source:UniProt... [more]
shw-35.499e-3949.64SHaW family of potassium channels [Source:UniProt... [more]
shw-13.632e-3844.53SHaW family of potassium channels [Source:UniProt... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sh2.223e-4754.93gene:FBgn0003380 transcript:FBtr0089660[more]
Sh2.553e-4755.32gene:FBgn0003380 transcript:FBtr0346703[more]
Sh2.553e-4755.32gene:FBgn0003380 transcript:FBtr0089658[more]
Sh2.982e-4754.93gene:FBgn0003380 transcript:FBtr0346705[more]
Sh8.405e-4755.32gene:FBgn0003380 transcript:FBtr0089657[more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcna2a2.182e-4756.20potassium voltage-gated channel, shaker-related su... [more]
kcna2a2.182e-4756.20potassium voltage-gated channel, shaker-related su... [more]
kcna2b3.653e-4756.52potassium voltage-gated channel, shaker-related su... [more]
CABZ01113981.17.210e-4755.32pep scaffold:GRCz11:KN150008.1:12653:14179:-1 gene... [more]
kcna1b8.542e-4757.04potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNA24.110e-4856.93potassium channel, voltage gated shaker related su... [more]
ENSXETT00000049277.12.470e-4755.80potassium channel, voltage gated shaker related su... [more]
fastkd31.850e-4654.35FAST kinase domains 3 [Source:Xenbase;Acc:XB-GENE-... [more]
KCNA12.011e-4655.47potassium channel, voltage gated shaker related su... [more]
fastkd35.824e-4654.35FAST kinase domains 3 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcna25.100e-4856.93potassium voltage-gated channel, shaker-related su... [more]
Kcna25.100e-4856.93potassium voltage-gated channel, shaker-related su... [more]
Kcna25.100e-4856.93potassium voltage-gated channel, shaker-related su... [more]
Kcna61.347e-4756.83potassium voltage-gated channel, shaker-related, s... [more]
Kcna61.347e-4756.83potassium voltage-gated channel, shaker-related, s... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q09081|KCNA2_RABIT3.079e-4756.93Potassium voltage-gated channel subfamily A member... [more]
sp|P63142|KCNA2_RAT3.567e-4756.93Potassium voltage-gated channel subfamily A member... [more]
sp|P63141|KCNA2_MOUSE3.567e-4756.93Potassium voltage-gated channel subfamily A member... [more]
sp|P17658|KCNA6_HUMAN4.171e-4757.66Potassium voltage-gated channel subfamily A member... [more]
sp|P17659|KCNA6_RAT9.364e-4756.83Potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430PX561.894e-6573.19Ion_trans domain-containing protein (Fragment) OS=... [more]
A0A1I8F3339.789e-6574.26Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H8036.213e-6372.46BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A267DW528.843e-6372.46BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A210PGX21.206e-6169.57Potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcna2a1.467e-4756.20potassium voltage-gated channel subfamily A member... [more]
kcna2b4.937e-4756.52potassium voltage-gated channel subfamily A member... [more]
ENSAMXT00000014366.25.570e-4755.47potassium voltage-gated channel subfamily A member... [more]
KCNA32.475e-4655.80potassium voltage-gated channel subfamily A member... [more]
KCNA59.526e-4654.68potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNA31.780e-4856.03potassium voltage-gated channel subfamily A member... [more]
KCNA35.313e-4656.62potassium voltage-gated channel subfamily A member... [more]
KCNA32.299e-4452.90potassium voltage-gated channel subfamily A member... [more]
ENSPMAT00000001869.11.537e-4348.06pep scaffold:Pmarinus_7.0:GL480351:152:3521:-1 gen... [more]
KCNA53.224e-4357.98potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
