Calpain

Overview
NameCalpain
Smed IDSMED30034337
Length (bp)2041
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calpain (SMED30034337) t-SNE clustered cells

Violin plots show distribution of expression levels for Calpain (SMED30034337) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calpain (SMED30034337) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calpain (SMED30034337) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034337

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30034337h1SMcG0007394 dd_Smed_v4_5719_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034337h1SMcG0007394 dd_Smed_v4_5719_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30034337h1SMcG0007394 dd_Smed_v4_5719_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034337h1SMcG0007394 dd_Smed_v4_5719_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calpain vs. Ensembl Human
Match: CAPN9 (calpain 9 [Source:HGNC Symbol;Acc:HGNC:1486])

HSP 1 Score: 190.274 bits (482), Expect = 3.195e-51
Identity = 98/213 (46.01%), Postives = 135/213 (63.38%), Query Frame = 1
Query:  160 SKKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPR-IWDVMVKASHMESIMCCPIN 795
            S + F   ++  L +  LF D  F  SN  L+ S      F WKRP EI KNP+FI  G +R D+ QG LGDCWLLAAI SL+L+   + +VI  DQ F   Y G F F+ W+   W DVV+DDRLPT   +LV++HS++ +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ + F+  +K +P   ++++ KA    S++ C I+
Sbjct:   25 SGQSFEQMRQECLQRGTLFEDADFPASNSSLFYSERPQIPFVWKRPGEIVKNPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVIPQDQSFGPGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAETFQ--TKEAPENFYEILEKALKRGSLLGCFID 235          

HSP 2 Score: 110.923 bits (276), Expect = 1.031e-24
Identity = 77/266 (28.95%), Postives = 128/266 (48.12%), Query Frame = 1
Query: 1066 TPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDI--NTGNKQWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGK-LCETIICITMLEGSLVNMPDSSFI---YSIFKIEDARYLNAQLDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            +  + E +   GLI+GHAYSVT + +V     +I L+RIRNPWG +VEW G++SD                           M+F+DF  +F  +EIC +T D        +W+     G W +   +       D F  NPQ + ++   EKD G+  C  ++ +   +   +    ++ +   Y+I++  D    +  L+ +FF+ ++S  + + F++   +  R +LPPG Y++IPST     EADF LRI  E +     +D
Sbjct:  238 SAAESEARTPFGLIKGHAYSVTGIDQVSFRGQRIELIRIRNPWG-QVEWNGSWSDR--------------------------MAFKDFKAHFDKVEICNLTPDALEEDAIHKWEVTVHQGSWVRGSTAGGCRNFLDTFWTNPQIKLSL--TEKDEGQEECSFLVALMQKDRRKLKRFGANVLTIGYAIYECPDK---DEHLNKDFFRYHASRARSKTFINLREVSDRFKLPPGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMD 471          
BLAST of Calpain vs. Ensembl Human
Match: CAPN3 (calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480])

HSP 1 Score: 190.66 bits (483), Expect = 5.186e-51
Identity = 100/211 (47.39%), Postives = 134/211 (63.51%), Query Frame = 1
Query:  163 KKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPIN 795
            +K F    K  L K  L+ DP F P    L+ S     +F WKRP EI +NP+FI DG +R D+ QG LGDCW LAAI  L+L+ +L+ +VI  DQ F ++Y G F F+ WR G W DVV+DD LPT N +LV+  S++ +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ + F +   A   ++ +M KA    S+M C I+
Sbjct:   58 EKTFEQLHKKCLEKKVLYVDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEI-RDAPSDMYKIMKKAIERGSLMGCSID 267          

HSP 2 Score: 150.984 bits (380), Expect = 1.668e-37
Identity = 95/282 (33.69%), Postives = 150/282 (53.19%), Query Frame = 1
Query: 1069 PVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNK--QWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGK---LCETIICITM--------LEGSLVNMPDSSFIYSIFKIEDARYLNAQ-LDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD*TLIFINPI 1848
            PVQ E ++  GL+ GHAYSVT + EV     ++ LVR+RNPWG +VEW G++SD   +W+ +++ E+  L+     DGEFWMS++DFI +F+ LEIC +T+D    +K   W      G+W +   +       D F  NPQYR  +L  + DP     +C  ++ +          L  SL  +      ++I+++    + N Q L  +FF  N+S  + + +++   +  R RLPP  YVI+PST     E +F+LR+  E     E V+ T+    P+
Sbjct:  271 PVQYETRMACGLVRGHAYSVTGLDEVPFKGEKVKLVRLRNPWG-QVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADALQSDKLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKNRRKDRKLGASLFTIG-----FAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPV 546          
BLAST of Calpain vs. Ensembl Human
Match: CAPN3 (calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480])

HSP 1 Score: 191.045 bits (484), Expect = 5.817e-51
Identity = 100/211 (47.39%), Postives = 134/211 (63.51%), Query Frame = 1
Query:  163 KKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPIN 795
            +K F    K  L K  L+ DP F P    L+ S     +F WKRP EI +NP+FI DG +R D+ QG LGDCW LAAI  L+L+ +L+ +VI  DQ F ++Y G F F+ WR G W DVV+DD LPT N +LV+  S++ +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ + F +   A   ++ +M KA    S+M C I+
Sbjct:   58 EKTFEQLHKKCLEKKVLYVDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEI-RDAPSDMYKIMKKAIERGSLMGCSID 267          

HSP 2 Score: 151.369 bits (381), Expect = 1.644e-37
Identity = 93/277 (33.57%), Postives = 148/277 (53.43%), Query Frame = 1
Query: 1069 PVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNK--QWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGK---LCETIICITMLEGSLVNMPDSSFI---YSIFKIEDARYLNAQ-LDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD*TLIFINPI 1848
            PVQ E ++  GL+ GHAYSVT + EV     ++ LVR+RNPWG +VEW G++SD   +W+ +++ E+  L+     DGEFWMS++DFI +F+ LEIC +T+D    +K   W      G+W +   +       D F  NPQYR  +L  + DP     +C  ++ +            +S     ++I+++    + N Q L  +FF  N+S  + + +++   +  R RLPP  YVI+PST     E +F+LR+  E     E V+ T+    P+
Sbjct:  271 PVQYETRMACGLVRGHAYSVTGLDEVPFKGEKVKLVRLRNPWG-QVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADALQSDKLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPV 546          
BLAST of Calpain vs. Ensembl Human
Match: CAPN9 (calpain 9 [Source:HGNC Symbol;Acc:HGNC:1486])

HSP 1 Score: 189.889 bits (481), Expect = 6.585e-51
Identity = 98/213 (46.01%), Postives = 135/213 (63.38%), Query Frame = 1
Query:  160 SKKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPR-IWDVMVKASHMESIMCCPIN 795
            S + F   ++  L +  LF D  F  SN  L+ S      F WKRP EI KNP+FI  G +R D+ QG LGDCWLLAAI SL+L+   + +VI  DQ F   Y G F F+ W+   W DVV+DDRLPT   +LV++HS++ +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ + F+  +K +P   ++++ KA    S++ C I+
Sbjct:   25 SGQSFEQMRQECLQRGTLFEDADFPASNSSLFYSERPQIPFVWKRPGEIVKNPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVIPQDQSFGPGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAETFQ--TKEAPENFYEILEKALKRGSLLGCFID 235          

HSP 2 Score: 150.214 bits (378), Expect = 2.574e-37
Identity = 89/266 (33.46%), Postives = 145/266 (54.51%), Query Frame = 1
Query: 1066 TPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDI--NTGNKQWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGK-LCETIICITMLEGSLVNMPDSSFI---YSIFKIEDARYLNAQLDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            +  + E +   GLI+GHAYSVT + +V     +I L+RIRNPWG +VEW G++SD+SPEW ++   E+K L     +DGEFWM+F+DF  +F  +EIC +T D        +W+     G W +   +       D F  NPQ + ++   EKD G+  C  ++ +   +   +    ++ +   Y+I++  D    +  L+ +FF+ ++S  + + F++   +  R +LPPG Y++IPST     EADF LRI  E +     +D
Sbjct:  238 SAAESEARTPFGLIKGHAYSVTGIDQVSFRGQRIELIRIRNPWG-QVEWNGSWSDSSPEWRSVGPAEQKRLCHTALDDGEFWMAFKDFKAHFDKVEICNLTPDALEEDAIHKWEVTVHQGSWVRGSTAGGCRNFLDTFWTNPQIKLSL--TEKDEGQEECSFLVALMQKDRRKLKRFGANVLTIGYAIYECPDK---DEHLNKDFFRYHASRARSKTFINLREVSDRFKLPPGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMD 497          
BLAST of Calpain vs. Ensembl Human
Match: CAPN3 (calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480])

HSP 1 Score: 191.43 bits (485), Expect = 6.686e-51
Identity = 100/211 (47.39%), Postives = 134/211 (63.51%), Query Frame = 1
Query:  163 KKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPIN 795
            +K F    K  L K  L+ DP F P    L+ S     +F WKRP EI +NP+FI DG +R D+ QG LGDCW LAAI  L+L+ +L+ +VI  DQ F ++Y G F F+ WR G W DVV+DD LPT N +LV+  S++ +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ + F +   A   ++ +M KA    S+M C I+
Sbjct:   58 EKTFEQLHKKCLEKKVLYVDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEI-RDAPSDMYKIMKKAIERGSLMGCSID 267          

HSP 2 Score: 151.369 bits (381), Expect = 1.810e-37
Identity = 93/277 (33.57%), Postives = 148/277 (53.43%), Query Frame = 1
Query: 1069 PVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNK--QWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGK---LCETIICITMLEGSLVNMPDSSFI---YSIFKIEDARYLNAQ-LDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD*TLIFINPI 1848
            PVQ E ++  GL+ GHAYSVT + EV     ++ LVR+RNPWG +VEW G++SD   +W+ +++ E+  L+     DGEFWMS++DFI +F+ LEIC +T+D    +K   W      G+W +   +       D F  NPQYR  +L  + DP     +C  ++ +            +S     ++I+++    + N Q L  +FF  N+S  + + +++   +  R RLPP  YVI+PST     E +F+LR+  E     E V+ T+    P+
Sbjct:  319 PVQYETRMACGLVRGHAYSVTGLDEVPFKGEKVKLVRLRNPWG-QVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADALQSDKLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPV 594          
BLAST of Calpain vs. Ensembl Celegans
Match: clp-4 (CaLPain family [Source:UniProtKB/TrEMBL;Acc:Q8IAA9])

HSP 1 Score: 194.897 bits (494), Expect = 1.125e-53
Identity = 94/208 (45.19%), Postives = 128/208 (61.54%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPIN 795
            F ++++  L    LF DP F  +   LY  +   D+  WKRP EI  NPQ I  G SRFDV QG LGDCW LAA+ +++L   L  +++  +Q F ++Y G F F+ W  G W DVVVDDRLPT N +L Y+HS++  EFWSAL+EKA+AKL G Y+NLDGG + +A+E  TGG+ + F L       +   +VK   M S+  C I+
Sbjct:  227 FETEREKCLRNKTLFEDPEFPATAASLYYRTPPRDRIIWKRPGEIIANPQLITQGESRFDVKQGALGDCWFLAALANITLYDALFYRIVPPNQSFTENYAGIFHFQFWHYGKWVDVVVDDRLPTVNNQLYYLHSADNTEFWSALVEKAYAKLHGGYENLDGGTTAEALEDFTGGLTEYFDLRKSEKAAVLAALVKGMEMGSLFGCSID 434          

HSP 2 Score: 113.235 bits (282), Expect = 6.333e-26
Identity = 54/133 (40.60%), Postives = 79/133 (59.40%), Query Frame = 1
Query: 1078 REIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDI------NTG----------NKQWKTYNEFGKWS 1428
            +E ++  GL+ GHAYS+T +  +        L+R+RNPWGNE EW GA+SD S EW+ I+E  +K +++ F  DGEFWMSF+DF + F+ +E+C +T++I       TG            QW    E G+WS
Sbjct:  440 KEAQLRNGLVCGHAYSITAIHSITYYGEDTTLLRLRNPWGNEKEWNGAWSDGSSEWSKIDEATKKQIDVQFARDGEFWMSFEDFFSNFTQMEVCNLTAEIFDEIAEMTGVNRATETVEEEHQWHEIMEDGEWS 572          
BLAST of Calpain vs. Ensembl Celegans
Match: clp-4 (CaLPain family [Source:UniProtKB/TrEMBL;Acc:Q8IAA9])

