Calcium/calmodulin-dependent protein kinase I

Overview
NameCalcium/calmodulin-dependent protein kinase I
Smed IDSMED30034348
Length (bp)2365
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium/calmodulin-dependent protein kinase I (SMED30034348) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium/calmodulin-dependent protein kinase I (SMED30034348) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium/calmodulin-dependent protein kinase I (SMED30034348) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium/calmodulin-dependent protein kinase I (SMED30034348) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034348

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30034348SMESG000078937.1 SmedASXL_019418SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30034348SMESG000078937.1 dd_Smed_v4_5783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30034348SMESG000078937.1 dd_Smed_v4_5783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30034348SMESG000078937.1 dd_Smed_v4_5783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30034348SMESG000078937.1 dd_Smed_v6_5783_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30034348SMESG000078937.1 OX_Smed_1.0.21549ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30034348SMESG000078937.1 dd_Smed_v4_5783_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Human
Match: CAMK1 (calcium/calmodulin dependent protein kinase I [Source:HGNC Symbol;Acc:HGNC:1459])

HSP 1 Score: 276.944 bits (707), Expect = 2.507e-85
Identity = 126/185 (68.11%), Postives = 159/185 (85.95%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS D+DSKIMISDFGLSKM+D  S ++TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI+HLMEK+P+KR++C+++L HPWI+ +TALDKNI++SVS QIKKNF A  +WK+A+NA  V+  +++LQ+ 
Sbjct:  142 LKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNF-AKSKWKQAFNATAVVRHMRKLQLG 322          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Human
Match: CAMK1D (calcium/calmodulin dependent protein kinase ID [Source:HGNC Symbol;Acc:HGNC:19341])

HSP 1 Score: 266.929 bits (681), Expect = 1.480e-82
Identity = 121/185 (65.41%), Postives = 155/185 (83.78%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS D++SKIMISDFGLSKM+     M+TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI++LMEK+P KRY+C+++  HPWI+ +TAL+KNI+ESVSAQI+KNF A  +W++A+NA  V+  +++L + 
Sbjct:   51 LKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKNF-AKSKWRQAFNATAVVRHMRKLHLG 231          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Human
Match: CAMK1D (calcium/calmodulin dependent protein kinase ID [Source:HGNC Symbol;Acc:HGNC:19341])

HSP 1 Score: 268.47 bits (685), Expect = 2.486e-82
Identity = 121/185 (65.41%), Postives = 155/185 (83.78%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS D++SKIMISDFGLSKM+     M+TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI++LMEK+P KRY+C+++  HPWI+ +TAL+KNI+ESVSAQI+KNF A  +W++A+NA  V+  +++L + 
Sbjct:  145 LKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKNF-AKSKWRQAFNATAVVRHMRKLHLG 325          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Human
Match: CAMK1D (calcium/calmodulin dependent protein kinase ID [Source:HGNC Symbol;Acc:HGNC:19341])

HSP 1 Score: 268.855 bits (686), Expect = 4.718e-82
Identity = 121/185 (65.41%), Postives = 155/185 (83.78%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS D++SKIMISDFGLSKM+     M+TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI++LMEK+P KRY+C+++  HPWI+ +TAL+KNI+ESVSAQI+KNF A  +W++A+NA  V+  +++L + 
Sbjct:  145 LKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKNF-AKSKWRQAFNATAVVRHMRKLHLG 325          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Human
Match: CAMK1 (calcium/calmodulin dependent protein kinase I [Source:HGNC Symbol;Acc:HGNC:1459])

HSP 1 Score: 258.455 bits (659), Expect = 7.051e-80
Identity = 117/172 (68.02%), Postives = 148/172 (86.05%), Query Frame = 1
Query: 1402 DSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
            DSKIMISDFGLSKM+D  S ++TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI+HLMEK+P+KR++C+++L HPWI+ +TALDKNI++SVS QIKKNF A  +WK+A+NA  V+  +++LQ+ 
Sbjct:    2 DSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNF-AKSKWKQAFNATAVVRHMRKLQLG 169          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Celegans
Match: cmk-1 (Calcium/calmodulin-dependent protein kinase type 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXJ0])

HSP 1 Score: 250.751 bits (639), Expect = 3.708e-76
Identity = 118/198 (59.60%), Postives = 154/198 (77.78%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESAISKQ 1956
             +PENLLYY+ D+DSKIMISDFGLSK +D+   MATACGTPGYVAPEVL+    + YGK VD W++GVIAYILLCGYPPFYDE+D  LF QI + +YEFD+PYWD+ISDSAKDFI HLM  +P+ R++C+++L+HPWIS NTA   +I+ +V+  +KK+ LA R WKKAYNAA  +  L+ L+++  +N  +   S+Q
Sbjct:  145 LKPENLLYYNQDEDSKIMISDFGLSKTEDS-GVMATACGTPGYVAPEVLQ---QKPYGKAVDVWSIGVIAYILLCGYPPFYDESDANLFAQIIKGEYEFDAPYWDQISDSAKDFITHLMCCDPEARFTCQDALSHPWISGNTAYTHDIHGTVAVHLKKS-LAKRNWKKAYNAAAAIRQLQMLRLSSNSNRLQKQASQQ 337          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 135.961 bits (341), Expect = 1.059e-34
Identity = 78/213 (36.62%), Postives = 111/213 (52.11%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMT---------LLKRLQVNKENNHSESAISKQTR*KND 1974
             +PENLL  S    + + ++DFGL+   +   A     GTPGY++PEVL+ +    Y K VD WA GVI YILL GYPPF+DE+   L+ QIK   Y++ SP WD ++  AK  I  ++  NPKKR +  ++L  PWI +   +   I+   +    K F A R+ K A     + T         LL + +    +   ES+ S QT   ND
Sbjct:  135 LKPENLLLASKAKGAAVKLADFGLAIEVNDSEAWHGFAGTPGYLSPEVLKKDP---YSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKGAILTTMIATRNLSNLGRNLLNKKEQGPPSTIKESSESSQTIDDND 344          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 135.961 bits (341), Expect = 1.059e-34
Identity = 78/213 (36.62%), Postives = 111/213 (52.11%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMT---------LLKRLQVNKENNHSESAISKQTR*KND 1974
             +PENLL  S    + + ++DFGL+   +   A     GTPGY++PEVL+ +    Y K VD WA GVI YILL GYPPF+DE+   L+ QIK   Y++ SP WD ++  AK  I  ++  NPKKR +  ++L  PWI +   +   I+   +    K F A R+ K A     + T         LL + +    +   ES+ S QT   ND
Sbjct:  135 LKPENLLLASKAKGAAVKLADFGLAIEVNDSEAWHGFAGTPGYLSPEVLKKDP---YSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKGAILTTMIATRNLSNLGRNLLNKKEQGPPSTIKESSESSQTIDDND 344          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 135.961 bits (341), Expect = 1.059e-34
Identity = 78/213 (36.62%), Postives = 111/213 (52.11%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMT---------LLKRLQVNKENNHSESAISKQTR*KND 1974
             +PENLL  S    + + ++DFGL+   +   A     GTPGY++PEVL+ +    Y K VD WA GVI YILL GYPPF+DE+   L+ QIK   Y++ SP WD ++  AK  I  ++  NPKKR +  ++L  PWI +   +   I+   +    K F A R+ K A     + T         LL + +    +   ES+ S QT   ND
Sbjct:  135 LKPENLLLASKAKGAAVKLADFGLAIEVNDSEAWHGFAGTPGYLSPEVLKKDP---YSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKGAILTTMIATRNLSNLGRNLLNKKEQGPPSTIKESSESSQTIDDND 344          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 136.732 bits (343), Expect = 9.029e-34
Identity = 78/211 (36.97%), Postives = 111/211 (52.61%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMT-------LLKRLQVNKENNHSESAISKQTR*KND 1974
             +PENLL  S    + + ++DFGL+   +   A     GTPGY++PEVL+ +    Y K VD WA GVI YILL GYPPF+DE+   L+ QIK   Y++ SP WD ++  AK  I  ++  NPKKR +  ++L  PWI +   +   I+   +    K F A R+ K A     + T       LL + +    +   ES+ S QT   ND
Sbjct:  135 LKPENLLLASKAKGAAVKLADFGLAIEVNDSEAWHGFAGTPGYLSPEVLKKDP---YSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKGAILTTMIATRNLSSRNLLNKKEQGPPSTIKESSESSQTIDDND 342          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0089063)

HSP 1 Score: 258.07 bits (658), Expect = 1.018e-79
Identity = 123/189 (65.08%), Postives = 150/189 (79.37%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENN 1929
             +PENLLYYSPDDDSKIMISDFGLSKM+D+   MATACGTPGYVAPEVL   + + YGK VD W++GVI+YILLCGYPPFYDEND  LF QI +  +EFDSPYWDEIS+SAK FIK+LM    +KRY+CK++L H WIS N A  +NI+ +VS Q+KKNF A  RWK+AY AATV+  ++R+ +N  +N
Sbjct:   48 LKPENLLYYSPDDDSKIMISDFGLSKMEDS-GIMATACGTPGYVAPEVL---AQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNF-AKSRWKQAYYAATVIRQMQRMALNSNSN 231          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0333670)