SHAK44.489e-4557.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK67.593e-4454.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK38.418e-4456.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK52.242e-4152.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398043.406e-4148.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000004658.21.327e-4754.00pep primary_assembly:ASM223467v1:6:13425755:134350... [more]
KCNA53.894e-4754.61potassium voltage-gated channel subfamily A member... [more]
kcna2a5.054e-4755.80potassium voltage-gated channel, shaker-related su... [more]
ENSORLT00000010657.29.759e-4755.80potassium voltage-gated channel subfamily A member... [more]
ENSORLT00000025729.21.280e-4654.05shaker-related potassium channel tsha2 [Source:NCB... [more]
back to top
BLAST of Potassium voltage-gated channel subfamily A member 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014198.11.440e-96100.00SMESG000014198.1[more]
SMESG000014206.11.850e-96100.00SMESG000014206.1[more]
SMESG000013562.12.740e-7178.26SMESG000013562.1[more]
SMESG000006565.13.703e-6467.63SMESG000006565.1[more]
SMESG000079731.14.147e-4755.80SMESG000079731.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034352 ID=SMED30034352|Name=Potassium voltage-gated channel subfamily A member 2|organism=Schmidtea mediterranea sexual|type=transcript|length=456bp
AAAAATAGCGCATCATTAGCGTTTTTGAGAGTAATCAAACTGATAAGGAT
ATTCAAATTGACAAAACACTCATCGGGATTACAAGTTCTTCTGAAAACAT
TTCGCGCAAGCATTGAAAGTCTGGGATTATTTGTGGTTGCTTTATCAATG
CTGGTGATATTGTTTTCATCCGCTCTTTATTACGTGGAGAATACTTACGA
GGATTCTGATATCAAAAGTATACCACATGCGTTTTGGTGGGCCATAATTA
CGATGTGTACCGTTGGCTATGGAGATGCTGTGCCTCAACATTTCCTAGGG
AAAATAGTTGGAAGCTTTTGTGCAGTTGCTGGAGTTTTGACACTTGCAAT
TCCAGTGCCAATTATTACTGAAAACTTCAATAAATTCTATTCTCATAGAA
CTAATAGAAATAGAATTTAATTTAATAAATCTCATTAGCATCGTCCCATT
TCAACC
back to top

protein sequence of SMED30034352-orf-1

>SMED30034352-orf-1 ID=SMED30034352-orf-1|Name=SMED30034352-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=140bp
KNSASLAFLRVIKLIRIFKLTKHSSGLQVLLKTFRASIESLGLFVVALSM
LVILFSSALYYVENTYEDSDIKSIPHAFWWAIITMCTVGYGDAVPQHFLG
KIVGSFCAVAGVLTLAIPVPIITENFNKFYSHRTNRNRI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000105secretory cell
PLANA:0000143ventral region of the whole animal
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0000481serotonergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR028325VG_K_chnl
IPR003968K_chnl_volt-dep_Kv
IPR005821Ion_trans_dom
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005267potassium channel activity
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0006810transport
GO:0034765regulation of ion transmembrane transport
GO:0051260protein homooligomerization
GO:0071805potassium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003968Potassium channel, voltage dependent, KvPRINTSPR01491KVCHANNELcoord: 40..54
score: 34.5
coord: 16..24
score: 69.91
coord: 111..122
score: 68.19
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 100..126
score: 61.82
coord: 40..63
score: 41.37
coord: 71..93
score: 64.9
coord: 11..37
score: 49.18
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 1..130
e-value: 9.7E-43
score: 148.2
NoneNo IPR availablePANTHERPTHR11537:SF113POTASSIUM VOLTAGE-GATED CHANNEL PROTEIN SHAKERcoord: 2..137
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 5..128
NoneNo IPR availableTMHMMTMhelixcoord: 40..62
NoneNo IPR availableTMHMMTMhelixcoord: 101..123
NoneNo IPR availableTMHMMTMhelixcoord: 77..94
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 4..133
e-value: 5.2E-27
score: 94.6
IPR028325Voltage-gated potassium channelPANTHERPTHR11537VOLTAGE-GATED POTASSIUM CHANNELcoord: 2..137