HSP 1 Score: 196.052 bits (497), Expect = 2.229e-53
Identity = 94/208 (45.19%), Postives = 128/208 (61.54%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPIN 795
            F ++++  L    LF DP F  +   LY  +   D+  WKRP EI  NPQ I  G SRFDV QG LGDCW LAA+ +++L   L  +++  +Q F ++Y G F F+ W  G W DVVVDDRLPT N +L Y+HS++  EFWSAL+EKA+AKL G Y+NLDGG + +A+E  TGG+ + F L       +   +VK   M S+  C I+
Sbjct:  227 FETEREKCLRNKTLFEDPEFPATAASLYYRTPPRDRIIWKRPGEIIANPQLITQGESRFDVKQGALGDCWFLAALANITLYDALFYRIVPPNQSFTENYAGIFHFQFWHYGKWVDVVVDDRLPTVNNQLYYLHSADNTEFWSALVEKAYAKLHGGYENLDGGTTAEALEDFTGGLTEYFDLRKSEKAAVLAALVKGMEMGSLFGCSID 434          

HSP 2 Score: 140.969 bits (354), Expect = 1.037e-34
Identity = 88/276 (31.88%), Postives = 135/276 (48.91%), Query Frame = 1
Query: 1078 REIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDI------NTG----------NKQWKTYNEFGKWSQNLGS--------DNFHLNPQYRFTILVNEKDPGKLCETIICITMLE---------GSLVNMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPEL 1803
            +E ++  GL+ GHAYS+T +  +        L+R+RNPWGNE EW GA+SD S EW+ I+E  +K +++ F  DGEFWMSF+DF + F+ +E+C +T++I       TG            QW    E G+WS   G+          +  NPQ+       +          + + +L+         G  V +P    IYS+     AR   + L ++FF  N    +   F++   +  R R+PPG YVI+P T     +A+FLLR+     L
Sbjct:  440 KEAQLRNGLVCGHAYSITAIHSITYYGEDTTLLRLRNPWGNEKEWNGAWSDGSSEWSKIDEATKKQIDVQFARDGEFWMSFEDFFSNFTQMEVCNLTAEIFDEIAEMTGVNRATETVEEEHQWHEIMEDGEWSSKKGTAGGCNNNPSTYPKNPQFSTFFTAPQSSIEADGNVTVIVAVLQKYRRELRSKGKDV-LPIGVSIYSLGAEGTAR---SPLTAQFFSQNRPIARTTVFVNTREVTVRFRVPPGQYVIVPCTFDAYDDAEFLLRVYANGTL 711          
BLAST of Calpain vs. Ensembl Celegans
Match: clp-7 (CaLPain family [Source:UniProtKB/TrEMBL;Acc:U4PMH7])

HSP 1 Score: 196.052 bits (497), Expect = 3.688e-53
Identity = 95/208 (45.67%), Postives = 130/208 (62.50%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPIN 795
            F  +++  L +  LF DP F  ++  LY  +   +   WKRP EI +NPQ I   +SRFDV QG LGDCWLLAA+ +L+L   L  +V+  DQ F ++Y G F F+ WR G W DVV+DDRLPT +G+L YM S   +EFWSALLEKA+AKL G Y+NLDGG + +A+E  TGG+ + F +          ++V+   M S+  C I+
Sbjct:  297 FQQERQRCLDQRCLFEDPQFPANDSSLYYKTRPDEPIIWKRPGEIYENPQLIVGEKSRFDVKQGALGDCWLLAAVANLTLRDELFYRVVPPDQSFTENYAGIFHFQFWRYGQWVDVVIDDRLPTVDGRLCYMRSQENNEFWSALLEKAYAKLYGGYENLDGGTTAEALEDFTGGLTEFFDISKGDKSTTLAMLVRGMQMGSLFGCSID 504          

HSP 2 Score: 143.665 bits (361), Expect = 1.869e-35
Identity = 85/270 (31.48%), Postives = 135/270 (50.00%), Query Frame = 1
Query: 1078 REIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDI-------------NTGNKQWKTYNEFGKWSQNLGS-------DNFHLNPQYR--FTILVNEKDPGKLCETIICI------TMLEGSLVNMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKYEFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPEL 1803
            +E ++  GL+ GHAYS+T ++ V +  GQ+ L+RIRNPWGN  EW GA+SD S EW+ ++  +R+ + + F  DGEFWMSF DF+T F+ +E C +++D+             +    QW   +E G+W+   G+       D +  NPQY   F + ++  +    C  I  +       +    L N+P     +S++K + +     Q   +            F++   +  R R+PPG YVI+P T     +A FLLRI    E 
Sbjct:  510 KEAQLTNGLVRGHAYSITAIQTVNTYGGQVPLLRIRNPWGNSKEWNGAWSDGSSEWSQVDPQQREQMGVQFAKDGEFWMSFDDFMTNFTQMECCNLSADVMDEISEMTGVEVHDKQKHQWVEKSEDGEWNSRQGTAGGCQNNDTYCNNPQYGTYFQVPMDSVEHDGKCTVIGAVLQKYRRELRTKGLDNLP---IGFSVYKADGS----GQAIHDVSGQKPIARTKVFINMREVTVRFRVPPGQYVIVPCTFDAHDDASFLLRIFSNAEF 772          
BLAST of Calpain vs. Ensembl Celegans
Match: clp-7 (CaLPain family [Source:UniProtKB/TrEMBL;Acc:U4PMH7])

HSP 1 Score: 196.052 bits (497), Expect = 3.688e-53
Identity = 95/208 (45.67%), Postives = 130/208 (62.50%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPIN 795
            F  +++  L +  LF DP F  ++  LY  +   +   WKRP EI +NPQ I   +SRFDV QG LGDCWLLAA+ +L+L   L  +V+  DQ F ++Y G F F+ WR G W DVV+DDRLPT +G+L YM S   +EFWSALLEKA+AKL G Y+NLDGG + +A+E  TGG+ + F +          ++V+   M S+  C I+
Sbjct:  297 FQQERQRCLDQRCLFEDPQFPANDSSLYYKTRPDEPIIWKRPGEIYENPQLIVGEKSRFDVKQGALGDCWLLAAVANLTLRDELFYRVVPPDQSFTENYAGIFHFQFWRYGQWVDVVIDDRLPTVDGRLCYMRSQENNEFWSALLEKAYAKLYGGYENLDGGTTAEALEDFTGGLTEFFDISKGDKSTTLAMLVRGMQMGSLFGCSID 504          

HSP 2 Score: 143.665 bits (361), Expect = 1.869e-35
Identity = 85/270 (31.48%), Postives = 135/270 (50.00%), Query Frame = 1
Query: 1078 REIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDI-------------NTGNKQWKTYNEFGKWSQNLGS-------DNFHLNPQYR--FTILVNEKDPGKLCETIICI------TMLEGSLVNMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKYEFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPEL 1803
            +E ++  GL+ GHAYS+T ++ V +  GQ+ L+RIRNPWGN  EW GA+SD S EW+ ++  +R+ + + F  DGEFWMSF DF+T F+ +E C +++D+             +    QW   +E G+W+   G+       D +  NPQY   F + ++  +    C  I  +       +    L N+P     +S++K + +     Q   +            F++   +  R R+PPG YVI+P T     +A FLLRI    E 
Sbjct:  510 KEAQLTNGLVRGHAYSITAIQTVNTYGGQVPLLRIRNPWGNSKEWNGAWSDGSSEWSQVDPQQREQMGVQFAKDGEFWMSFDDFMTNFTQMECCNLSADVMDEISEMTGVEVHDKQKHQWVEKSEDGEWNSRQGTAGGCQNNDTYCNNPQYGTYFQVPMDSVEHDGKCTVIGAVLQKYRRELRTKGLDNLP---IGFSVYKADGS----GQAIHDVSGQKPIARTKVFINMREVTVRFRVPPGQYVIVPCTFDAHDDASFLLRIFSNAEF 772          
BLAST of Calpain vs. Ensembl Celegans
Match: clp-6 (CaLPain family [Source:UniProtKB/TrEMBL;Acc:Q9N4B2])

HSP 1 Score: 191.43 bits (485), Expect = 2.519e-52
Identity = 96/223 (43.05%), Postives = 135/223 (60.54%), Query Frame = 1
Query:  169 WFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPIN----HSQVQLAQKL 825
            +F  +++  L +N+LF DP F  +N  +Y          W RP +I  NP+ I +G+SRFDV QG LG+CW LAA  +L+    L  +V+  DQ F ++Y G F F+ WR G W DVV+DDRLPT NGKL+YM S + DE W  LLEKA+AKL G+Y++LDGG + +A+E  TGG+ + + L S     I  +++K   M S+  C I+      + QLA  L
Sbjct:  143 YFYEERQKCLDENRLFEDPQFPANNSSIYYKKPPKSHIVWLRPAKIFANPRLIVNGKSRFDVRQGSLGNCWFLAAAATLAQRDELFYRVVPPDQSFTENYAGIFHFQFWRYGEWVDVVIDDRLPTVNGKLIYMSSQDGDECWGPLLEKAYAKLYGTYEHLDGGTTTEALEDFTGGLTEFYDLTSTDKTMILAMIMKGMQMGSLFACSIDPDPREKEAQLANGL 365          

HSP 2 Score: 123.25 bits (308), Expect = 4.865e-29
Identity = 80/270 (29.63%), Postives = 126/270 (46.67%), Query Frame = 1
Query: 1069 PVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDI-------------NTGNKQWKTYNEFGKWSQNLGS--------DNFHLNPQYRFTILVNEKDPGKLCETIICI--TMLEGSLVNMPDSSFI-YSIFKIEDARYLNAQLDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPEL 1803
            P ++E ++  GL+ GHAYSVT V  V + + ++ L+RIRNPWG+  EW G +SD S  W  +++ +R+ +E     DGEFWM   DF+  F++L+ C +++D+                +KQW   +  G+W    G+        + F  NPQY              C  I  +        L    D   I  S++K+      N ++ +E  KT++     + F+       R  +PPG YVI+P T     +A+FLLR     E 
Sbjct:  354 PREKEAQLANGLVRGHAYSVTGVHTVETDKEKVALLRIRNPWGD-TEWNGDWSDKSSLWEQVDQEQREKMEFRIKEDGEFWMCLDDFMAQFANLDCCNLSADVMHEITEMTEIEVMEKQSKQWIQKSADGEWCSRKGTAGGCSNNENTFCTNPQYETYFRATSPSSNDKCTVIAAVFQKYRRNQLHRGLDMLQIGLSVYKMSGP---NEKVTAEMMKTHAPIASTKLFVDYREAVVRFTVPPGYYVIVPCTFEPNHDAEFLLRTFSNVEF 619          
BLAST of Calpain vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0086530)

HSP 1 Score: 202.216 bits (513), Expect = 1.728e-56
Identity = 103/214 (48.13%), Postives = 140/214 (65.42%), Query Frame = 1
Query:  196 LSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPI----NHSQVQLAQKL 825
            L+   LF DP F  SN+ L  S       +W RP EI +NPQF  +G SRFDV QG LGDCWLLAA  +L+ +SNL  +VI  +Q F+++Y G F FR W+ G W DV++DDRLPT NG+L+YMHS+  +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ + + L  +A   ++ ++ KA+   S+M C I    N ++ +  Q L
Sbjct:   83 LASGSLFEDPLFPASNESLQFSRRPDRHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEENYAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDL-KEAPGNLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGL 295          