HSP 1 Score: 259.225 bits (661), Expect = 1.159e-78
Identity = 123/189 (65.08%), Postives = 150/189 (79.37%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENN 1929
             +PENLLYYSPDDDSKIMISDFGLSKM+D+   MATACGTPGYVAPEVL   + + YGK VD W++GVI+YILLCGYPPFYDEND  LF QI +  +EFDSPYWDEIS+SAK FIK+LM    +KRY+CK++L H WIS N A  +NI+ +VS Q+KKNF A  RWK+AY AATV+  ++R+ +N  +N
Sbjct:  154 LKPENLLYYSPDDDSKIMISDFGLSKMEDS-GIMATACGTPGYVAPEVL---AQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNF-AKSRWKQAYYAATVIRQMQRMALNSNSN 337          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0089067)

HSP 1 Score: 259.225 bits (661), Expect = 1.931e-78
Identity = 123/189 (65.08%), Postives = 150/189 (79.37%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENN 1929
             +PENLLYYSPDDDSKIMISDFGLSKM+D+   MATACGTPGYVAPEVL   + + YGK VD W++GVI+YILLCGYPPFYDEND  LF QI +  +EFDSPYWDEIS+SAK FIK+LM    +KRY+CK++L H WIS N A  +NI+ +VS Q+KKNF A  RWK+AY AATV+  ++R+ +N  +N
Sbjct:  169 LKPENLLYYSPDDDSKIMISDFGLSKMEDS-GIMATACGTPGYVAPEVL---AQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNF-AKSRWKQAYYAATVIRQMQRMALNSNSN 352          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0089065)

HSP 1 Score: 259.225 bits (661), Expect = 1.931e-78
Identity = 123/189 (65.08%), Postives = 150/189 (79.37%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENN 1929
             +PENLLYYSPDDDSKIMISDFGLSKM+D+   MATACGTPGYVAPEVL   + + YGK VD W++GVI+YILLCGYPPFYDEND  LF QI +  +EFDSPYWDEIS+SAK FIK+LM    +KRY+CK++L H WIS N A  +NI+ +VS Q+KKNF A  RWK+AY AATV+  ++R+ +N  +N
Sbjct:  169 LKPENLLYYSPDDDSKIMISDFGLSKMEDS-GIMATACGTPGYVAPEVL---AQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNF-AKSRWKQAYYAATVIRQMQRMALNSNSN 352          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0089069)

HSP 1 Score: 259.225 bits (661), Expect = 1.931e-78
Identity = 123/189 (65.08%), Postives = 150/189 (79.37%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENN 1929
             +PENLLYYSPDDDSKIMISDFGLSKM+D+   MATACGTPGYVAPEVL   + + YGK VD W++GVI+YILLCGYPPFYDEND  LF QI +  +EFDSPYWDEIS+SAK FIK+LM    +KRY+CK++L H WIS N A  +NI+ +VS Q+KKNF A  RWK+AY AATV+  ++R+ +N  +N
Sbjct:  169 LKPENLLYYSPDDDSKIMISDFGLSKMEDS-GIMATACGTPGYVAPEVL---AQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNF-AKSRWKQAYYAATVIRQMQRMALNSNSN 352          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Zebrafish
Match: camk1a (calcium/calmodulin-dependent protein kinase Ia [Source:ZFIN;Acc:ZDB-GENE-131120-147])

HSP 1 Score: 277.715 bits (709), Expect = 9.801e-86
Identity = 127/185 (68.65%), Postives = 158/185 (85.41%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS ++DS IMISDFGLSK++D+ S M+TACGTPGYVAPEVL   + + Y K VDCW++GVI+YILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI HLMEK+P  RY+C+++L HPWIS +TALDKNI+ESVSAQIKKNF A  +WK+A+NA  V+  ++RLQ++
Sbjct:  143 LKPENLLYYSMEEDSNIMISDFGLSKIEDSGSVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVISYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFISHLMEKDPSLRYTCEQALLHPWISGDTALDKNIHESVSAQIKKNF-AKSKWKQAFNATAVVRHMRRLQLS 323          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Zebrafish
Match: camk1a (calcium/calmodulin-dependent protein kinase Ia [Source:ZFIN;Acc:ZDB-GENE-131120-147])

HSP 1 Score: 276.559 bits (706), Expect = 3.753e-85
Identity = 127/185 (68.65%), Postives = 158/185 (85.41%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS ++DS IMISDFGLSK++D+ S M+TACGTPGYVAPEVL   + + Y K VDCW++GVI+YILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI HLMEK+P  RY+C+++L HPWIS +TALDKNI+ESVSAQIKKNF A  +WK+A+NA  V+  ++RLQ++
Sbjct:  143 LKPENLLYYSMEEDSNIMISDFGLSKIEDSGSVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVISYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFISHLMEKDPSLRYTCEQALLHPWISGDTALDKNIHESVSAQIKKNF-AKSKWKQAFNATAVVRHMRRLQLS 323          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Zebrafish
Match: camk1a (calcium/calmodulin-dependent protein kinase Ia [Source:ZFIN;Acc:ZDB-GENE-131120-147])

HSP 1 Score: 276.559 bits (706), Expect = 3.753e-85
Identity = 127/185 (68.65%), Postives = 158/185 (85.41%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS ++DS IMISDFGLSK++D+ S M+TACGTPGYVAPEVL   + + Y K VDCW++GVI+YILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI HLMEK+P  RY+C+++L HPWIS +TALDKNI+ESVSAQIKKNF A  +WK+A+NA  V+  ++RLQ++
Sbjct:  143 LKPENLLYYSMEEDSNIMISDFGLSKIEDSGSVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVISYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFISHLMEKDPSLRYTCEQALLHPWISGDTALDKNIHESVSAQIKKNF-AKSKWKQAFNATAVVRHMRRLQLS 323          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Zebrafish
Match: camk1b (calcium/calmodulin-dependent protein kinase Ib [Source:ZFIN;Acc:ZDB-GENE-141014-1])

HSP 1 Score: 276.559 bits (706), Expect = 3.850e-85
Identity = 127/185 (68.65%), Postives = 157/185 (84.86%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS D++SKIMISDFGLSK++ + S M+TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI  A+YEFDSPYWD+ISDSAKDFI HLMEK+P +RY+C+++L HPWI+ +TALDKNI+ESVSAQIKKNF A  +WK+A+NA  V+  ++RLQ+ 
Sbjct:  143 LKPENLLYYSMDEESKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILRAEYEFDSPYWDDISDSAKDFIVHLMEKDPNQRYTCEQALQHPWIAGDTALDKNIHESVSAQIKKNF-AKSKWKQAFNATAVVRHMRRLQLG 323          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Zebrafish
Match: camk1db (calcium/calmodulin-dependent protein kinase 1Db [Source:ZFIN;Acc:ZDB-GENE-070112-1872])

HSP 1 Score: 267.314 bits (682), Expect = 7.613e-82
Identity = 132/235 (56.17%), Postives = 174/235 (74.04%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDA-DSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESAISKQTR*KNDFPVILNVNFTRCIITSMKENDITEYSYIYL 2064
             +PENLLY++P ++SKIMISDFGLSKM+ A +  M+TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI +LM+K+P+KR++C E+L HPWI+ +TAL KNI+ESVS Q+KKNF A  +W++A+NA  V+  ++RLQ+        S  S Q R +N  P  +        ++S+  ND  E   I++
Sbjct:  146 LKPENLLYFNPHEESKIMISDFGLSKMEGAANDIMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFINNLMQKDPEKRFTCDEALRHPWIAGDTALCKNIHESVSRQMKKNF-AKAKWRQAFNATAVIRHMRRLQLGS------SMDSSQHRKQN--PTSMPGKSQSVDVSSVHRNDSLEEGVIFV 368          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Xenopus
Match: dnz1 (DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbase;Acc:XB-GENE-5747351])

HSP 1 Score: 275.404 bits (703), Expect = 4.458e-85
Identity = 126/185 (68.11%), Postives = 156/185 (84.32%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS D+DSKIMISDFGLSK++ + S M+TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI+HLMEK+P KR +C ++L HPWI+ +TALDKNI+ESVS QI+KNF A  RWK+A+NA  V+  +++LQ+ 
Sbjct:  136 LKPENLLYYSIDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIQHLMEKDPNKRNTCDQALQHPWIAGDTALDKNIHESVSEQIRKNF-AKSRWKQAFNATAVVRHMRKLQLG 316          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Xenopus
Match: dnz1 (DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbase;Acc:XB-GENE-5747351])

HSP 1 Score: 275.789 bits (704), Expect = 5.302e-85
Identity = 126/185 (68.11%), Postives = 156/185 (84.32%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS D+DSKIMISDFGLSK++ + S M+TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI+HLMEK+P KR +C ++L HPWI+ +TALDKNI+ESVS QI+KNF A  RWK+A+NA  V+  +++LQ+ 
Sbjct:  151 LKPENLLYYSIDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIQHLMEKDPNKRNTCDQALQHPWIAGDTALDKNIHESVSEQIRKNF-AKSRWKQAFNATAVVRHMRKLQLG 331          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Xenopus
Match: dnz1 (DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbase;Acc:XB-GENE-5747351])

HSP 1 Score: 274.633 bits (701), Expect = 6.932e-85
Identity = 126/185 (68.11%), Postives = 156/185 (84.32%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS D+DSKIMISDFGLSK++ + S M+TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI+HLMEK+P KR +C ++L HPWI+ +TALDKNI+ESVS QI+KNF A  RWK+A+NA  V+  +++LQ+ 
Sbjct:  127 LKPENLLYYSIDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIQHLMEKDPNKRNTCDQALQHPWIAGDTALDKNIHESVSEQIRKNF-AKSRWKQAFNATAVVRHMRKLQLG 307          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Xenopus
Match: dnz1 (DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbase;Acc:XB-GENE-5747351])