HSP 2 Score: 166.007 bits (419), Expect = 1.282e-43
Identity = 94/272 (34.56%), Postives = 150/272 (55.15%), Query Frame = 1
Query: 1069 PVQREIKVDTGLIEGHAYSVTNVKEV----CSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDI------NTGNKQWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTIL-VNEKDPGKLCETIICITM---LEGSLVNMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKY-EFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESV 1818
            P   E +   GLI GHAYS+T V  +     + +G+I ++R+RNPWGNE EW G +SD+SPEW  I E ++  + L F+ DGEFWMSFQDF+ +F  +EIC ++ D       N+G ++W+     G+W+  + +       D F  NPQY  T++  +E+D    C  I+ +          + M   +  ++I+ + D    N      FF+  SS  +   F++   +C+R +LPPG+Y+I+PST     E +F++R+  E + +ME V
Sbjct:  284 PNVTEAETPQGLIRGHAYSITKVCLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSLNDRELENRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETQNNMECV 555          
BLAST of Calpain vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0340532)

HSP 1 Score: 202.601 bits (514), Expect = 5.245e-55
Identity = 103/214 (48.13%), Postives = 140/214 (65.42%), Query Frame = 1
Query:  196 LSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPI----NHSQVQLAQKL 825
            L+   LF DP F  SN+ L  S       +W RP EI +NPQF  +G SRFDV QG LGDCWLLAA  +L+ +SNL  +VI  +Q F+++Y G F FR W+ G W DV++DDRLPT NG+L+YMHS+  +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ + + L  +A   ++ ++ KA+   S+M C I    N ++ +  Q L
Sbjct:   98 LASGSLFEDPLFPASNESLQFSRRPDRHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEENYAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDL-KEAPGNLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGL 310          

HSP 2 Score: 166.392 bits (420), Expect = 1.021e-42
Identity = 94/273 (34.43%), Postives = 150/273 (54.95%), Query Frame = 1
Query: 1069 PVQREIKVDTGLIEGHAYSVTNVKEV----CSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDI------NTGNKQWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTIL-VNEKDPGKLCETIICITM---LEGSLVNMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKY-EFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            P   E +   GLI GHAYS+T V  +     + +G+I ++R+RNPWGNE EW G +SD+SPEW  I E ++  + L F+ DGEFWMSFQDF+ +F  +EIC ++ D       N+G ++W+     G+W+  + +       D F  NPQY  T++  +E+D    C  I+ +          + M   +  ++I+ + D    N      FF+  SS  +   F++   +C+R +LPPG+Y+I+PST     E +F++R+  E + +ME  D
Sbjct:  299 PNVTEAETPQGLIRGHAYSITKVCLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSLNDRELENRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETQNNMEEND 571          
BLAST of Calpain vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0112869)

HSP 1 Score: 202.216 bits (513), Expect = 5.862e-55
Identity = 103/214 (48.13%), Postives = 140/214 (65.42%), Query Frame = 1
Query:  196 LSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPI----NHSQVQLAQKL 825
            L+   LF DP F  SN+ L  S       +W RP EI +NPQF  +G SRFDV QG LGDCWLLAA  +L+ +SNL  +VI  +Q F+++Y G F FR W+ G W DV++DDRLPT NG+L+YMHS+  +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ + + L  +A   ++ ++ KA+   S+M C I    N ++ +  Q L
Sbjct:   83 LASGSLFEDPLFPASNESLQFSRRPDRHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEENYAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDL-KEAPGNLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGL 295          

HSP 2 Score: 166.392 bits (420), Expect = 1.005e-42
Identity = 94/273 (34.43%), Postives = 150/273 (54.95%), Query Frame = 1
Query: 1069 PVQREIKVDTGLIEGHAYSVTNVKEV----CSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDI------NTGNKQWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTIL-VNEKDPGKLCETIICITM---LEGSLVNMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKY-EFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            P   E +   GLI GHAYS+T V  +     + +G+I ++R+RNPWGNE EW G +SD+SPEW  I E ++  + L F+ DGEFWMSFQDF+ +F  +EIC ++ D       N+G ++W+     G+W+  + +       D F  NPQY  T++  +E+D    C  I+ +          + M   +  ++I+ + D    N      FF+  SS  +   F++   +C+R +LPPG+Y+I+PST     E +F++R+  E + +ME  D
Sbjct:  284 PNVTEAETPQGLIRGHAYSITKVCLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSLNDRELENRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETQNNMEEND 556          
BLAST of Calpain vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0086529)

HSP 1 Score: 202.216 bits (513), Expect = 5.862e-55
Identity = 103/214 (48.13%), Postives = 140/214 (65.42%), Query Frame = 1
Query:  196 LSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPI----NHSQVQLAQKL 825
            L+   LF DP F  SN+ L  S       +W RP EI +NPQF  +G SRFDV QG LGDCWLLAA  +L+ +SNL  +VI  +Q F+++Y G F FR W+ G W DV++DDRLPT NG+L+YMHS+  +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ + + L  +A   ++ ++ KA+   S+M C I    N ++ +  Q L
Sbjct:   83 LASGSLFEDPLFPASNESLQFSRRPDRHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEENYAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDL-KEAPGNLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGL 295          

HSP 2 Score: 166.392 bits (420), Expect = 1.005e-42
Identity = 94/273 (34.43%), Postives = 150/273 (54.95%), Query Frame = 1
Query: 1069 PVQREIKVDTGLIEGHAYSVTNVKEV----CSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDI------NTGNKQWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTIL-VNEKDPGKLCETIICITM---LEGSLVNMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKY-EFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            P   E +   GLI GHAYS+T V  +     + +G+I ++R+RNPWGNE EW G +SD+SPEW  I E ++  + L F+ DGEFWMSFQDF+ +F  +EIC ++ D       N+G ++W+     G+W+  + +       D F  NPQY  T++  +E+D    C  I+ +          + M   +  ++I+ + D    N      FF+  SS  +   F++   +C+R +LPPG+Y+I+PST     E +F++R+  E + +ME  D
Sbjct:  284 PNVTEAETPQGLIRGHAYSITKVCLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSLNDRELENRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETQNNMEEND 556          
BLAST of Calpain vs. Ensembl Fly
Match: CalpB (gene:FBgn0025866 transcript:FBtr0076343)

HSP 1 Score: 201.06 bits (510), Expect = 3.080e-54
Identity = 100/209 (47.85%), Postives = 137/209 (65.55%), Query Frame = 1
Query:  160 SKKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCC 786
            SK  F S +   L+   +F DP F  +N  L  S      ++W RP +I  +PQF  +G SRFDV QG LGDCWLLAA  +L+ DS L  +VI  DQ F ++Y G F F+ W+ G W +VV+DDRLPT NG+L+YMHS+  +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ + + +  +A P ++ +M+KA+   S+M C
Sbjct:  242 SKGDFQSLRDSCLANGTMFEDPDFPATNASLMYSRRPDRYYEWLRPGDIADDPQFFVEGYSRFDVQQGELGDCWLLAAAANLTQDSTLFFRVIPPDQDFQENYAGIFHFKFWQYGKWVEVVIDDRLPTYNGELIYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTEWYDI-KEAPPNLFSIMMKAAERGSMMGC 449          

HSP 2 Score: 149.828 bits (377), Expect = 3.582e-37
Identity = 91/270 (33.70%), Postives = 146/270 (54.07%), Query Frame = 1
Query: 1081 EIKVDTGLIEGHAYSVTNV----KEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNKQ------WKTYNEFGKWSQNLGS-------DNFHLNPQYRFTI--LVNEKDPGKLCETIICITM---LEGSLVNMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKY-EFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            E +   GLI GHAYS+T V        + +G++ ++R+RNPWGN+ EW G +SD+SPEW  I E  ++ + LNF+ DGEFWMSFQDF+ +F  +EIC ++ D  T ++Q      W+     G+W+  + +       + F  NPQY  ++    +E D GK C  I+ +          V +   +  ++I+ + D           FFK  +S  +   F++   +C+R +LPPG+Y+I+PST     E +F++R+  E   +ME  D
Sbjct:  459 EAETPQGLIRGHAYSITKVCLMDISTPNRQGKLPMIRMRNPWGNDAEWSGPWSDSSPEWRFIPEHTKEEIGLNFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQHSSRRKWEMSMFEGEWTSGVTAGGCRNFLETFWHNPQYIISLEDPDDEDDDGK-CTAIVALMQKNRRSKRNVGIDCLTIGFAIYHLTDRDMQVKPQGLNFFKYRASVARSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETRNNMEEND 727          
BLAST of Calpain vs. Ensembl Zebrafish
Match: capn3b (calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149])

HSP 1 Score: 196.823 bits (499), Expect = 1.985e-53
Identity = 101/219 (46.12%), Postives = 139/219 (63.47%), Query Frame = 1
Query:  166 KWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQK 822
            K F   +   + K  LF DP F   +  L+ S     K +WKRP+EI KNPQFI  G +R D+ QG LGDCWLLAAI  L+L+  ++ +V+  DQ F ++Y G F F+ WR G W DVV+DDRLPT   KLV+  S   +EFWSAL+EKA+AKL GSY+ L GG S +AME  TGG+ + + + ++A   ++++M KA    S+M C I+ + V  AQ+
Sbjct:   59 KDFQELRDKYVRKKVLFEDPLFPAQDSSLFYSEKFPLKLEWKRPMEICKNPQFILGGANRTDICQGDLGDCWLLAAIACLTLNDVILKRVVPHDQSFTENYAGIFHFQFWRYGEWVDVVIDDRLPTYKNKLVFTRSGQNNEFWSALMEKAYAKLHGSYEALKGGNSLEAMEDFTGGVTEFYEI-TEAPKELYNIMRKALKRGSLMGCAID-TLVPTAQR 275          

HSP 2 Score: 113.62 bits (283), Expect = 1.150e-25
Identity = 80/259 (30.89%), Postives = 130/259 (50.19%), Query Frame = 1
Query: 1066 TPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQ---INLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNK--QWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDSSFI----YSIFKIEDARYLN--AQLDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRI 1785
             P  +  K  +GL+ GHAYSVT V++    +G+   I LVR+R+PWG  V    A   N  +W  + + E+    L     GEFWM F++F   F+ LEIC +T D    ++  +W      G+W +   +       D +  NPQ+R  +L  E D  +   T++   M +G  V     + +    ++I+++   ++ N   QL  +FF  N+S  + + +++   +  R  L PG YVIIPST     E++FLLR+
Sbjct:  270 VPTAQRTKTASGLVRGHAYSVTGVEQGKRKDGKDLMIRLVRVRDPWG--VAPPPACKSN--DWVELAKTEQDKQRLQPGEQGEFWMCFEEFQKNFTKLEICNLTPDTLEDDQMFKWNVTVHEGRWVKGCSAGGCRNFPDTYWTNPQFRLVLL--EADAKEKTCTVVVALMQKGRRVERCSGATLHNIGFAIYEVCSNKHGNQQQQLSKDFFLYNASTARSKSYVNIREVTERFCLKPGEYVIIPSTFDPHKESEFLLRL 522          
BLAST of Calpain vs. Ensembl Zebrafish
Match: capn3b (calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149])

HSP 1 Score: 196.823 bits (499), Expect = 2.230e-53
Identity = 100/217 (46.08%), Postives = 138/217 (63.59%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQK 822
            F   +   + K  LF DP F   +  L+ S     K +WKRP+EI KNPQFI  G +R D+ QG LGDCWLLAAI  L+L+  ++ +V+  DQ F ++Y G F F+ WR G W DVV+DDRLPT   KLV+  S   +EFWSAL+EKA+AKL GSY+ L GG S +AME  TGG+ + + + ++A   ++++M KA    S+M C I+ + V  AQ+
Sbjct:   52 FQELRDKYVRKKVLFEDPLFPAQDSSLFYSEKFPLKLEWKRPMEICKNPQFILGGANRTDICQGDLGDCWLLAAIACLTLNDVILKRVVPHDQSFTENYAGIFHFQFWRYGEWVDVVIDDRLPTYKNKLVFTRSGQNNEFWSALMEKAYAKLHGSYEALKGGNSLEAMEDFTGGVTEFYEI-TEAPKELYNIMRKALKRGSLMGCAID-TLVPTAQR 266          

HSP 2 Score: 115.161 bits (287), Expect = 4.218e-26
Identity = 82/271 (30.26%), Postives = 133/271 (49.08%), Query Frame = 1
Query: 1066 TPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQ---INLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNK--QWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDSSFI----YSIFKIEDARYLN--AQLDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
             P  +  K  +GL+ GHAYSVT V++    +G+   I LVR+R+PWG  V    A   N  +W  + + E+    L     GEFWM F++F   F+ LEIC +T D    ++  +W      G+W +   +       D +  NPQ+R  +L  E D  +   T++   M +G  V     + +    ++I+++      N   QL  +FF  N+S  + + +++   +  R  L PG YVIIPST     E++FLLR+  E   + + +D
Sbjct:  261 VPTAQRTKTASGLVRGHAYSVTGVEQGKRKDGKDLMIRLVRVRDPWG--VAPPPACKSN--DWVELAKTEQDKQRLQPGEQGEFWMCFEEFQKNFTKLEICNLTPDTLEDDQMFKWNVTVHEGRWVKGCSAGGCRNFPDTYWTNPQFRLVLL--EADAKEKTCTVVVALMQKGRRVERCSGATLHNIGFAIYEVPKEMKGNQQQQLSKDFFLYNASTARSKSYVNIREVTERFCLKPGEYVIIPSTFDPHKESEFLLRVFSENRSTSKVID 525          
BLAST of Calpain vs. Ensembl Zebrafish
Match: capn3b (calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149])

HSP 1 Score: 196.823 bits (499), Expect = 2.232e-53
Identity = 100/217 (46.08%), Postives = 138/217 (63.59%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQK 822
            F   +   + K  LF DP F   +  L+ S     K +WKRP+EI KNPQFI  G +R D+ QG LGDCWLLAAI  L+L+  ++ +V+  DQ F ++Y G F F+ WR G W DVV+DDRLPT   KLV+  S   +EFWSAL+EKA+AKL GSY+ L GG S +AME  TGG+ + + + ++A   ++++M KA    S+M C I+ + V  AQ+
Sbjct:   52 FQELRDKYVRKKVLFEDPLFPAQDSSLFYSEKFPLKLEWKRPMEICKNPQFILGGANRTDICQGDLGDCWLLAAIACLTLNDVILKRVVPHDQSFTENYAGIFHFQFWRYGEWVDVVIDDRLPTYKNKLVFTRSGQNNEFWSALMEKAYAKLHGSYEALKGGNSLEAMEDFTGGVTEFYEI-TEAPKELYNIMRKALKRGSLMGCAID-TLVPTAQR 266          

HSP 2 Score: 117.087 bits (292), Expect = 1.018e-26
Identity = 83/267 (31.09%), Postives = 133/267 (49.81%), Query Frame = 1
Query: 1066 TPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQ---INLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNK--QWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDSSFIYSI-FKIEDAR-YLNAQLDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
             P  +  K  +GL+ GHAYSVT V++    +G+   I LVR+R+PWG  V    A   N  +W  + + E+    L     GEFWM F++F   F+ LEIC +T D    ++  +W      G+W +   +       D +  NPQ+R  +L  E D  +   T++   M +G  V     + +++I F I + +     QL  +FF  N+S  + + +++   +  R  L PG YVIIPST     E++FLLR+  E   + + +D
Sbjct:  261 VPTAQRTKTASGLVRGHAYSVTGVEQGKRKDGKDLMIRLVRVRDPWG--VAPPPACKSN--DWVELAKTEQDKQRLQPGEQGEFWMCFEEFQKNFTKLEICNLTPDTLEDDQMFKWNVTVHEGRWVKGCSAGGCRNFPDTYWTNPQFRLVLL--EADAKEKTCTVVVALMQKGRRVERCSGATLHNIGFAIYEMKGNQQQQLSKDFFLYNASTARSKSYVNIREVTERFCLKPGEYVIIPSTFDPHKESEFLLRVFSENRSTSKVID 521          
BLAST of Calpain vs. Ensembl Zebrafish
Match: capn8 (calpain 8 [Source:ZFIN;Acc:ZDB-GENE-050522-279])

HSP 1 Score: 194.897 bits (494), Expect = 7.024e-53
Identity = 100/218 (45.87%), Postives = 141/218 (64.68%), Query Frame = 1
Query:  163 KKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKF-------QWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPIN 795
            K+ + S K+  L+K  LF DP F   +D L    + L ++       QWKRP E+  NP+FI DG +R D+ QG LGDCWLLAAI SL+LD  ++ +V+   Q F + Y G F F+ W+ G W DVV+DDRLPT +GKL+++HS+   EFWSALLEKA+AK+ GSY+ L GG + +  E  TGGI + + L SKA P ++ ++ KA  + S++ C I+
Sbjct:   29 KQDYQSLKQECLAKRALFCDPTFPAESDSL--GYNELGRYSFKTKGVQWKRPKELCSNPEFIMDGANRTDICQGALGDCWLLAAIASLTLDKEILERVVPSGQSFTEDYAGIFHFQFWQYGEWVDVVIDDRLPTRDGKLLFVHSAEGSEFWSALLEKAYAKVNGSYEALTGGSTTEGFEDFTGGITENYEL-SKAPPNLFKLVQKALALGSLLGCSID 243          

HSP 2 Score: 126.331 bits (316), Expect = 1.132e-29
Identity = 88/252 (34.92%), Postives = 132/252 (52.38%), Query Frame = 1
Query: 1102 LIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNK--QWKTYNEF-GKW---SQNLGSDN----FHLNPQYRFTILVNEKDPG---KLCETIICITMLEG---SLVNMPDSSFIYSIFKIED--ARYLNAQLDSE-FFKTNSSYLKYEFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPE 1800
            L++GHAYSVT  +EV      + LVRIRNPWG EVEW GA+SDNS EW+++   E+  L+ +   DGEFWM++ DFI  FS LEIC +T D  +  +  +W +Y++F G W   S   G  N    F  NPQ+   +   + DP      C  ++ +   +G          ++  ++I+K+ D      N  L  +   +  S      F++   +  R +LPPG Y+I+PST     +  F+LR+  E E
Sbjct:  258 LVKGHAYSVTAAEEVHFRGSLVQLVRIRNPWG-EVEWTGAWSDNSKEWDSVPPEEKAKLDYS-AEDGEFWMAYSDFIQQFSKLEICNLTPDTLSSEEVNRW-SYSQFEGNWRVGSTAGGCRNNPATFCSNPQFMIKLEEIDDDPHDGVNGCTFLVGLMQKDGRKDKRFGRDLNTIGFAIYKVPDELKGRSNIHLGPDVLLRQRSVAGSNTFINLREVSERFKLPPGEYIIVPSTFEPHRKGSFILRVFAEKE 506          
BLAST of Calpain vs. Ensembl Zebrafish
Match: capn8 (calpain 8 [Source:ZFIN;Acc:ZDB-GENE-050522-279])

HSP 1 Score: 194.897 bits (494), Expect = 7.222e-53
Identity = 100/218 (45.87%), Postives = 141/218 (64.68%), Query Frame = 1
Query:  163 KKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKF-------QWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPIN 795
            K+ + S K+  L+K  LF DP F   +D L    + L ++       QWKRP E+  NP+FI DG +R D+ QG LGDCWLLAAI SL+LD  ++ +V+   Q F + Y G F F+ W+ G W DVV+DDRLPT +GKL+++HS+   EFWSALLEKA+AK+ GSY+ L GG + +  E  TGGI + + L SKA P ++ ++ KA  + S++ C I+
Sbjct:   29 KQDYQSLKQECLAKRALFCDPTFPAESDSL--GYNELGRYSFKTKGVQWKRPKELCSNPEFIMDGANRTDICQGALGDCWLLAAIASLTLDKEILERVVPSGQSFTEDYAGIFHFQFWQYGEWVDVVIDDRLPTRDGKLLFVHSAEGSEFWSALLEKAYAKVNGSYEALTGGSTTEGFEDFTGGITENYEL-SKAPPNLFKLVQKALALGSLLGCSID 243          

HSP 2 Score: 126.716 bits (317), Expect = 7.209e-30
Identity = 86/249 (34.54%), Postives = 132/249 (53.01%), Query Frame = 1
Query: 1102 LIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNK--QWKTYNEF-GKW---SQNLGSDN----FHLNPQYRFTILVNEKDPG---KLCETIICITMLEG---SLVNMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKYEFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPE 1800
            L++GHAYSVT  +EV      + LVRIRNPWG EVEW GA+SDNS EW+++   E+  L+ +   DGEFWM++ DFI  FS LEIC +T D  +  +  +W +Y++F G W   S   G  N    F  NPQ+   +   + DP      C  ++ +   +G          ++  ++I+K++    ++   D    +  S      F++   +  R +LPPG Y+I+PST     +  F+LR+  E E
Sbjct:  258 LVKGHAYSVTAAEEVHFRGSLVQLVRIRNPWG-EVEWTGAWSDNSKEWDSVPPEEKAKLDYS-AEDGEFWMAYSDFIQQFSKLEICNLTPDTLSSEEVNRW-SYSQFEGNWRVGSTAGGCRNNPATFCSNPQFMIKLEEIDDDPHDGVNGCTFLVGLMQKDGRKDKRFGRDLNTIGFAIYKLKGRSNIHLGPDV-LLRQRSVAGSNTFINLREVSERFKLPPGEYIIVPSTFEPHRKGSFILRVFAEKE 502          
BLAST of Calpain vs. Ensembl Xenopus
Match: CAPN3 (calpain 3 [Source:NCBI gene;Acc:100497532])

HSP 1 Score: 323.553 bits (828), Expect = 3.662e-99
Identity = 212/594 (35.69%), Postives = 312/594 (52.53%), Query Frame = 1
Query:  139 VSKNL---DDSKKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPR-IWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKIVKEPNEPWGT--PVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQ-INLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSD-INTGNKQ-WKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGK---LCETIICITMLEGSLVNMPDSSFI---YSIFKIEDARYLNAQ-LDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD*TLIFINPI 1848
            +S+NL      +K F   +K  L +N  F D  F P    L+ S     KF+WKRP EI +NPQFI  G +R D+ QG LGDCW LAAI  L+L+  ++ +VI  DQ F  +Y G F F+ WR G W DV++DD LPT N +LV+  SS  +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ + + L  K +P+ ++++M KA    S++ C I+    +     G F P P N + ++                               +K   S G     TN +           +P +P  T  PVQ E ++  GL++GHAYSVT V+E   L+G+ I LVR+RNPWG +VEW GA+ DN+ EW  +++ E+  L+     DGEFWMS+ DF+  F+  EIC +T D +++ + Q W      G+W +   +       D +  NPQYR  +L  + DP     +C  ++ +            ++     ++I+++    + N Q L  +FF  N+S  K + +++   +C R RLPP  YVIIPST     E +F+LR+  E     E V+  +    PI
Sbjct:   38 ISRNLPIIGGREKTFEELRKKCLQRNFHFQDREFPPDESSLFYSQSFPIKFEWKRPPEICENPQFILGGANRTDICQGDLGDCWFLAAIACLTLNEKVLFRVIPPDQNFTDNYAGIFHFQFWRYGDWVDVIIDDYLPTYNNELVFTKSSQRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEL--KEAPKDMYNIMKKAFERGSLIGCSIDD---KYGSSCG-FAP-PSNMEDAI-------------------------------MKMIESVGDTRPDTNGR----------GQPPKPVATLVPVQLETRMANGLVKGHAYSVTGVEET-KLKGKPIKLVRLRNPWG-QVEWNGAWGDNAKEWTMVDKSEKTRLQHQVQEDGEFWMSYDDFMKNFTKAEICNLTPDALDSDSLQVWTVSVNEGRWVRGCSAGGCRNYPDTYWTNPQYRLKLLEEDDDPADNEVVCSFVVALMQKNRRKDRKAGANLFTIGFAIYEVPKEMHGNNQHLQKDFFLYNASKAKCKSYINMREVCQRFRLPPSEYVIIPSTYEPHQEGEFILRVFSEKRNISEEVENKIEAEKPI 581          
BLAST of Calpain vs. Ensembl Xenopus
Match: CAPN3 (calpain 3 [Source:NCBI gene;Acc:100497532])