HSP 1 Score: 273.863 bits (699), Expect = 1.689e-84
Identity = 126/185 (68.11%), Postives = 156/185 (84.32%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS D+DSKIMISDFGLSK++ + S M+TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI+HLMEK+P KR +C ++L HPWI+ +TALDKNI+ESVS QI+KNF A  RWK+A+NA  V+  +++LQ+ 
Sbjct:  143 LKPENLLYYSIDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIQHLMEKDPNKRNTCDQALQHPWIAGDTALDKNIHESVSEQIRKNF-AKSRWKQAFNATAVVRHMRKLQLG 323          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Xenopus
Match: dnz1 (DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbase;Acc:XB-GENE-5747351])

HSP 1 Score: 274.248 bits (700), Expect = 1.928e-84
Identity = 126/185 (68.11%), Postives = 156/185 (84.32%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS D+DSKIMISDFGLSK++ + S M+TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI+HLMEK+P KR +C ++L HPWI+ +TALDKNI+ESVS QI+KNF A  RWK+A+NA  V+  +++LQ+ 
Sbjct:  143 LKPENLLYYSIDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIQHLMEKDPNKRNTCDQALQHPWIAGDTALDKNIHESVSEQIRKNF-AKSRWKQAFNATAVVRHMRKLQLG 323          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Mouse
Match: Camk1 (calcium/calmodulin-dependent protein kinase I [Source:MGI Symbol;Acc:MGI:1098535])

HSP 1 Score: 276.944 bits (707), Expect = 1.808e-85
Identity = 126/185 (68.11%), Postives = 159/185 (85.95%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS D+DSKIMISDFGLSKM+D  S ++TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI+HLMEK+P+KR++C+++L HPWI+ +TALDKNI++SVS QIKKNF A  +WK+A+NA  V+  +++LQ+ 
Sbjct:  142 LKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNF-AKSKWKQAFNATAVVRHMRKLQLG 322          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Mouse
Match: Camk1d (calcium/calmodulin-dependent protein kinase ID [Source:MGI Symbol;Acc:MGI:2442190])

HSP 1 Score: 275.789 bits (704), Expect = 8.719e-85
Identity = 125/196 (63.78%), Postives = 161/196 (82.14%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESAIS 1950
             +PENLLYYS D++SKIMISDFGLSKM+     M+TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI++LMEK+P KRY+C+++  HPWI+ +TAL KNI+ESVSAQI+KNF A  +W++A+NA  V+  ++RLQ+    + S +++S
Sbjct:  145 LKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALSKNIHESVSAQIRKNF-AKSKWRQAFNATAVVRHMRRLQLGSSLDSSNASVS 336          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Mouse
Match: Camk1d (calcium/calmodulin-dependent protein kinase ID [Source:MGI Symbol;Acc:MGI:2442190])

HSP 1 Score: 274.248 bits (700), Expect = 2.590e-84
Identity = 125/196 (63.78%), Postives = 161/196 (82.14%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESAIS 1950
             +PENLLYYS D++SKIMISDFGLSKM+     M+TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI++LMEK+P KRY+C+++  HPWI+ +TAL KNI+ESVSAQI+KNF A  +W++A+NA  V+  ++RLQ+    + S +++S
Sbjct:  137 LKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALSKNIHESVSAQIRKNF-AKSKWRQAFNATAVVRHMRRLQLGSSLDSSNASVS 328          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Mouse
Match: Camk1g (calcium/calmodulin-dependent protein kinase I gamma [Source:MGI Symbol;Acc:MGI:2388073])

HSP 1 Score: 249.21 bits (635), Expect = 9.780e-74
Identity = 111/185 (60.00%), Postives = 151/185 (81.62%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLY +P+++SKIMI+DFGLSKM+  +  M+TACGTPGYVAPEVL   + + Y K VDCW++GVI YILLCGYPPFY+E + +LF +IKE  YEF+SP+WD+IS+SAKDFI HL+EK+P +RY+C+++L HPWI  NTAL ++IY SVS QI+KNF A  +W++A+NAA V+  +++L +N
Sbjct:  144 LKPENLLYLTPEENSKIMITDFGLSKMEQ-NGVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVITYILLCGYPPFYEETESKLFEKIKEGYYEFESPFWDDISESAKDFICHLLEKDPNERYTCEKALRHPWIDGNTALHRDIYPSVSLQIQKNF-AKSKWRQAFNAAAVVHHMRKLHMN 323          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Mouse
Match: Pnck (pregnancy upregulated non-ubiquitously expressed CaM kinase [Source:MGI Symbol;Acc:MGI:1347357])

HSP 1 Score: 243.047 bits (619), Expect = 4.868e-73
Identity = 114/206 (55.34%), Postives = 155/206 (75.24%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESAISKQTR*KNDFP 1980
             +PENLLY +P +DSKIM+SDFGLSK+  A + + TACGTPGYVAPE+LE    + YGK VD WA+GVI+YILLCGYPPFYDE+D ELF QI  A YEFDSP+WD+IS+SAKDFI+HL+E++P+KR++C+++L H WIS + A D++I  SVS QI+KNF A   WK+A+NA + +  +++L  + E   +    S+Q   ++  P
Sbjct:  137 LKPENLLYATPFEDSKIMVSDFGLSKIQ-AGNMLGTACGTPGYVAPELLE---QKPYGKAVDVWALGVISYILLCGYPPFYDESDPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQALQHLWISGDAAFDRDILGSVSEQIQKNF-ARTHWKRAFNATSFLRHIRKLGQSPEGEEA----SRQCMTRHSHP 333          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. UniProt/SwissProt
Match: sp|Q14012|KCC1A_HUMAN (Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens OX=9606 GN=CAMK1 PE=1 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 1.204e-84
Identity = 126/185 (68.11%), Postives = 159/185 (85.95%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS D+DSKIMISDFGLSKM+D  S ++TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI+HLMEK+P+KR++C+++L HPWI+ +TALDKNI++SVS QIKKNF A  +WK+A+NA  V+  +++LQ+ 
Sbjct:  142 LKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNF-AKSKWKQAFNATAVVRHMRKLQLG 322          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. UniProt/SwissProt
Match: sp|Q63450|KCC1A_RAT (Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus OX=10116 GN=Camk1 PE=1 SV=2)

HSP 1 Score: 276.944 bits (707), Expect = 1.252e-84
Identity = 126/185 (68.11%), Postives = 159/185 (85.95%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS D+DSKIMISDFGLSKM+D  S ++TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI+HLMEK+P+KR++C+++L HPWI+ +TALDKNI++SVS QIKKNF A  +WK+A+NA  V+  +++LQ+ 
Sbjct:  142 LKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNF-AKSKWKQAFNATAVVRHMRKLQLG 322          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. UniProt/SwissProt
Match: sp|Q91YS8|KCC1A_MOUSE (Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus OX=10090 GN=Camk1 PE=1 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 1.265e-84
Identity = 126/185 (68.11%), Postives = 159/185 (85.95%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS D+DSKIMISDFGLSKM+D  S ++TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI+HLMEK+P+KR++C+++L HPWI+ +TALDKNI++SVS QIKKNF A  +WK+A+NA  V+  +++LQ+ 
Sbjct:  142 LKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNF-AKSKWKQAFNATAVVRHMRKLQLG 322          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. UniProt/SwissProt
Match: sp|Q8BW96|KCC1D_MOUSE (Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus OX=10090 GN=Camk1d PE=1 SV=2)