HSP 1 Score: 317.775 bits (813), Expect = 4.407e-97
Identity = 208/585 (35.56%), Postives = 305/585 (52.14%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFFCPSNDLL-----YCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPR-IWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKIVKEPNEPWGT--PVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQ-INLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSD-INTGNKQ-WKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGK---LCETIICITMLEGSLVNMPDSSFI---YSIFKIEDARYLNAQ-LDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD*TLIFINPI 1848
            F + K   + K +LF DP F P+   L        S  L    WKRP EI +NPQFI  G +R D+ QG LGDCW LAAI  L+L+  ++ +VI  DQ F  +Y G F F+ WR G W DV++DD LPT N +LV+  SS  +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ + + L  K +P+ ++++M KA    S++ C I+    +     G F P P N + ++                               +K   S G     TN +           +P +P  T  PVQ E ++  GL++GHAYSVT V+E   L+G+ I LVR+RNPWG +VEW GA+ DN+ EW  +++ E+  L+     DGEFWMS+ DF+  F+  EIC +T D +++ + Q W      G+W +   +       D +  NPQYR  +L  + DP     +C  ++ +            ++     ++I+++    + N Q L  +FF  N+S  K + +++   +C R RLPP  YVIIPST     E +F+LR+  E     E V+  +    PI
Sbjct:   37 FATLKSEFVGKKKLFEDPIFLPAVQSLGQKEFAQKSTKLKNIIWKRPKEICENPQFILGGANRTDICQGDLGDCWFLAAIACLTLNEKVLFRVIPPDQNFTDNYAGIFHFQFWRYGDWVDVIIDDYLPTYNNELVFTKSSQRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEL--KEAPKDMYNIMKKAFERGSLIGCSIDD---KYGSSCG-FAP-PSNMEDAI-------------------------------MKMIESVGDTRPDTNGRG----------QPPKPVATLVPVQLETRMANGLVKGHAYSVTGVEET-KLKGKPIKLVRLRNPWG-QVEWNGAWGDNAKEWTMVDKSEKTRLQHQVQEDGEFWMSYDDFMKNFTKAEICNLTPDALDSDSLQVWTVSVNEGRWVRGCSAGGCRNYPDTYWTNPQYRLKLLEEDDDPADNEVVCSFVVALMQKNRRKDRKAGANLFTIGFAIYEVPKEMHGNNQHLQKDFFLYNASKAKCKSYINMREVCQRFRLPPSEYVIIPSTYEPHQEGEFILRVFSEKRNISEEVENKIEAEKPI 571          
BLAST of Calpain vs. Ensembl Xenopus
Match: CAPN3 (calpain 3 [Source:NCBI gene;Acc:100497532])

HSP 1 Score: 302.753 bits (774), Expect = 1.763e-91
Identity = 210/591 (35.53%), Postives = 305/591 (51.61%), Query Frame = 1
Query:  139 VSKNL---DDSKKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPR-IWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKIVKEPNEPWGT--PVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQ-INLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSD-INTGNKQ-WKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGK---LCETIICITMLEGSLVNMPDSSFIYSI-FKIEDARYLNAQLDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD*TLIFINPI 1848
            +S+NL      +K F   +K  L +N  F D  F P    L+ S     KF+WKRP EI +NPQFI  G +R D+ QG LGDCW LAAI  L+L+  ++ +VI  DQ F  +Y G F F+ WR G W DV++DD LPT N +LV+  SS  +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ + + L  K +P+ ++++M KA    S++ C I+    +     G F P P N + ++                               +K   S G     TN +           +P +P  T  PVQ E ++  GL++GHAYSVT V+E   L+G+ I LVR+RNPWG +VEW G        W  +   E+  L+     DGEFWMS+ DF+  F+  EIC +T D +++ + Q W      G+W +   +       D +  NPQYR  +L  + DP     +C  ++ + M +    +    + +++I F I +    N  L  +FF  N+S  K + +++   +C R RLPP  YVIIPST     E +F+LR+  E     E V+  +    PI
Sbjct:   47 ISRNLPIIGGREKTFEELRKKCLQRNFHFQDREFPPDESSLFYSQSFPIKFEWKRPPEICENPQFILGGANRTDICQGDLGDCWFLAAIACLTLNEKVLFRVIPPDQNFTDNYAGIFHFQFWRYGDWVDVIIDDYLPTYNNELVFTKSSQRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEL--KEAPKDMYNIMKKAFERGSLIGCSIDD---KYGSSCG-FAP-PSNMEDAI-------------------------------MKMIESVGDTRPDTNGR----------GQPPKPVATLVPVQLETRMANGLVKGHAYSVTGVEET-KLKGKPIKLVRLRNPWG-QVEWNG--------WAFVLS-EKTRLQHQVQEDGEFWMSYDDFMKNFTKAEICNLTPDALDSDSLQVWTVSVNEGRWVRGCSAGGCRNYPDTYWTNPQYRLKLLEEDDDPADNEVVCSFVVAL-MQKNRRKDRKAGANLFTIGFAIYEMHGNNQHLQKDFFLYNASKAKCKSYINMREVCQRFRLPPSEYVIIPSTYEPHQEGEFILRVFSEKRNISEEVENKIEAEKPI 577          
BLAST of Calpain vs. Ensembl Xenopus
Match: CAPN3 (calpain 3 [Source:NCBI gene;Acc:100497532])

HSP 1 Score: 302.368 bits (773), Expect = 1.882e-91
Identity = 210/591 (35.53%), Postives = 305/591 (51.61%), Query Frame = 1
Query:  139 VSKNL---DDSKKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPR-IWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKIVKEPNEPWGT--PVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQ-INLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSD-INTGNKQ-WKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGK---LCETIICITMLEGSLVNMPDSSFIYSI-FKIEDARYLNAQLDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD*TLIFINPI 1848
            +S+NL      +K F   +K  L +N  F D  F P    L+ S     KF+WKRP EI +NPQFI  G +R D+ QG LGDCW LAAI  L+L+  ++ +VI  DQ F  +Y G F F+ WR G W DV++DD LPT N +LV+  SS  +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ + + L  K +P+ ++++M KA    S++ C I+    +     G F P P N + ++                               +K   S G     TN +           +P +P  T  PVQ E ++  GL++GHAYSVT V+E   L+G+ I LVR+RNPWG +VEW G        W  +   E+  L+     DGEFWMS+ DF+  F+  EIC +T D +++ + Q W      G+W +   +       D +  NPQYR  +L  + DP     +C  ++ + M +    +    + +++I F I +    N  L  +FF  N+S  K + +++   +C R RLPP  YVIIPST     E +F+LR+  E     E V+  +    PI
Sbjct:   38 ISRNLPIIGGREKTFEELRKKCLQRNFHFQDREFPPDESSLFYSQSFPIKFEWKRPPEICENPQFILGGANRTDICQGDLGDCWFLAAIACLTLNEKVLFRVIPPDQNFTDNYAGIFHFQFWRYGDWVDVIIDDYLPTYNNELVFTKSSQRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEL--KEAPKDMYNIMKKAFERGSLIGCSIDD---KYGSSCG-FAP-PSNMEDAI-------------------------------MKMIESVGDTRPDTNGR----------GQPPKPVATLVPVQLETRMANGLVKGHAYSVTGVEE---LKGKPIKLVRLRNPWG-QVEWNG--------WAFVLS-EKTRLQHQVQEDGEFWMSYDDFMKNFTKAEICNLTPDALDSDSLQVWTVSVNEGRWVRGCSAGGCRNYPDTYWTNPQYRLKLLEEDDDPADNEVVCSFVVAL-MQKNRRKDRKAGANLFTIGFAIYEMHGNNQHLQKDFFLYNASKAKCKSYINMREVCQRFRLPPSEYVIIPSTYEPHQEGEFILRVFSEKRNISEEVENKIEAEKPI 566          
BLAST of Calpain vs. Ensembl Xenopus
Match: CAPN3 (calpain 3 [Source:NCBI gene;Acc:100497532])

HSP 1 Score: 294.664 bits (753), Expect = 6.991e-89
Identity = 202/564 (35.82%), Postives = 292/564 (51.77%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFFCPSNDLL-----YCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPR-IWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKIVKEPNEPWGT--PVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQ-INLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSD-INTGNKQ-WKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGK---LCETIICITMLEGSLVNMPDSSFIYSI-FKIEDARYLNAQLDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCE 1794
            F + K   + K +LF DP F P+   L        S  L    WKRP EI +NPQFI  G +R D+ QG LGDCW LAAI  L+L+  ++ +VI  DQ F  +Y G F F+ WR G W DV++DD LPT N +LV+  SS  +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ + + L  K +P+ ++++M KA    S++ C I+    +     G F P P N + ++                               +K   S G     TN +           +P +P  T  PVQ E ++  GL++GHAYSVT V+E   L+G+ I LVR+RNPWG +VEW G        W  +   E+  L+     DGEFWMS+ DF+  F+  EIC +T D +++ + Q W      G+W +   +       D +  NPQYR  +L  + DP     +C  ++ + M +    +    + +++I F I +    N  L  +FF  N+S  K + +++   +C R RLPP  YVIIPST     E +F+LR+  E
Sbjct:   37 FATLKSEFVGKKKLFEDPIFLPAVQSLGQKEFAQKSTKLKNIIWKRPKEICENPQFILGGANRTDICQGDLGDCWFLAAIACLTLNEKVLFRVIPPDQNFTDNYAGIFHFQFWRYGDWVDVIIDDYLPTYNNELVFTKSSQRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEL--KEAPKDMYNIMKKAFERGSLIGCSIDD---KYGSSCG-FAP-PSNMEDAI-------------------------------MKMIESVGDTRPDTNGR----------GQPPKPVATLVPVQLETRMANGLVKGHAYSVTGVEE---LKGKPIKLVRLRNPWG-QVEWNG--------WAFVLS-EKTRLQHQVQEDGEFWMSYDDFMKNFTKAEICNLTPDALDSDSLQVWTVSVNEGRWVRGCSAGGCRNYPDTYWTNPQYRLKLLEEDDDPADNEVVCSFVVAL-MQKNRRKDRKAGANLFTIGFAIYEMHGNNQHLQKDFFLYNASKAKCKSYINMREVCQRFRLPPSEYVIIPSTYEPHQEGEFILRVFSE 538          
BLAST of Calpain vs. Ensembl Mouse
Match: Capn1 (calpain 1 [Source:MGI Symbol;Acc:MGI:88263])

HSP 1 Score: 248.054 bits (632), Expect = 5.506e-72
Identity = 179/579 (30.92%), Postives = 265/579 (45.77%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFFCP-SNDL----LYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKI-VKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGN--KQWKTYNEFGKWSQNLGSD-------NFHLNPQYRFTILVNEKDPG-------KLCETIICITMLEGSLVNMPD---SSFIYSIFKIEDARYLNAQ---LDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            + + +   L    LF D  F P S+ L    L   S      +WKRP E+  NPQFI DG +R D+ QG LGDCWLLAAI SL+L+  ++++V+   Q F   Y G F F+LW+ G W DVV+DD LPT++GKLV++HS+  +EFWSALLEKA+AK+ GSY+ L GG + +A E  TGG+ + + L  KA   ++ +++KA    S++ C IN                        I++ +   AI+F                       +  G+ YS T  K +     ++ +     PWG                                    V  + PW          SD+S EWN ++  ER+ L +    DGEFWMSF+DFI  F+ LEIC +T D       + W T    G W +   +         F +NPQ  F I + E D           C  ++ +                +  ++++++   R L  Q   L  +FF  N+S  + E F++   + +R RLPPG Y+++PST     E DFLLR   E +   + +D
Sbjct:   42 YETLRARCLQSGVLFQDEAFPPVSHSLGFKELGPHSSKTYGIKWKRPTELMSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNETILHRVVPYGQSFQDGYAGIFHFQLWQFGEWVDVVIDDLLPTKDGKLVFVHSAQGNEFWSALLEKAYAKVNGSYEALSGGCTSEAFEDFTGGVTEWYDL-QKAPSDLYQIILKALERGSLLGCSIN------------------------ISDIRDLEAITF---------------------KNLVRGHAYSVTGAKQVTYQGQRVNLIRMRNPWGE-----------------------------------VEWKGPW----------SDSSYEWNKVDPYEREQLRVKM-EDGEFWMSFRDFIREFTKLEICNLTPDALKSRTLRNWNTTFYEGTWRRGSTAGGCRNYPATFWVNPQ--FKIRLEEVDDADDYDNRESGCSFLLALMQKHRRRERRFGRDMETIGFAVYQV--PRELAGQPVHLKRDFFLANASRAQSEHFINLREVSNRIRLPPGEYIVVPSTFEPNKEGDFLLRFFSEKKAGTQELD 524          
BLAST of Calpain vs. Ensembl Mouse
Match: Capn1 (calpain 1 [Source:MGI Symbol;Acc:MGI:88263])