HSP 1 Score: 275.789 bits (704), Expect = 6.099e-84
Identity = 125/196 (63.78%), Postives = 161/196 (82.14%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESAIS 1950
             +PENLLYYS D++SKIMISDFGLSKM+     M+TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI++LMEK+P KRY+C+++  HPWI+ +TAL KNI+ESVSAQI+KNF A  +W++A+NA  V+  ++RLQ+    + S +++S
Sbjct:  145 LKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALSKNIHESVSAQIRKNF-AKSKWRQAFNATAVVRHMRRLQLGSSLDSSNASVS 336          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. UniProt/SwissProt
Match: sp|Q8IU85|KCC1D_HUMAN (Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens OX=9606 GN=CAMK1D PE=1 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 2.266e-81
Identity = 121/185 (65.41%), Postives = 155/185 (83.78%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS D++SKIMISDFGLSKM+     M+TACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI++LMEK+P KRY+C+++  HPWI+ +TAL+KNI+ESVSAQI+KNF A  +W++A+NA  V+  +++L + 
Sbjct:  145 LKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKNF-AKSKWRQAFNATAVVRHMRKLHLG 325          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. TrEMBL
Match: A0A3Q0KH15 (Putative calcium/calmodulin-dependent protein kinase OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 4.334e-99
Identity = 145/195 (74.36%), Postives = 172/195 (88.21%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRS-YGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESA 1944
             +PENLLY+SP DDSKIM+SDFGLSK+++ +S MATACGTPGYVAPEVL VN G S YGKEVDCWA+GVIAYILLCGYPPFYDEND ELFRQI+ A+YEFDSPYWD ISDSAKDFI HL++K+PKKRYSC ++L HPWI+SNTALD+++Y  VS QI+KNFLA++RWKKAYNA TV+ LL+RLQ+NK N+  E +
Sbjct:  145 LKPENLLYFSPADDSKIMVSDFGLSKIENNESIMATACGTPGYVAPEVLSVNEGSSGYGKEVDCWAIGVIAYILLCGYPPFYDENDHELFRQIRMAEYEFDSPYWDNISDSAKDFISHLLQKDPKKRYSCVQALEHPWIASNTALDRDLYPFVSEQIRKNFLAVKRWKKAYNATTVLHLLRRLQLNKSNSTVEKS 339          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. TrEMBL
Match: G4VCT2 (Putative calcium/calmodulin-dependent protein kinase OS=Schistosoma mansoni OX=6183 GN=Smp_065290 PE=3 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 5.412e-99
Identity = 145/195 (74.36%), Postives = 172/195 (88.21%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRS-YGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESA 1944
             +PENLLY+SP DDSKIM+SDFGLSK+++ +S MATACGTPGYVAPEVL VN G S YGKEVDCWA+GVIAYILLCGYPPFYDEND ELFRQI+ A+YEFDSPYWD ISDSAKDFI HL++K+PKKRYSC ++L HPWI+SNTALD+++Y  VS QI+KNFLA++RWKKAYNA TV+ LL+RLQ+NK N+  E +
Sbjct:  146 LKPENLLYFSPADDSKIMVSDFGLSKIENNESIMATACGTPGYVAPEVLSVNEGSSGYGKEVDCWAIGVIAYILLCGYPPFYDENDHELFRQIRMAEYEFDSPYWDNISDSAKDFISHLLQKDPKKRYSCVQALEHPWIASNTALDRDLYPFVSEQIRKNFLAVKRWKKAYNATTVLHLLRRLQLNKSNSTVEKS 340          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. TrEMBL
Match: A0A4Z2DT57 (Calcium/calmodulin-dependent protein kinase type 1 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_008724 PE=3 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 2.380e-98
Identity = 147/200 (73.50%), Postives = 173/200 (86.50%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRS-YGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESAISKQT 1959
             +PENLLY+SP DDSKIM+SDFGLSK+++ +S MATACGTPGYVAPEVL V  G S YGKEVDCWA+GVIAYILLCGYPPFYDEND ELFRQI+ A+YEFDSPYWD ISDSAKDFI+HL++K+PKKRYSC ++L HPWI+SNTALD+++Y  VS QI+KNFLA++RWKKAYNA  V+ LL+RLQ+NK N    SAI K T
Sbjct:  135 LKPENLLYFSPADDSKIMVSDFGLSKIENNESIMATACGTPGYVAPEVLCVTEGSSGYGKEVDCWAIGVIAYILLCGYPPFYDENDHELFRQIRMAEYEFDSPYWDNISDSAKDFIRHLLQKDPKKRYSCVQALEHPWIASNTALDRDLYPFVSEQIRKNFLAVKRWKKAYNATAVLHLLRRLQLNKSN----SAIQKST 330          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. TrEMBL
Match: A0A430QMZ5 (Calcium/calmodulin-dependent protein kinase I OS=Schistosoma bovis OX=6184 GN=DC041_0003591 PE=4 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 2.607e-98
Identity = 143/195 (73.33%), Postives = 172/195 (88.21%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRS-YGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESA 1944
             +PENLLY+SP DDSKIM+SDFGLSK+++ +S MATACGTPGYVAPEVL VN G S YGKEVDCWA+GVIAYILLCGYPPFYDEND ELFRQI+ A+YEFDSPYWD ISDSAKDFI +L++K+PKKRYSC ++L HPWI+SNTALD+++Y  VS QI+KNFLA++RWKKAYNA  V+ LL+RLQ+NK N+ +E +
Sbjct:   58 LKPENLLYFSPADDSKIMVSDFGLSKIENNESIMATACGTPGYVAPEVLSVNEGSSGYGKEVDCWAIGVIAYILLCGYPPFYDENDHELFRQIRMAEYEFDSPYWDNISDSAKDFISNLLQKDPKKRYSCVQALEHPWIASNTALDRDLYPFVSEQIRKNFLAVKRWKKAYNATAVLHLLRRLQLNKSNSTAEKS 252          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. TrEMBL
Match: A0A4Z2DSJ8 (Calcium/calmodulin-dependent protein kinase type 1 isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_008724 PE=3 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 3.253e-98
Identity = 147/200 (73.50%), Postives = 173/200 (86.50%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRS-YGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESAISKQT 1959
             +PENLLY+SP DDSKIM+SDFGLSK+++ +S MATACGTPGYVAPEVL V  G S YGKEVDCWA+GVIAYILLCGYPPFYDEND ELFRQI+ A+YEFDSPYWD ISDSAKDFI+HL++K+PKKRYSC ++L HPWI+SNTALD+++Y  VS QI+KNFLA++RWKKAYNA  V+ LL+RLQ+NK N    SAI K T
Sbjct:  146 LKPENLLYFSPADDSKIMVSDFGLSKIENNESIMATACGTPGYVAPEVLCVTEGSSGYGKEVDCWAIGVIAYILLCGYPPFYDENDHELFRQIRMAEYEFDSPYWDNISDSAKDFIRHLLQKDPKKRYSCVQALEHPWIASNTALDRDLYPFVSEQIRKNFLAVKRWKKAYNATAVLHLLRRLQLNKSN----SAIQKST 341          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Cavefish
Match: camk1db (calcium/calmodulin-dependent protein kinase type 1D-like [Source:NCBI gene;Acc:103041809])

HSP 1 Score: 260.766 bits (665), Expect = 2.095e-79
Identity = 128/207 (61.84%), Postives = 162/207 (78.26%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDA-DSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESAISKQTR*KNDFP 1980
             +PENLLYY+  D+SKIMISDFGLSKM+ A +  M+TACGTPGYVAPEVL   + + Y K VDCW++GVI+YILLCGYPPFYDEND +LF QI +A YEFDSPYWD+ISDSAKDFI +LM KNP+KR++C ++L HPWI+ +TAL KNI+ESVS Q+KKNF A  +W++A+NA  V+  +KRLQ+   ++   S  S Q R +N  P
Sbjct:  129 LKPENLLYYN-QDESKIMISDFGLSKMEGAANDIMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVISYILLCGYPPFYDENDSKLFEQILKADYEFDSPYWDDISDSAKDFISNLMLKNPEKRFTCDQALLHPWIAGDTALRKNIHESVSRQMKKNF-AKAKWRQAFNATAVIRHMKRLQLG--SSLGSSIDSTQHRNQNQTP 328          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Cavefish
Match: camk1db (calcium/calmodulin-dependent protein kinase type 1D-like [Source:NCBI gene;Acc:103041809])

HSP 1 Score: 260.766 bits (665), Expect = 2.908e-79
Identity = 128/208 (61.54%), Postives = 162/208 (77.88%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDA-DSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESAISKQTR*KNDFPV 1983
             +PENLLYY+  D+SKIMISDFGLSKM+ A +  M+TACGTPGYVAPEVL   + + Y K VDCW++GVI+YILLCGYPPFYDEND +LF QI +A YEFDSPYWD+ISDSAKDFI +LM KNP+KR++C ++L HPWI+ +TAL KNI+ESVS Q+KKNF A  +W++A+NA  V+  +KRLQ+   ++   S  S Q R +N  P 
Sbjct:  146 LKPENLLYYN-QDESKIMISDFGLSKMEGAANDIMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVISYILLCGYPPFYDENDSKLFEQILKADYEFDSPYWDDISDSAKDFISNLMLKNPEKRFTCDQALLHPWIAGDTALRKNIHESVSRQMKKNF-AKAKWRQAFNATAVIRHMKRLQLG--SSLGSSIDSTQHRNQNQTPA 346          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Cavefish
Match: pnck (calcium/calmodulin-dependent protein kinase type 1B-like [Source:NCBI gene;Acc:103046554])

HSP 1 Score: 255.373 bits (651), Expect = 6.125e-78
Identity = 117/199 (58.79%), Postives = 160/199 (80.40%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESAISKQT 1959
             +PENLLY +P +DSKI+ISDFGLSKM++   A++TACGTP YVAPE+L+    ++YGK VD WA+GVI++ILLCGYPPFYDEND +L++QI +A++EFDSPYWD+ISDSAKDFI HL++K+P++R++C+++L HPWIS   ALDKNI+ SVSAQI+KNF A  +WK+A+NA  V+  L++     E    +++IS  T
Sbjct:  140 LKPENLLYETPLEDSKIVISDFGLSKMEE-QGALSTACGTPAYVAPELLQ---QKTYGKGVDLWALGVISFILLCGYPPFYDENDTQLYKQIIKAEFEFDSPYWDDISDSAKDFIVHLLQKDPERRFNCEQALQHPWISGGAALDKNIHGSVSAQIQKNF-AKSQWKRAFNATMVVHHLRKKAHASEEEEVDASISTGT 333          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Cavefish
Match: pnck (calcium/calmodulin-dependent protein kinase type 1B-like [Source:NCBI gene;Acc:103046554])

HSP 1 Score: 255.373 bits (651), Expect = 6.125e-78
Identity = 117/199 (58.79%), Postives = 160/199 (80.40%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESAISKQT 1959
             +PENLLY +P +DSKI+ISDFGLSKM++   A++TACGTP YVAPE+L+    ++YGK VD WA+GVI++ILLCGYPPFYDEND +L++QI +A++EFDSPYWD+ISDSAKDFI HL++K+P++R++C+++L HPWIS   ALDKNI+ SVSAQI+KNF A  +WK+A+NA  V+  L++     E    +++IS  T
Sbjct:  140 LKPENLLYETPLEDSKIVISDFGLSKMEE-QGALSTACGTPAYVAPELLQ---QKTYGKGVDLWALGVISFILLCGYPPFYDENDTQLYKQIIKAEFEFDSPYWDDISDSAKDFIVHLLQKDPERRFNCEQALQHPWISGGAALDKNIHGSVSAQIQKNF-AKSQWKRAFNATMVVHHLRKKAHASEEEEVDASISTGT 333          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Cavefish
Match: camk1gb (calcium/calmodulin-dependent protein kinase type 1D-like [Source:NCBI gene;Acc:103033882])

HSP 1 Score: 247.284 bits (630), Expect = 2.050e-73
Identity = 116/197 (58.88%), Postives = 152/197 (77.16%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESAISK 1953
             +PENLLYYS D++SKIMISDFGLSKM+D D  M+TACGTPGYVAPEVL   + + Y K VDCW++GVI YILLCGYPPFY+E +  LF +I +AQYEFDSP+WD IS+SAKDFI+++M+KNPK R++  ++L HPWI   TA  ++IY SVS QI+KNF A  +WK+A+NA   +  +K+LQ+     H E+A+ +
Sbjct:  158 LKPENLLYYSQDENSKIMISDFGLSKMEDND-IMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVITYILLCGYPPFYEETETRLFSKIMKAQYEFDSPFWDNISESAKDFIRNMMQKNPKLRFTTDQALRHPWIIGKTARSQDIYHSVSVQIQKNF-AKSKWKQAFNATVAIHHMKKLQL----AHCEAALKQ 345          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003135.1 (pep scaffold:Pmarinus_7.0:GL491838:799:5626:1 gene:ENSPMAG00000002863.1 transcript:ENSPMAT00000003135.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 211.075 bits (536), Expect = 3.608e-63
Identity = 93/137 (67.88%), Postives = 115/137 (83.94%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPW 1773
             +PENLLYYS +DDSKIMISDFGLSK++   S M+TACGTPGYVA E  EV + + Y + VDCW++GVI+YILLCGYPPFYDE D  LF QI +A+YEFDSPYWD+ISDSAKDFI+HLMEK+  +R++C+++L HPW
Sbjct:  119 LKPENLLYYSAEDDSKIMISDFGLSKVEAPGSVMSTACGTPGYVACEAPEVLAQKPYTRAVDCWSIGVISYILLCGYPPFYDEVDSRLFDQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDVAERFTCEQALQHPW 255          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Sea Lamprey
Match: camk2a (calcium/calmodulin-dependent protein kinase II alpha [Source:ZFIN;Acc:ZDB-GENE-051113-72])

HSP 1 Score: 144.436 bits (363), Expect = 3.309e-38
Identity = 83/231 (35.93%), Postives = 121/231 (52.38%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLS-KMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMT----LLKRLQVNKENNHSESAISKQTR*KNDFPVILNVNFTRCIITSMKENDI 2040
             +PENLL  S    + + ++DFGL+ ++     A     GTPGY++PEVL  +    YGK VD WA GVI YILL GYPPF+DE+   L++QIK   Y+F SP WD ++  AK  I  ++  NP KR +  E+L HPWI   + +   ++   + +  K F A R+ K A     + T      K L   K +   ES  S  T  +++    L +  T+C +   K+  I
Sbjct:   45 LKPENLLLASKTKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDP---YGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKSLINQMLTINPAKRITASEALTHPWIFQRSTVASCMHRQETVECLKKFNARRKLKGAILTTMLATRNFSAAKSLMNKKTDGVKESTDSSNTTLEDE---DLKLKKTKCSLKMRKQEII 269          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008748.1 (pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 gene:ENSPMAG00000007907.1 transcript:ENSPMAT00000008748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.51 bits (358), Expect = 2.484e-37
Identity = 71/178 (39.89%), Postives = 102/178 (57.30%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADS-AMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMT 1893
             +PENLL  S    + + ++DFGL+     D  A     GTPGY++PEVL  +    YGK VD WA GVI YILL GYPPF+DE+  +L++QIK   Y+F SP WD ++  AK+ I  ++  NP KR +  E+L HPWI   + +   ++   + +  + F A R+ K A     + T
Sbjct:  137 LKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDP---YGKPVDMWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTAEAKNLINQMLTINPAKRITAAEALKHPWICQRSTVASCMHRQETVECLRKFNARRKLKGAILTTMLAT 311          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010548.1 (pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-1 gene:ENSPMAG00000009555.1 transcript:ENSPMAT00000010548.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.272 bits (347), Expect = 3.367e-34
Identity = 73/166 (43.98%), Postives = 104/166 (62.65%), Query Frame = 1
Query: 1366 QPENLLY-YSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYD-ENDQ-ELFRQIKEAQYEFDSPYWDEISD---SAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDK-NIYESVSAQIKKNF 1842
            +PENLL   + D  + + ++D GL+   +    + T CGTP YVAPE+L   +   YG EVD WA GVI YILLCG+PPF   E DQ ELF  I+  +YEF SPYWD ISD   +AKD +  L+  +  +RY+ +++L HPW+S   A D  +++  V+  I+++F
Sbjct:  495 KPENLLVQRNADGGTTLKLADLGLAM--EVTGPIYTVCGTPTYVAPEIL---AETGYGLEVDMWAAGVITYILLCGFPPFRSLERDQEELFEIIQLGEYEFLSPYWDHISDGHEAAKDLVSRLLVVDTARRYTARQALHHPWVSDGGAGDHTDLHREVTMNIQRHF 655          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Sea Lamprey
Match: phkg1b (phosphorylase kinase, gamma 1b (muscle) [Source:ZFIN;Acc:ZDB-GENE-050522-52])

HSP 1 Score: 127.102 bits (318), Expect = 9.766e-32
Identity = 59/140 (42.14%), Postives = 86/140 (61.43%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRS---YGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPW 1773
             +PEN+L    DD+  I +SDFG S        +   CGTPGY++PE+L+ +   S   YGKEVD WA GVI Y LL G PPF+      + R I + +Y+F +P W++ SD+ KD I  L+   P+KR++ +++LAHP+
Sbjct:  155 LKPENILL---DDNMNIRLSDFGFSMQLRPGERLRELCGTPGYLSPELLKCSMDESHPGYGKEVDLWACGVIMYTLLAGSPPFWHRKQMTMLRLIMDGKYDFSTPEWEDRSDTVKDLISRLLVVEPEKRFTAEQALAHPF 291          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Yeast
Match: DUN1 (Cell-cycle checkpoint S/T protein kinase; required for transient G2/M arrest after DNA damage, damage-induced transcription, and nuclear-to-cytoplasmic redistribution of Rnr2p-Rnr4p after genotoxic stress and iron deprivation; phosphorylates repair protein Rad55p, transcriptional repressor Sml1p, superoxide dismutase, and ribonucleotide reductase inhibitors Crt1p and Dif1p; functions in the Mec1p pathway to regulate dNTP pools and telomere length; postreplicative repair role [Source:SGD;Acc:S000002259])

HSP 1 Score: 124.02 bits (310), Expect = 2.413e-30
Identity = 65/164 (39.63%), Postives = 94/164 (57.32%), Query Frame = 1
Query: 1402 DSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDE-NDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVM 1890
            D ++ I+DFGL+K         T CGTP YVAPEVL   + + Y  +VD W+ GVI Y+ LCG+PPF D+     L  QI +A+Y F SPYWD+I DS    I +L+  NP +RY+  E+L HPW +     D     SVS ++++  +   +  K Y+  + +
Sbjct:  358 DIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVL---TKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGPPSLKEQILQAKYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHPWFN-----DIQQQSSVSLELQRLQITDNKIPKTYSELSCL 513          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Yeast
Match: RCK1 (Protein kinase involved in oxidative stress response; promotes pseudohyphal growth via activation of Ubp3p phosphorylation; identified as suppressor of S. pombe cell cycle checkpoint mutations; RCK1 has a paralog, RCK2, that arose from the whole genome duplication [Source:SGD;Acc:S000003126])

HSP 1 Score: 119.013 bits (297), Expect = 1.226e-28
Identity = 59/145 (40.69%), Postives = 89/145 (61.38%), Query Frame = 1
Query: 1417 ISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTAL---DKNIYESVSAQIKKNF 1842
            + DFGL+K    ++A  T CGT  YVA EV    + + Y  +VD W++G + + LLCGYPPFY++N++ L ++I    YEF +P+WD IS  AK+ + HL+E +P KRY   + L  PW++S   L   + N Y SV + +  +F
Sbjct:  299 LMDFGLAKKLRNNTA-KTPCGTIEYVASEVF---TSKRYSMKVDMWSIGCVLFTLLCGYPPFYEKNEKTLLKKISRGDYEFLAPWWDNISSGAKNAVTHLLEVDPNKRYDIDDFLNDPWLNSYDCLKDSNSNSYASVQSILNDSF 439          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Yeast
Match: CMK2 (Calmodulin-dependent protein kinase; may play a role in stress response, many CA++/calmodulan dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK2 has a paralog, CMK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005376])