HSP 1 Score: 248.054 bits (632), Expect = 5.506e-72
Identity = 179/579 (30.92%), Postives = 265/579 (45.77%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFFCP-SNDL----LYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKI-VKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGN--KQWKTYNEFGKWSQNLGSD-------NFHLNPQYRFTILVNEKDPG-------KLCETIICITMLEGSLVNMPD---SSFIYSIFKIEDARYLNAQ---LDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            + + +   L    LF D  F P S+ L    L   S      +WKRP E+  NPQFI DG +R D+ QG LGDCWLLAAI SL+L+  ++++V+   Q F   Y G F F+LW+ G W DVV+DD LPT++GKLV++HS+  +EFWSALLEKA+AK+ GSY+ L GG + +A E  TGG+ + + L  KA   ++ +++KA    S++ C IN                        I++ +   AI+F                       +  G+ YS T  K +     ++ +     PWG                                    V  + PW          SD+S EWN ++  ER+ L +    DGEFWMSF+DFI  F+ LEIC +T D       + W T    G W +   +         F +NPQ  F I + E D           C  ++ +                +  ++++++   R L  Q   L  +FF  N+S  + E F++   + +R RLPPG Y+++PST     E DFLLR   E +   + +D
Sbjct:   42 YETLRARCLQSGVLFQDEAFPPVSHSLGFKELGPHSSKTYGIKWKRPTELMSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNETILHRVVPYGQSFQDGYAGIFHFQLWQFGEWVDVVIDDLLPTKDGKLVFVHSAQGNEFWSALLEKAYAKVNGSYEALSGGCTSEAFEDFTGGVTEWYDL-QKAPSDLYQIILKALERGSLLGCSIN------------------------ISDIRDLEAITF---------------------KNLVRGHAYSVTGAKQVTYQGQRVNLIRMRNPWGE-----------------------------------VEWKGPW----------SDSSYEWNKVDPYEREQLRVKM-EDGEFWMSFRDFIREFTKLEICNLTPDALKSRTLRNWNTTFYEGTWRRGSTAGGCRNYPATFWVNPQ--FKIRLEEVDDADDYDNRESGCSFLLALMQKHRRRERRFGRDMETIGFAVYQV--PRELAGQPVHLKRDFFLANASRAQSEHFINLREVSNRIRLPPGEYIVVPSTFEPNKEGDFLLRFFSEKKAGTQELD 524          
BLAST of Calpain vs. Ensembl Mouse
Match: Capn1 (calpain 1 [Source:MGI Symbol;Acc:MGI:88263])

HSP 1 Score: 244.588 bits (623), Expect = 8.458e-71
Identity = 177/579 (30.57%), Postives = 264/579 (45.60%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFFCP-SNDL----LYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKI-VKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGN--KQWKTYNEFGKWSQNLGSD-------NFHLNPQYRFTILVNEKDPG-------KLCETIICITMLEGSLVNMPD---SSFIYSIFKIEDARYLNAQ---LDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            + + +   L    LF D  F P S+ L    L   S      +WKRP E+  NPQFI DG +R D+ QG LGDCWLLAAI SL+L+  ++++V+   Q F   Y G F F+LW+ G W DVV+DD LPT++GKLV++HS+  +EFWSALLEKA+AK+ GSY+ L GG + +A E  TGG+ + + L  KA   ++ +++KA    S++ C IN                        I++ +   AI+F                       +  G+ YS T  K +     ++ +     PWG                                    V  + PW +          +S EWN ++  ER+ L +    DGEFWMSF+DFI  F+ LEIC +T D       + W T    G W +   +         F +NPQ  F I + E D           C  ++ +                +  ++++++   R L  Q   L  +FF  N+S  + E F++   + +R RLPPG Y+++PST     E DFLLR   E +   + +D
Sbjct:   42 YETLRARCLQSGVLFQDEAFPPVSHSLGFKELGPHSSKTYGIKWKRPTELMSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNETILHRVVPYGQSFQDGYAGIFHFQLWQFGEWVDVVIDDLLPTKDGKLVFVHSAQGNEFWSALLEKAYAKVNGSYEALSGGCTSEAFEDFTGGVTEWYDL-QKAPSDLYQIILKALERGSLLGCSIN------------------------ISDIRDLEAITF---------------------KNLVRGHAYSVTGAKQVTYQGQRVNLIRMRNPWGE-----------------------------------VEWKGPWSD----------SSYEWNKVDPYEREQLRVKM-EDGEFWMSFRDFIREFTKLEICNLTPDALKSRTLRNWNTTFYEGTWRRGSTAGGCRNYPATFWVNPQ--FKIRLEEVDDADDYDNRESGCSFLLALMQKHRRRERRFGRDMETIGFAVYQV--PRELAGQPVHLKRDFFLANASRAQSEHFINLREVSNRIRLPPGEYIVVPSTFEPNKEGDFLLRFFSEKKAGTQELD 524          
BLAST of Calpain vs. Ensembl Mouse
Match: Capn8 (calpain 8 [Source:MGI Symbol;Acc:MGI:2181366])

HSP 1 Score: 184.496 bits (467), Expect = 1.242e-51
Identity = 101/222 (45.50%), Postives = 138/222 (62.16%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFF--CPS----NDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQ 819
            F + +K  L+   LF DP F  CPS     DL   S++      WKRP E+  NPQFI  G +R D+ QG LGDCWLLAAI SL+L+  L+ +V+  DQ F K+Y G F F+ W+ G W +VV+DDRLPT+NG+L+++HS   +EFWSALLEKA+AKL GSY+ L GG + +  E  TGGI + + L  K    ++  + KA    S++ C I+ S    A+
Sbjct:   32 FETLRKQCLNSGVLFKDPEFPACPSALGYRDLGPGSAE-TQGIIWKRPTELCSNPQFIVGGATRTDIRQGGLGDCWLLAAIASLTLNEKLLYRVVPRDQSFQKNYAGIFHFQFWQYGEWVEVVIDDRLPTKNGQLLFLHSEEGNEFWSALLEKAYAKLNGSYEALAGGSTIEGFEDFTGGISEFYDL-RKPPGNLYYTIQKALRKGSLLGCSIDVSNAAEAE 251          

HSP 2 Score: 98.2117 bits (243), Expect = 1.691e-21
Identity = 51/101 (50.50%), Postives = 66/101 (65.35%), Query Frame = 1
Query: 1072 VQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSD 1374
             + E      L++GHAYSVT V+EV        L+R+RNPWG EVEW GA+SD++PEWN I+  ++KG       DGEFWMSF DF+  FS LEIC ++ D
Sbjct:  248 AEAEATTRQKLVKGHAYSVTGVEEVDFRGLPEKLIRLRNPWG-EVEWTGAWSDSAPEWNYIDP-QKKGELDKRAEDGEFWMSFSDFLKQFSRLEICNLSPD 346          
BLAST of Calpain vs. Ensembl Mouse
Match: Capn3 (calpain 3 [Source:MGI Symbol;Acc:MGI:107437])

HSP 1 Score: 187.963 bits (476), Expect = 2.928e-50
Identity = 98/211 (46.45%), Postives = 133/211 (63.03%), Query Frame = 1
Query:  163 KKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPIN 795
            +K F   ++  L K  L+ DP F P    L+ S     +F WKRP EI +NP+FI  G +R D+ QG LGDCW LAAI  L+L+  L+ +VI  DQ F ++Y G F F+ WR G W DVV+DD LPT N +LV+  S++ +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ + F +   A   ++ +M KA    S+M C I+
Sbjct:   58 EKTFEQLRRKCLEKKVLYLDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIGGANRTDICQGDLGDCWFLAAIACLTLNERLLFRVIPHDQSFTENYAGIFHFQFWRYGDWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFFEI-KDAPSDMYKIMRKAIERGSLMGCSID 267          

HSP 2 Score: 146.362 bits (368), Expect = 3.750e-36
Identity = 90/280 (32.14%), Postives = 146/280 (52.14%), Query Frame = 1
Query: 1066 TPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNK--QWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDS--------SFIYSIFKIEDARYLNAQ-LDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD*TLIFINPI 1848
             PVQ E ++  GL++GHAYSVT ++E      ++ LVR+RNPWG +VEW G++SD   +W+ +++ E+  L+     DGEFWMS+ DF+ +F+ LEIC +T+D    +K   W      G+W +   +       D F  NPQYR  +L  + D       +IC  ++     N            +  ++I+++    + N Q L  +FF  N+S  + + +++   +  R RLPP  YVI+PST     E +F+LR+  E     E  + T+    P+
Sbjct:  270 VPVQYETRMACGLVKGHAYSVTGLEEALFKGEKVKLVRLRNPWG-QVEWNGSWSDGWKDWSFVDKDEKARLQHQVTEDGEFWMSYDDFVYHFTKLEICNLTADALESDKLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDD--PEDSEVICSFLVALMQKNRRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEAENTISVDRPV 546          
BLAST of Calpain vs. UniProt/SwissProt
Match: sp|P43368|CAN3_PIG (Calpain-3 OS=Sus scrofa OX=9823 GN=CAPN3 PE=2 SV=2)