HSP 1 Score: 117.472 bits (293), Expect = 1.700e-28
Identity = 67/186 (36.02%), Postives = 98/186 (52.69%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSK-MDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQY--EFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQ 1911
             +PEN+LY    ++S ++I+DFG++K +   +  +  A G+ GYVAPEVL   +   +GK  D W++GVI Y LLCGY PF  E+ +    +   ++Y   F  PYWD IS   K FI   +  NP  R +  E L  PWI+S      NI   V    KK F   ++ + A     +   +KRL+
Sbjct:  172 LKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLGYVAPEVL---TQDGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYWDNISIDVKRFILKALRLNPADRPTATELLDDPWITSKRVETSNILPDV----KKGFSLRKKLRDAIEIVKLNNRIKRLR 350          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Yeast
Match: CMK1 (Calmodulin-dependent protein kinase; may play a role in stress response, many Ca++/calmodulin dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK1 has a paralog, CMK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001910])

HSP 1 Score: 112.464 bits (280), Expect = 8.313e-27
Identity = 57/141 (40.43%), Postives = 81/141 (57.45%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMA-TACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQY--EFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWI 1776
             +PENLLY    D+S ++++DFG++K   +D  +     G+ GYVAPEVL   +   +GK  D W++GVI Y LLCGY  F  E  Q+   +    +Y  +F  PYWD +S+ AK FI   +  +P KR +  E L  PWI
Sbjct:  162 LKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVL---TQDGHGKPCDIWSIGVITYTLLCGYSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWI 299          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Yeast
Match: RCK2 (Protein kinase involved in response to oxidative and osmotic stress; identified as suppressor of S. pombe cell cycle checkpoint mutations; similar to CaM (calmodulin) kinases; RCK2 has a paralog, RCK1, that arose from the whole genome duplication [Source:SGD;Acc:S000004238])

HSP 1 Score: 109.768 bits (273), Expect = 2.190e-25
Identity = 61/147 (41.50%), Postives = 84/147 (57.14%), Query Frame = 1
Query: 1417 ISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRR 1857
            ++DFGLSK   + +   T CGT GY APEV++      Y  +VD W +G + Y +LCG+PPFYDE    L  +I   +Y F  P+WDEIS  AK+ +  L+E  P KRY   + L  PW+++   L K   E  S+Q KK   + RR
Sbjct:  363 LADFGLSKQIFSKNT-KTPCGTVGYTAPEVVK---DEHYSMKVDMWGIGCVLYTMLCGFPPFYDEKIDTLTEKISRGEYTFLKPWWDEISAGAKNAVAKLLELEPSKRYDIDQFLDDPWLNTFDCLPK---EGESSQ-KKAGTSERR 501          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Nematostella
Match: EDO36253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ85])

HSP 1 Score: 244.973 bits (624), Expect = 8.556e-75
Identity = 113/167 (67.66%), Postives = 137/167 (82.04%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWK 1863
             +PENLLYYSPD+DSKIMISDFGLSK++   S M TACGTPGYVAPEVL+    + YGK VDCW++GVI YILLCGYPPFYD++D  LF QI  A+YEFDSPYWDEIS+SAKDFI+HLME +PK RY+C+++L+HPWI    AL ++I+ SVS QIKKNF   ++WK
Sbjct:  139 LKPENLLYYSPDEDSKIMISDFGLSKIEAQGSFMDTACGTPGYVAPEVLK---QQPYGKAVDCWSIGVITYILLCGYPPFYDDSDANLFAQIMRAEYEFDSPYWDEISESAKDFIRHLMELDPKLRYTCRQALSHPWICGGEALTRDIHASVSEQIKKNFYK-QKWK 301          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Nematostella
Match: EDO42276 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1X1])

HSP 1 Score: 163.696 bits (413), Expect = 6.288e-45
Identity = 79/167 (47.31%), Postives = 113/167 (67.66%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWK 1863
             +PENLLY +  +DS + I+DFGLSK+   +   +T CGTPGY APEVL+   G SY   VD WA+GVIAYILLCG+ PFYDE DQ++F++I +  Y+F SP+WD++S  AKD +K L+  +  KR + K++L HPW+    A  +++ E    ++K+ F A R+ K
Sbjct:  137 LKPENLLYANEREDSPLKIADFGLSKILPQEVMTSTVCGTPGYCAPEVLK---GESYDTGVDMWAIGVIAYILLCGFEPFYDETDQQMFQRILKCDYDFVSPWWDDVSSGAKDLVKRLITGDKNKRLTAKQALDHPWVKGENARREDM-ERTRKKLKE-FNAKRKLK 298          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Nematostella
Match: EDO35611 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL08])

HSP 1 Score: 152.525 bits (384), Expect = 2.172e-40
Identity = 76/192 (39.58%), Postives = 116/192 (60.42%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDA--DSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALD--KNIYESVSAQIKK---NFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYY P +DSKIMI+DFGLS +     D  M T CGTPGY+APEVL     + Y   VD W++GVI + +L G  PF D++   L+++I   ++ F    WD+++D AKDFI  L+   P+ R + ++ + HPWI+S+ A    KN+++S+S  + K   N     R +K+  +  +  +  RL++N
Sbjct:  189 LKPENLLYYHPGNDSKIMITDFGLSNLRKHPDDRTMETTCGTPGYMAPEVL---LSKPYTNSVDIWSIGVITFNVLSGQMPFADDHRSRLYKKILRGKFSFSGEPWDDVTDMAKDFINKLIVYEPEMRLTAEQGIKHPWIASSAATSSLKNLHKSISQNLLKSRGNSAKSNRSQKSNRSIRIANIDGRLRIN 377          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Nematostella
Match: EDO44488 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVP7])

HSP 1 Score: 138.272 bits (347), Expect = 1.077e-36
Identity = 67/139 (48.20%), Postives = 93/139 (66.91%), Query Frame = 1
Query: 1363 FQPENLLYYS-PDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWI 1776
             +PENLL  + P+    + ++DFGL+   +  S M   CGTP YVAPE+L+  SG  YG +VD WA GVI+YILLCG+PPF   +  ELF  I   ++E+ SP+W++IS SAKD I H++  +  +RYS K+ LAHPW+
Sbjct:  123 IKPENLLVLNLPNGRKSLKLADFGLAM--EVKSPMFLVCGTPTYVAPEILD-ESG--YGLKVDIWAAGVISYILLCGFPPFRSPDQDELFDLILAGEFEYLSPFWNDISSSAKDLIDHMLVVDANQRYSAKQVLAHPWV 256          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Nematostella
Match: EDO29114 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4K0])

HSP 1 Score: 137.117 bits (344), Expect = 2.193e-36
Identity = 64/116 (55.17%), Postives = 85/116 (73.28%), Query Frame = 1
Query: 1369 PENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHL 1716
            PENLLY +  +DS + I+DFGLSK+   +   +T CGTPGY APEVL+   G SY   VD WA+GVIAYILLCG+ PFYDE DQ++F++I +  Y+F SP+WD++S  AK+ I+ L
Sbjct:   71 PENLLYANEREDSPLKIADFGLSKILPQEVMTSTVCGTPGYCAPEVLK---GESYDTGVDMWAIGVIAYILLCGFEPFYDETDQQMFQRILKCDYDFVSPWWDDVSSGAKNSIQIL 183          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Medaka
Match: camk1b (calcium/calmodulin-dependent protein kinase type 1 [Source:NCBI gene;Acc:101170017])

HSP 1 Score: 272.322 bits (695), Expect = 1.001e-83
Identity = 126/185 (68.11%), Postives = 156/185 (84.32%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS D+DSKIMISDFGLSK++ + S M+TACGTPGYVAPEVL   + + Y K VDCW++GVI+YILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI HLMEK+   RY+C ++L HPWI+ +TALDKNI+ESVSAQIKKNF A  +WK+A+NA  V+  ++RLQ++
Sbjct:  143 LKPENLLYYSMDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVISYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIVHLMEKDSNTRYTCDQALLHPWIAGDTALDKNIHESVSAQIKKNF-AKSKWKQAFNATAVIRHMRRLQLS 323          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Medaka
Match: camk1b (calcium/calmodulin-dependent protein kinase type 1 [Source:NCBI gene;Acc:101170017])

HSP 1 Score: 272.322 bits (695), Expect = 1.528e-83
Identity = 126/185 (68.11%), Postives = 156/185 (84.32%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS D+DSKIMISDFGLSK++ + S M+TACGTPGYVAPEVL   + + Y K VDCW++GVI+YILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI HLMEK+   RY+C ++L HPWI+ +TALDKNI+ESVSAQIKKNF A  +WK+A+NA  V+  ++RLQ++
Sbjct:  156 LKPENLLYYSMDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVISYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIVHLMEKDSNTRYTCDQALLHPWIAGDTALDKNIHESVSAQIKKNF-AKSKWKQAFNATAVIRHMRRLQLS 336          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Medaka
Match: camk1b (calcium/calmodulin-dependent protein kinase type 1 [Source:NCBI gene;Acc:101170017])

HSP 1 Score: 272.322 bits (695), Expect = 1.615e-83
Identity = 126/185 (68.11%), Postives = 156/185 (84.32%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS D+DSKIMISDFGLSK++ + S M+TACGTPGYVAPEVL   + + Y K VDCW++GVI+YILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI HLMEK+   RY+C ++L HPWI+ +TALDKNI+ESVSAQIKKNF A  +WK+A+NA  V+  ++RLQ++
Sbjct:  161 LKPENLLYYSMDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVISYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIVHLMEKDSNTRYTCDQALLHPWIAGDTALDKNIHESVSAQIKKNF-AKSKWKQAFNATAVIRHMRRLQLS 341          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Medaka
Match: camk1b (calcium/calmodulin-dependent protein kinase type 1 [Source:NCBI gene;Acc:101170017])

HSP 1 Score: 272.707 bits (696), Expect = 2.207e-83
Identity = 126/185 (68.11%), Postives = 156/185 (84.32%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLYYS D+DSKIMISDFGLSK++ + S M+TACGTPGYVAPEVL   + + Y K VDCW++GVI+YILLCGYPPFYDEND +LF QI +A+YEFDSPYWD+ISDSAKDFI HLMEK+   RY+C ++L HPWI+ +TALDKNI+ESVSAQIKKNF A  +WK+A+NA  V+  ++RLQ++
Sbjct:  179 LKPENLLYYSMDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVL---AQKPYSKAVDCWSIGVISYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIVHLMEKDSNTRYTCDQALLHPWIAGDTALDKNIHESVSAQIKKNF-AKSKWKQAFNATAVIRHMRRLQLS 359          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Medaka
Match: camk1db (calcium/calmodulin-dependent protein kinase type 1D [Source:NCBI gene;Acc:101175563])

HSP 1 Score: 268.085 bits (684), Expect = 9.441e-82
Identity = 122/185 (65.95%), Postives = 152/185 (82.16%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVN 1917
             +PENLLY+SP DDSKIMISDFGLSKM+     MATACGTPGYVAPEVL   + + Y K VDCW++GVIAYILLCGYPPFYDEND +LF QI +A YEFD+PYWD+ISDSAKDFI  LMEK+P+KR++C ++L HPWI+ +TAL KNI+ESVS Q++KNF A  +W++A+NA  V+  ++RLQ+ 
Sbjct:  142 LKPENLLYFSPHDDSKIMISDFGLSKMEGTGGVMATACGTPGYVAPEVL---AQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKADYEFDAPYWDDISDSAKDFISCLMEKDPEKRFTCDQALEHPWIAGDTALCKNIHESVSRQMRKNF-AKSKWRQAFNATAVIRHMRRLQLG 322          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Planmine SMEST
Match: SMESG000078937.1 (SMESG000078937.1)

HSP 1 Score: 422.55 bits (1085), Expect = 4.093e-142
Identity = 198/200 (99.00%), Postives = 199/200 (99.50%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESAISKQTR 1962
             +PENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESAISKQTR
Sbjct:  146 LKPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESAISKQTR 345          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Planmine SMEST
Match: SMESG000042100.1 (SMESG000042100.1)

HSP 1 Score: 154.066 bits (388), Expect = 6.349e-41
Identity = 79/196 (40.31%), Postives = 119/196 (60.71%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKENNHSESAIS 1950
             +PENLLY S  ++S + ++DFG++K+ + D    T CGTPGY APE+L    G SYGK VD W++GVI YILLCGY PFY+E D ++F+ I +  Y F SP+WD +S +AKD I  L+  +P KR +  ++L H W+    A   ++ E    ++K+   + R+ K +    T +  + RL  N+   + E+ IS
Sbjct:  138 LKPENLLYES-QEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEIL---LGVSYGKPVDLWSIGVITYILLCGYEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSL-EETQNKLKEFNSSRRKLKASIFVTTAIEHMMRL-CNRPEQNQETDIS 327          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Planmine SMEST
Match: SMESG000076544.1 (SMESG000076544.1)

HSP 1 Score: 144.05 bits (362), Expect = 1.869e-37
Identity = 74/172 (43.02%), Postives = 113/172 (65.70%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRS-YGKEVDCWAVGVIAYILLCGYPPFY--DENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWIS--SNTALDKNIYESVSAQIKKNFLAIRRWK 1863
             +PEN+L+ SPD++SKI+++DFGLS+    D  M T+CGT  Y APE+L+  S +  Y  ++D W++GV+ YILLCGYPPFY  +++DQE+ + I    Y+F SP+W+ IS +AK  I  L++ N   R S  ++L H WI+   NT   K+IY  +   +K+  +A +RW+
Sbjct:  160 IKPENVLFKSPDENSKIVLADFGLSR--QIDDYMLTSCGTMDYSAPELLKSKSTKVPYSCKIDNWSIGVVCYILLCGYPPFYSLNQDDQEIKKMILLGNYQFHSPHWNIISKAAKSLIASLLKVNASDRISLDQALKHQWITMGGNT---KDIYPIIETSLKET-IARQRWR 325          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Planmine SMEST
Match: SMESG000027403.1 (SMESG000027403.1)

HSP 1 Score: 142.895 bits (359), Expect = 4.146e-37
Identity = 75/191 (39.27%), Postives = 114/191 (59.69%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGR-SYGKEVDCWAVGVIAYILLCGYPPFYD--ENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWISSNTALDKN-IYESVSAQIKKNFLAIRRWKKAYNAATVMTLLKRLQVNKE 1923
             +PEN+L+ S D DS I+++DFGLS+  +A   M T CGT  Y APE+L     R  YG EVD W++GV+AYILLCG+ PFY    +D E+  +I    Y+F SP WD IS +AKDF+ +L++  P  R +  +++ H W+       +N  Y SV ++   + ++  RW+     AT +  + ++ VN+E
Sbjct:  151 LKPENILFKSRDKDSSILLTDFGLSR--EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMSQINVNRE 339          
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Planmine SMEST
Match: SMESG000018331.1 (SMESG000018331.1)