HSP 1 Score: 308.916 bits (790), Expect = 8.514e-93
Identity = 203/589 (34.47%), Postives = 302/589 (51.27%), Query Frame = 1
Query:  163 KKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPR-IWDVMVKASHMESIMCCPIN------HSQVQLAQKLGLFIPN-PKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKIVKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNK--QWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDSSFI--------YSIFKIEDARYLNAQ-LDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD*TLIFINPI 1848
            +K F    K  L K  L+ DP F P    L+ S     +F WKRP EI +NP+FI  G +R D+ QG LGDCW LAAI  L+L+  L+ +VI  DQ F ++Y G F F+ WR G W DVV+DD LPT N +LV+  S++ +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ + F +  K +PR ++ +M KA    S+M C I+      +       K+G  I    +N D+S +   +    I   C            +  +P +T +                               PVQ E ++  GL++GHAYSVT ++E      ++ LVR+RNPWG +VEW G++SD+  +W+ +++ E+  L+     DGEFWMS+ DFI +F+ LEIC +T+D    +K   W      G+W +   +       D F  NPQYR  +L  + D       +IC  ++     N      +        ++I+++    + N Q L  +FF  N+S  +   +++   +  R RLPP  YVI+PST     E +F+LR+  E     E V+ T+    P+
Sbjct:   57 EKTFEQLHKKCLEKKVLYLDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIGGANRTDICQGDLGDCWFLAAIACLTLNKRLLFRVIPHDQSFTENYAGIFHFQFWRYGDWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFFEI--KDAPRDMYKIMKKAIERGSLMGCSIDDGTNMTYGTSPSGLKMGDLIARMVRNMDESRL---RDSDLIPEGC------------SDDRPTRTIV-------------------------------PVQFETRMACGLVKGHAYSVTGLEEALFKGEKVKLVRLRNPWG-QVEWNGSWSDSWKDWSFVDKDEKARLQHQVTEDGEFWMSYDDFIYHFTKLEICNLTADALESDKLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDD--PDDSEVICSFLVALMQKNRRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSRTYINMREVSERFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPV 594          
BLAST of Calpain vs. UniProt/SwissProt
Match: sp|Q92177|CAN3_CHICK (Calpain-3 OS=Gallus gallus OX=9031 GN=CAPN3 PE=2 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 3.316e-91
Identity = 203/572 (35.49%), Postives = 294/572 (51.40%), Query Frame = 1
Query:  163 KKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPR-IWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKIVKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNK--QWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGK---LCETIICITMLEGSLVNMPDSSFIYSI-FKI----EDARYLNAQLDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            +K +    K  L +N L+ DP F P+   L+ S     KF+WKRP EI +NP+FI  G +R D+ QG LGDCW LAAI  L+L+  L+ +VI  DQ F ++Y G F F+ WR G W DV++DD LPT N +LV+  SS  +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+I+ + +  K +P+ I+ +M  A    S+M   I+ +       LG        SD   I E   +   +         ++  + T  +P  T +   Y                               E ++  GL++GHAYSVT V+E      ++ LVR+RNPWG +VEW G +SD S EWN I+E E+  L+     DGEFW+S +DF+ +F+ LEIC +T D    +K   W      G+W +   +       D F  NPQYR  +L  + DP     +C  ++ + M +         + +Y+I F I    ++       L  +FF  N+S  + + +++   I  R RLPP  YVIIPST     E +F+LR+  E     E V+
Sbjct:   52 EKTYEELHKKCLEENILYEDPDFPPNETSLFYSQKVPIKFEWKRPREICENPRFIIGGANRTDICQGELGDCWFLAAIACLTLNKKLLCRVIPHDQSFIQNYAGIFHFQFWRYGDWVDVIIDDCLPTYNNQLVFTKSSQRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVIEFYEI--KDAPKDIYKIMKHAIARGSLMASSIDDN-------LGFHYGAAPRSD---IGELIARMVKNLENAQMTYSTVDYQGTDERPAWTIMPMQY-------------------------------ETRMSCGLVKGHAYSVTAVEETTYKGEKMRLVRLRNPWG-QVEWNGPWSDKSEEWNFIDEEEKIRLQHKIAEDGEFWISLEDFMRHFTKLEICNLTPDTLEADKLQTWTVSVNEGRWVRGCSAGGCRNYPDTFWTNPQYRLKLLEEDDDPEDEEVICSFLVAL-MQKNRRKERKLGANLYTIGFAIYEVPKEMHGTKHHLQKDFFLYNASKARSKTYINMREISERFRLPPSEYVIIPSTYEPHQEGEFILRVFSEKRSLSEEVE 578          
BLAST of Calpain vs. UniProt/SwissProt
Match: sp|Q9TTH8|CAN3_SHEEP (Calpain-3 OS=Ovis aries OX=9940 GN=CAPN3 PE=2 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 2.898e-88
Identity = 198/589 (33.62%), Postives = 296/589 (50.25%), Query Frame = 1
Query:  163 KKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPR-IWDVMVKASHMESIMCCPIN------HSQVQLAQKLGLFIPN-PKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKIVKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNK--QWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDSSFI--------YSIFKIEDARYLNAQ-LDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD*TLIFINPI 1848
            +K F    +  L K  LF DP F P    L+ S     +F WKRP EI +NP+FI  G +R D+ QG LGDCW LAAI  L+L+  L+ +VI  DQ F ++Y G F F+ WR G W DVV+DD LPT N +LV+  S++ +EFWSALLEKA+AKL GSY+ L  G + + ME  TG + + F +  K +PR ++ +M KA    S+M C I+      +       K+G  I    +N D S +   +    I   C            +  +P +T +   Y                               E ++  GL++GHAYSVT ++E      ++ LVR+RNPWG +VEW G++SD+  +W+ +++ E+  L+     DGEFWMS+ DFI +F+ LEIC +T+D    +K   W      G+W +   +       D F  NPQYR  +L  + D       +IC  ++     N      +        ++I+++    + N Q L  +FF  N+S  +   +++   +  R RLPP  YVI+PST     E +F+LR+  E     E V+ T+    P+
Sbjct:   58 EKTFEQLHRKCLEKKVLFVDPEFPPDETSLFYSQKFPIQFIWKRPPEICENPRFIIGGANRTDICQGDLGDCWFLAAIACLTLNERLLFRVIPHDQSFTENYAGIFHFQFWRYGDWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKAGNTTEGMEDFTGELTEFFEI--KDAPRDMYKIMKKAIERGSLMGCSIDDGTNMTYGTSPSGLKMGELIERMVRNMDNSRL---RDSDLIPEGC------------SDDRPTRTIVPVQY-------------------------------ETRMACGLVKGHAYSVTGLEEALYKGEKVKLVRLRNPWG-QVEWNGSWSDSWKDWSYVDKDEKARLQHQVTEDGEFWMSYDDFIYHFTKLEICNLTADALESDKLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDD--PDDSEVICSFLVALMQKNRRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSRTYINMREVSERFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPV 595          
BLAST of Calpain vs. UniProt/SwissProt
Match: sp|Q9GLG7|CAN3_MACFA (Calpain-3 OS=Macaca fascicularis OX=9541 GN=CAPN3 PE=2 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 9.397e-78
Identity = 186/581 (32.01%), Postives = 287/581 (49.40%), Query Frame = 1
Query:  163 KKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKIVKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNK--QWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDS--------SFIYSIFKIEDARYLNAQ-LDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD*TLIFINPI 1848
            +K F    K  L K  L+ DP F P    L+ S     +F WKRP EI +NP+FI DG +R D+ QG LGDCW LAAI  L+L+  L+ +VI  DQ F ++Y G F F+ WR G W DVV+DD LPT N +LV+  S++ +EFWSALLEKA       Y  L G  S++A++   G   +     +      +++    S M  IM        ++    +G  I +  N                 + +      +   +   + ++    D  L+  ++     ++    V+ P      PVQ E ++  GL+ GHAYSVT + EV     ++ LVR+RNPWG +VEW G++SD   +W+ +++ E+  L+     DGEFWMS++DFI +F+ LEIC +T+D    +K   W      G+W +   +       D F  NPQYR  +L  + D       +IC  ++     N            +  ++I+++    + N Q L  +FF  N+S  + + +++   +  R RLPP  YVI+PST     E +F+LR+  E     E V+ T+    P+
Sbjct:   58 EKTFEQLHKKCLEKKVLYVDPEFPPDETSLFYSQKFPIQFIWKRPPEICENPRFIIDGANRTDICQGDLGDCWFLAAIACLTLNQRLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKA-------YAKLHG--SYEALKG--GNTTEAMEDFTGGVTEFFEIRDAPSDMHKIM-----KKAIERGSLMGCSIDDGTN-----------------MTYGTSPSGLNMGELIARMVRN--MDNSLFRDSD-----LDPRASVERPTRTI-VPVQYETRMACGLVRGHAYSVTGLDEVLFKGEKVKLVRLRNPWG-QVEWNGSWSDGWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADALQSDKLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDD--PDDSEVICSFLVALMQKNRRKDRKLGANLFTIGFAIYEVPKEMHGNRQHLQKDFFLYNASRARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPV 594          
BLAST of Calpain vs. UniProt/SwissProt
Match: sp|P97571|CAN1_RAT (Calpain-1 catalytic subunit OS=Rattus norvegicus OX=10116 GN=Capn1 PE=1 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 3.287e-72
Identity = 181/571 (31.70%), Postives = 265/571 (46.41%), Query Frame = 1
Query:  196 LSKNQLFHDPFFCP-SNDL----LYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKI-VKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGN--KQWKTYNEFGKWSQNLGSD-------NFHLNPQYRFTILVNEKDPG-------KLCETIICITMLEGSLVNMPD---SSFIYSIFKIEDARYLNAQ---LDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            L    LF D  F P S+ L    L  +S      +WKRP E+  NPQFI DG +R D+ QG LGDCWLLAAI SL+L+  ++++V+   Q F + Y G F F+LW+ G W DVVVDD LPT++GKLV++HS+  +EFWSALLEKA+AK+ GSY+ L GG + +A E  TGG+ + + L  KA   ++ +++KA    S++ C IN                        I++ +   AI+F                       +  G+ YS T+ K +     ++ +     PWG                                    V  + PW          SDNS EWN ++  ER+ L +    DGEFWMSF+DFI  F+ LEIC +T D       + W T    G W +   +         F +NPQ  F I + E D           C  ++ +                +  ++++++   R L  Q   L  +FF  N+S  + E F++   + +R RLPPG Y+++PST     E DFLLR   E +   + +D
Sbjct:   50 LQNGVLFQDDAFPPVSHSLGFKELGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNETILHRVVPYGQSFQEGYAGIFHFQLWQFGEWVDVVVDDLLPTKDGKLVFVHSAQGNEFWSALLEKAYAKVNGSYEALSGGCTSEAFEDFTGGVTEWYDL-QKAPSDLYQIILKALERGSLLGCSIN------------------------ISDIRDLEAITF---------------------KNLVRGHAYSVTDAKQVTYQGQRVNLIRMRNPWGE-----------------------------------VEWKGPW----------SDNSYEWNKVDPYEREQLRVKM-EDGEFWMSFRDFIREFTKLEICNLTPDALKSRTLRNWNTTFYEGTWRRGSTAGGCRNYPATFWVNPQ--FKIRLEEVDDADDYDSRESGCSFLLALMQKHRRRERRFGRDMETIGFAVYQV--PRELAGQPVHLKRDFFLANASRAQSEHFINLREVSNRIRLPPGEYIVVPSTFEPNKEGDFLLRFFSEKKAGTQELD 524          
BLAST of Calpain vs. TrEMBL
Match: A0A310SH88 (Calpain-B OS=Eufriesea mexicana OX=516756 GN=WN48_06682 PE=3 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 6.093e-100
Identity = 203/567 (35.80%), Postives = 292/567 (51.50%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKIVKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEIC------YVTSDINTGNKQWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDSSFI---YSIFKIEDARYLNAQLDSEFFKTNSSYLKY-EFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            FN+ K+  LS   LF DP F  ++  LY S       +WKRP+EI  NPQ   +G SRFDV QG LGDCWLLAA+ +L++D NL  QV+  DQ F+++YVG F FR W+ G W DVV+DDRLPT  G+L+Y+HS+ ++EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ +++++  +  P ++++++KA    S+M C I               P+P     +++     +  I                            G+ YS T  KH++I      + PN+    P+ R                                 +RNPWGNE EW G +SD SPEW  I + E+  L L F+ DGEFWMSFQDF  YF+ LEIC         SD++ G K+W+     G+W + + +       + F  NPQYR T+   ++D  K C  I+ +            +  +   ++I+ ++    L   LD  FFK N+S  +   F++   +  R +LPPG Y I+PST     E +FLLRI  E + +ME  D
Sbjct:   52 FNTLKRECLSTGTLFEDPEFPANDSSLYFSKRPDRYIEWKRPMEIADNPQLFVEGFSRFDVQQGELGDCWLLAAVANLTMDQNLFFQVVPEDQSFEENYVGIFHFRFWQYGRWVDVVIDDRLPTYRGELLYLHSAEVNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTEMYQM-DETPPNLFNILLKAYERNSLMGCSIE--------------PDP-----NILEAETPQGLIR---------------------------GHAYSITRVKHVEI------QTPNQYGRIPLLR---------------------------------LRNPWGNEAEWNGPWSDQSPEWRFIPDHEKDELGLTFDMDGEFWMSFQDFTRYFTQLEICNLNPDSLTESDLSAGKKKWEMSVFEGEWVRGVTAGGCRNFLETFWHNPQYRITLEYPDEDDDK-CTVIVALMQKNRRAQRRMGADCLTIGFAIYHLDYPERLPKPLDVNFFKYNASVARSPAFINLREVTCRFKLPPGVYCIVPSTFDPNEEGEFLLRIFSENKNNMEEND 531          
BLAST of Calpain vs. TrEMBL
Match: E2ADL6 (Calpain-A OS=Camponotus floridanus OX=104421 GN=EAG_10351 PE=3 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 2.087e-99
Identity = 202/567 (35.63%), Postives = 290/567 (51.15%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKIVKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEIC------YVTSDINTGNKQWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDSSFI---YSIFKIEDARYLNAQLDSEFFKTNSSYLKY-EFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            FN+ ++  L+  +LF DP F   +  LY S       +WKRP+EI  NPQ   +G SRFDV QG LGDCWLLAA+ +L++ SNL  QV+  DQ F+++Y G F FR W+ G W DVV+DDRLPT  G+LVY+HS+  +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ +++++  +  P ++++++KA    S++ C I               P+P     +++     +  I                            G+ YS T+ KH++I              TP Q                           G I L+R+RNPWGNE EW G +SD SPEW  I + E++ L L F+ DGEFWMSF DF  +F+ LEIC          DI+ G K+W+     G+W + + +       + F  NPQYR T+   + D  K C  I+ +            +  +   ++I+ +E    L   LD  FFK N+S  +   F++   +  R +LPPG Y I+PST     E +FLLRI  E + +ME  D
Sbjct:   41 FNTLRRECLATGRLFEDPEFLADDSSLYFSRRPDRYIEWKRPMEIVDNPQLFVEGFSRFDVQQGELGDCWLLAAVANLTMHSNLFFQVVPEDQSFEENYAGIFHFRFWQYGRWVDVVIDDRLPTCRGELVYLHSAESNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTEMYQM-DQTPPNLFNILLKAFERNSLLGCSIE--------------PDP-----NILEAETPQGLIR---------------------------GHAYSITHVKHVEIQ-------------TPNQH--------------------------GTIPLLRLRNPWGNEAEWNGPWSDQSPEWRFIPDHEKEELGLTFDMDGEFWMSFHDFTRHFTQLEICNLNPDSLTADDIDAGKKRWEMSVFEGEWVRGVTAGGCRNYLETFCHNPQYRITLEYPDDDDDK-CTVIVALMQKNRRAQKRMGADCLTIGFAIYHLEYPERLPKPLDINFFKYNASVGRSPAFINLREVTCRFKLPPGVYCIVPSTFDPNEEGEFLLRIFSENKNNMEEND 520          
BLAST of Calpain vs. TrEMBL
Match: A0A026WP62 (Calpain-B OS=Ooceraea biroi OX=2015173 GN=X777_00848 PE=3 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 2.714e-99
Identity = 202/567 (35.63%), Postives = 291/567 (51.32%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKIVKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSD------INTGNKQWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDSSFI---YSIFKIEDARYLNAQLDSEFFKTNSSYLKY-EFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            FN  ++  L+  +LF DP F  ++  LY S       +WKRP+EI  NPQF  +G SRFDV QG LGDCWLLAA+ +L++  NL  QV+  DQ FD++Y G F FR W+ G W DVV+DDRLPT  G+L+Y+HS+  DEFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ +++++  +  P ++++++KA    S++ C I               P+P     +V+     +  I                            G+ YS T  KH++I      + PN+    P                                 L+R+RNPWGNE EW G +SD SPEW  I + E++ L L F+ DGEFWMSF DF+ +F+ LEIC +  D      +N G K+W+     G+W + + +       + F  NPQYR T+   + D  K C  I+ +            +  +   ++I+ +E+   L   LD  FFK N S  +   F++   +  R +LPPG Y I+PST     E +FLLRI  E + +ME  D
Sbjct:   77 FNVLRRECLASGRLFEDPEFPANDSSLYFSRRPDRYIEWKRPMEIADNPQFFVEGFSRFDVQQGELGDCWLLAAVANLTMHPNLFFQVVPEDQSFDENYAGIFHFRFWQYGRWVDVVIDDRLPTFRGELMYLHSAENDEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTEMYQM-DQTPPNLFNILLKAFERNSLLGCSIE--------------PDP-----NVVEAETPQGLIR---------------------------GHAYSVTRVKHVEI------QTPNQIGTIP---------------------------------LLRLRNPWGNEAEWNGPWSDKSPEWRFIPDHEKEELGLTFDMDGEFWMSFHDFVRHFTQLEICNLNPDSLTIDELNAGKKRWEMSVFEGEWVRGVTAGGCRNYLETFWHNPQYRITLECPDDDDDK-CTVIVALMQKNRRAQKRMGADCLTIGFAIYHLENPERLPKPLDMSFFKYNPSIGRSPAFINLREVTCRFKLPPGVYCIVPSTFDPNEEGEFLLRIFSENKNNMEEND 556          
BLAST of Calpain vs. TrEMBL
Match: E9IT45 (Uncharacterized protein (Fragment) OS=Solenopsis invicta OX=13686 GN=SINV_03488 PE=3 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 3.452e-98
Identity = 205/580 (35.34%), Postives = 293/580 (50.52%), Query Frame = 1
Query:  133 FRVSKNLDDSKKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKIVKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEIC------YVTSDINTGNKQWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDSSFI---YSIFKIEDARYLNAQLDSEFFKTNSSYLKY-EFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            FR    + D    FN  ++  L+  +LF DP F  ++D LY S       +W+RP+EI  NPQ   +G SRFDV QG LGDCWLLAA+ +L++ SNL  Q++  DQ FD++Y G F FR W+ G W DVV+DDRLPT +GKL+Y+ S+  +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ +++++  +  P ++++++KA    S++ C I               P+P     +++     +  I                            G+ YS T  KH++I      + PN     P+ R                                 +RNPWGNE EW G +SD SPEW  I E E++ L L F+ DGEFWMSF DF+ +F+ LEIC        T DI+ G K+W+     G+W + + +       + F  NPQYR T L N  D    C  II +            +  +   ++I+ +E    L   LD  FFK N+S  +   F++   +  R +LPPG Y I+PST     E +FLLRI  E + +ME  D
Sbjct:   75 FRARGEVQD----FNKLRRECLATGRLFEDPEFPANDDSLYFSRRPDRYIEWRRPMEIADNPQLFVEGYSRFDVQQGELGDCWLLAAVANLTMHSNLFFQIVPEDQSFDENYAGIFHFRFWQYGRWVDVVIDDRLPTYHGKLMYLQSAETNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTEMYQM-DETPPNLFNILLKAFERNSLLGCSIE--------------PDP-----NILEAETPQGLIR---------------------------GHAYSITCVKHVEI------QMPNRQGTIPLLR---------------------------------LRNPWGNEAEWNGPWSDKSPEWRFIPEHEKEELGLTFDMDGEFWMSFHDFVRHFTQLEICNLNPDSLTTDDISIGKKRWEMSVFEGEWVRGVTAGGCRNFLETFCHNPQYRIT-LENPDDDDDKCTVIIALMQKNRRAQRRMGADCLTIGFAIYHLEYPDRLPKPLDVNFFKYNASVGRSPSFINLREVTCRFKLPPGVYCIVPSTFDPNEEGEFLLRIFSENKNNMEEND 563          
BLAST of Calpain vs. TrEMBL
Match: A0A452GPR9 (Calpain 3 OS=Gopherus agassizii OX=38772 GN=CAPN3 PE=3 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 4.287e-98
Identity = 212/580 (36.55%), Postives = 304/580 (52.41%), Query Frame = 1
Query:  163 KKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPR-IWDVMVKASHMESIMCCPINHS---------QVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKIVKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNK--QWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGK---LCETIICITMLEGSLVNMPDSSFI---YSIFKIEDARYLNAQ-LDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            +K F    K  L K  L+ DP F P+   L+ S     KF+WKRP EI +NP+FI  G +R D+ QG LGDCW LAAI  L+L+  L+ +VI  DQ F K+Y G F F+ WR G W DVV+DD LPT N +LV+  SS  +EFWSALLEKA+AKL GSY+ L GG + +AME  TGG+ + + +  K +P+ I+ +M  A    S+M C I+ +         Q  L + +   +       K+V + P+  S + F            + T  +P  T +                               P+Q E ++  GL++GHAYSVT V+E     G+I LVR+RNPWG +VEWKGA+SDNS EWN +++ E+  L+     DGEFWMSF DF+ YF+ LEIC +T D    +K   W      G+W +   +       D F  NPQYR  +L  + DP     +C  ++ +            ++ +   ++I+++    + N Q L  +FF  N+S  + + +++   I  R RLPP  YVIIPST     E +F+LR+  E     E V+
Sbjct:   52 EKTFEELHKKCLEKKILYVDPDFPPNESSLFYSQKVPIKFEWKRPTEICENPRFIIGGANRTDICQGELGDCWFLAAIACLTLNEKLLCRVIPHDQTFIKNYAGIFHFQFWRYGNWVDVVIDDCLPTYNNQLVFTKSSQRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEI--KDAPKDIYKIMKHAKDRGSLMACSIDDNMGFSYGTAPQTDLGKLIAQMV-------KNVNSMPRTDSTLDF------------QGTDERPAWTIV-------------------------------PMQLETRMTCGLVKGHAYSVTAVEETSFKAGKIKLVRLRNPWG-QVEWKGAWSDNSDEWNFVDKAEKIRLQYRIAEDGEFWMSFDDFMRYFTKLEICNLTPDTLEADKLQTWTVSVNEGRWVRGCSAGGCRNYPDTFWTNPQYRLELLEEDDDPEDNEVICSFLVALMQKNRRKERKLGANLLTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKSYINMREISERFRLPPNEYVIIPSTYEPHQEGEFILRVFSEKRSLSEEVE 578          
BLAST of Calpain vs. Ensembl Cavefish
Match: capn3b (calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149])