HSP 1 Score: 137.502 bits (345), Expect = 3.022e-35
Identity = 65/143 (45.45%), Postives = 89/143 (62.24%), Query Frame = 1
Query: 1363 FQPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELF----RQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWIS 1779
             +PENLLY S +DD+ I ++DFG +K    D ++ T C TP YVAPE+L   S + Y K  D W++GVI YILLCGYPPFY +N Q +      +I++ QY F    W  +S  AKD IK L+E +P KR +  +   HPW++
Sbjct:  139 LKPENLLYTSMNDDAVIKLTDFGFAKEVLTDKSLQTPCYTPYYVAPEIL---STKKYDKSCDLWSLGVIMYILLCGYPPFYSQNGQPISPGMKNRIRDGQYTFPPAEWSHVSSDAKDLIKRLLETDPDKRLTISQVKVHPWVA 278          
The following BLAST results are available for this feature:
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAMK12.507e-8568.11calcium/calmodulin dependent protein kinase I [Sou... [more]
CAMK1D1.480e-8265.41calcium/calmodulin dependent protein kinase ID [So... [more]
CAMK1D2.486e-8265.41calcium/calmodulin dependent protein kinase ID [So... [more]
CAMK1D4.718e-8265.41calcium/calmodulin dependent protein kinase ID [So... [more]
CAMK17.051e-8068.02calcium/calmodulin dependent protein kinase I [Sou... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmk-13.708e-7659.60Calcium/calmodulin-dependent protein kinase type 1... [more]
unc-431.059e-3436.62Calcium/calmodulin-dependent protein kinase type I... [more]
unc-431.059e-3436.62Calcium/calmodulin-dependent protein kinase type I... [more]
unc-431.059e-3436.62Calcium/calmodulin-dependent protein kinase type I... [more]
unc-439.029e-3436.97Calcium/calmodulin-dependent protein kinase type I... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CaMKI1.018e-7965.08gene:FBgn0016126 transcript:FBtr0089063[more]
CaMKI1.159e-7865.08gene:FBgn0016126 transcript:FBtr0333670[more]
CaMKI1.931e-7865.08gene:FBgn0016126 transcript:FBtr0089067[more]
CaMKI1.931e-7865.08gene:FBgn0016126 transcript:FBtr0089065[more]
CaMKI1.931e-7865.08gene:FBgn0016126 transcript:FBtr0089069[more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk1a9.801e-8668.65calcium/calmodulin-dependent protein kinase Ia [So... [more]
camk1a3.753e-8568.65calcium/calmodulin-dependent protein kinase Ia [So... [more]
camk1a3.753e-8568.65calcium/calmodulin-dependent protein kinase Ia [So... [more]
camk1b3.850e-8568.65calcium/calmodulin-dependent protein kinase Ib [So... [more]
camk1db7.613e-8256.17calcium/calmodulin-dependent protein kinase 1Db [S... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnz14.458e-8568.11DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbas... [more]
dnz15.302e-8568.11DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbas... [more]
dnz16.932e-8568.11DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbas... [more]
dnz11.689e-8468.11DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbas... [more]
dnz11.928e-8468.11DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbas... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Camk11.808e-8568.11calcium/calmodulin-dependent protein kinase I [Sou... [more]
Camk1d8.719e-8563.78calcium/calmodulin-dependent protein kinase ID [So... [more]
Camk1d2.590e-8463.78calcium/calmodulin-dependent protein kinase ID [So... [more]
Camk1g9.780e-7460.00calcium/calmodulin-dependent protein kinase I gamm... [more]
Pnck4.868e-7355.34pregnancy upregulated non-ubiquitously expressed C... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase I vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14012|KCC1A_HUMAN1.204e-8468.11Calcium/calmodulin-dependent protein kinase type 1... [more]
sp|Q63450|KCC1A_RAT1.252e-8468.11Calcium/calmodulin-dependent protein kinase type 1... [more]
sp|Q91YS8|KCC1A_MOUSE1.265e-8468.11Calcium/calmodulin-dependent protein kinase type 1... [more]
sp|Q8BW96|KCC1D_MOUSE6.099e-8463.78Calcium/calmodulin-dependent protein kinase type 1... [more]
sp|Q8IU85|KCC1D_HUMAN2.266e-8165.41Calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase I vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KH154.334e-9974.36Putative calcium/calmodulin-dependent protein kina... [more]
G4VCT25.412e-9974.36Putative calcium/calmodulin-dependent protein kina... [more]
A0A4Z2DT572.380e-9873.50Calcium/calmodulin-dependent protein kinase type 1... [more]
A0A430QMZ52.607e-9873.33Calcium/calmodulin-dependent protein kinase I OS=S... [more]
A0A4Z2DSJ83.253e-9873.50Calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk1db2.095e-7961.84calcium/calmodulin-dependent protein kinase type 1... [more]
camk1db2.908e-7961.54calcium/calmodulin-dependent protein kinase type 1... [more]
pnck6.125e-7858.79calcium/calmodulin-dependent protein kinase type 1... [more]
pnck6.125e-7858.79calcium/calmodulin-dependent protein kinase type 1... [more]
camk1gb2.050e-7358.88calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003135.13.608e-6367.88pep scaffold:Pmarinus_7.0:GL491838:799:5626:1 gene... [more]
camk2a3.309e-3835.93calcium/calmodulin-dependent protein kinase II alp... [more]
ENSPMAT00000008748.12.484e-3739.89pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 ge... [more]
ENSPMAT00000010548.13.367e-3443.98pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-... [more]
phkg1b9.766e-3242.14phosphorylase kinase, gamma 1b (muscle) [Source:ZF... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DUN12.413e-3039.63Cell-cycle checkpoint S/T protein kinase; required... [more]
RCK11.226e-2840.69Protein kinase involved in oxidative stress respon... [more]
CMK21.700e-2836.02Calmodulin-dependent protein kinase; may play a ro... [more]
CMK18.313e-2740.43Calmodulin-dependent protein kinase; may play a ro... [more]
RCK22.190e-2541.50Protein kinase involved in response to oxidative a... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO362538.556e-7567.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422766.288e-4547.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356112.172e-4039.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444881.077e-3648.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291142.193e-3655.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk1b1.001e-8368.11calcium/calmodulin-dependent protein kinase type 1... [more]
camk1b1.528e-8368.11calcium/calmodulin-dependent protein kinase type 1... [more]
camk1b1.615e-8368.11calcium/calmodulin-dependent protein kinase type 1... [more]
camk1b2.207e-8368.11calcium/calmodulin-dependent protein kinase type 1... [more]
camk1db9.441e-8265.95calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase I vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078937.14.093e-14299.00SMESG000078937.1[more]
SMESG000042100.16.349e-4140.31SMESG000042100.1[more]
SMESG000076544.11.869e-3743.02SMESG000076544.1[more]
SMESG000027403.14.146e-3739.27SMESG000027403.1[more]
SMESG000018331.13.022e-3545.45SMESG000018331.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034348 ID=SMED30034348|Name=Calcium/calmodulin-dependent protein kinase I|organism=Schmidtea mediterranea sexual|type=transcript|length=2365bp
GGGTTTGCTTATTTGATTCGAAAAAGACACGAGAAGTCATAGGGAACCGA
CTTTCAATAATAATTACCCAACAATATGCTGAAACAATTAGAGGCGACAA
AGATATAATTTTGACTAAGGAATGCAAAGAAAGCTTGCAAATACTGAATG
AAAAGTTGTGCAAGGCACCTGTTCTCGACTATCCAAGAGAAAGTAGAACA
TTTATCTTAGACACATACACTAGATTTAGAGCTATTGGAGCGGTTTTGAG
TCAAATTATAGAAAATGTAGCAAGATTTCTTATATCACATGAAAAGGGCT
GCTGAGTAGCCAGGGAAAACTTCTCTATGTACATGAATATATTATGAATT
TTAGAAAGTTCATAATTCATATCAACCACAAAATATTGAAAAATACAAAA
ACGCCAATCAAATCTCACTTTAAACATGTCTTGCTAATCTGGCCGAATAT
GATTTTGAACTGAAATTCCGGAAAGAGGAAGGAGACACTGATGCAGATGG
GTTATCAAGATTGGTAGCTATGATTGGCACCCAGTTTCAAAAAACAAAAA
GAATGCAAAGAATGAAAATCAAAGATTGTTGGTACTAATTATGAAATTGT
AATAAATAAAATATAATTTCTTCAATTTTTCGTATTTGTTATTGGAATGG
ATTATATTTTGATAAAAGTGTAATTTATTCAATAAAATATAGTATTGAAT
CTGTCAGTATGTTCAATTTTATCTAATTTTCATTTAAGTGACATAGTAGT
CTTTAATCATTACTTACATCTCTGCGAATTTTATAAGTTGTATATCCTTA
TTTGTGTAACCACGTGCAAAACACAACAACTGTGTCCATTATTTCCAAAC
ATACGTCCATCACAATGTGGTTAACGTCTTAAACTCTCCCGGATACATCG
GATTTCACATTTCAATAACCTCTAACTGGATCATCTCTATCAACCTTAGC
TTAACCTCGTTAACATTTTATCAACCATTTTTTGCCACTCCAACTTGATT
ATCTTATTGAATATCATTTATACTTATTTTGATGGAACTTCAAATTGGTT
TTAACTAATCACGTGTTGCAAAGTTCTCGACTAGTTTTCCACATACGGTG
AAATACATCTCGTTTTGTCATTTTATACGTTAGAGCTTTAAAAATTTGTC
TGTTTTACACAATGTAATATGCTTTTTTTAACACGCTCAATCTGAATGCA
TGTCCCCTAACAATGATGCTCCTCTAGGCTAGCTTTTAATCTTTTTTAAT
AAACTCACATATAGTTGTGCTTACCGTAAATTATATATTTTTATTTTTCA
AAAAATCTTGTTCCATTTTGTCCAAAATTTAAAATGAAAGATTTACGTAA
TTTAAATAACAATTTCAGCCGGAGAATTTGCTTTATTACAGTCCGGATGA
TGATAGTAAAATAATGATCAGTGATTTTGGTCTTTCAAAAATGGATGATG
CTGATTCAGCTATGGCCACGGCTTGCGGAACTCCTGGATATGTTGCTCCT
GAGGTTCTAGAAGTAAATTCGGGTAGAAGCTATGGAAAAGAAGTAGATTG
CTGGGCGGTTGGAGTTATTGCTTATATTCTATTATGCGGGTATCCACCAT
TTTATGACGAAAATGACCAAGAATTGTTCAGACAAATAAAAGAAGCACAA
TATGAATTTGATTCTCCATATTGGGATGAAATTTCAGATTCAGCTAAAGA
TTTTATCAAACATTTAATGGAAAAAAATCCCAAAAAACGATACTCATGTA
AAGAGTCCCTTGCCCATCCTTGGATATCAAGCAATACCGCATTAGACAAG
AATATATACGAGTCTGTAAGTGCTCAAATTAAGAAAAATTTTCTGGCTAT
TCGTAGATGGAAGAAGGCATATAATGCTGCTACGGTAATGACGTTACTTA
AACGTTTACAAGTAAATAAAGAAAACAATCATTCCGAATCAGCGATATCA
AAACAAACCCGCTAAAAGAATGATTTCCCAGTTATTCTCAACGTTAATTT
TACTCGCTGCATAATAACTTCAATGAAAGAAAATGATATTACCGAATATT
CATACATTTATTTATCAGTGCGTCTTTATTATTCCAATATTTGTTATGCT
GATGAATCGCATTGCTTTATGAACAATCTTTATTTCCTTATTTTTTTCAT
TAAATAGCTGTGTTCAAAGTTTTAGATTTTCCAGCTTATTCTTACTTGTA
TAATTTTATGAAATATCGTAAAAATTCAGTTCTAAATTACACAATTTTCA
CATTGATTTGCTGTTTAAAGTTTATATTGAATTATTTATATAAATAAAAA
TGTTCGATTTTTAAATTTCTATTTGTTTTACTTACAGTTGTCAGTAAATT
GGTATCAGATGTTGG
back to top

protein sequence of SMED30034348-orf-1

>SMED30034348-orf-1 ID=SMED30034348-orf-1|Name=SMED30034348-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=184bp
MISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVG
VIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKH
LMEKNPKKRYSCKESLAHPWISSNTALDKNIYESVSAQIKKNFLAIRRWK
KAYNAATVMTLLKRLQVNKENNHSESAISKQTR*
back to top

protein sequence of SMED30034348-orf-2

>SMED30034348-orf-2 ID=SMED30034348-orf-2|Name=SMED30034348-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp
VCLFDSKKTREVIGNRLSIIITQQYAETIRGDKDIILTKECKESLQILNE
KLCKAPVLDYPRESRTFILDTYTRFRAIGAVLSQIIENVARFLISHEKGC
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008741AV_PCPalpha
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004197cysteine-type endopeptidase activity
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 1..121
e-value: 1.2E-7
score: -26.1
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 2..121
e-value: 2.2E-31
score: 109.2
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 1..121
score: 24.485
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 128..173
e-value: 2.0E-50
score: 173.9
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 2..127
e-value: 2.0E-50
score: 173.9
NoneNo IPR availablePANTHERPTHR24347:SF197CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE 1coord: 1..167
NoneNo IPR availablePANTHERPTHR24347SERINE/THREONINE-PROTEIN KINASEcoord: 1..167
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 2..145