HSP 1 Score: 197.593 bits (501), Expect = 1.068e-53
Identity = 100/200 (50.00%), Postives = 129/200 (64.50%), Query Frame = 1
Query:  196 LSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPIN 795
            + K  LF DP F   +  LY +     K  WKRP EI KNPQFI  G +R D+ QG LGDCWLLAAI  L+L   L+ +V+  DQ F ++Y G F F+ WR G W DVVVDDRLPT N  LV+  S N +EFWSALLEKA+AKL G+Y+ L GG + +AME  TGG+ + + + S A   I+++M KA +  S+M C I+
Sbjct:   74 VRKKVLFKDPLFPADDSSLYYNQKFPLKLVWKRPSEICKNPQFIVGGANRTDICQGDLGDCWLLAAIACLTLSETLLYRVVPADQSFSENYAGIFHFQFWRYGEWVDVVVDDRLPTSNNHLVFTRSGNKNEFWSALLEKAYAKLHGTYEALKGGNTLEAMEDFTGGVTEFYEI-SDAPREIYNIMKKALNRGSLMGCSID 272          

HSP 2 Score: 115.161 bits (287), Expect = 3.830e-26
Identity = 82/259 (31.66%), Postives = 125/259 (48.26%), Query Frame = 1
Query: 1069 PVQREIKVDTGLIEGHAYSVTNVKEVCSLEG---QINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNK--QWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILV---NEKDPGKLCETIICITMLEGSLVNMPDSSFIYSI-FKIEDARYLNAQLDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCE 1794
            P   E K DTGL+ GHAYSVT V++    +G   +I LVR+R+PWG         S  S +W+++   E+    L     GEFWM F++F   F+ LEIC +T D    ++  +W      G+W +   +       D F  NPQYR  +     +E D G+   T++   M +G          + +I F I +       L  +FF   +S  + + +++   +  R  L PG YVI+PST     E+DF+LR+  E
Sbjct:  276 PSASETKTDTGLVRGHAYSVTAVEQGKQEDGSDTRIRLVRLRDPWG----VAPPPSRMSCDWSSLATSEQDQQRLKPVEAGEFWMGFEEFQQTFTKLEICNLTPDALQDDELLKWDVSVNEGRWVRGCSAGGCRNYPDTFWTNPQYRLRLTEEDDDEPDHGEKGCTVVVALMQKGRRRERCTGGTLLTIGFAIYEMHGNKQHLPKDFFLYTASKARCKSYINLREVTERFCLSPGEYVIVPSTFDPNNESDFILRVFSE 530          
BLAST of Calpain vs. Ensembl Cavefish
Match: capn2a (calpain-2 catalytic subunit-like [Source:NCBI gene;Acc:107197131])

HSP 1 Score: 188.734 bits (478), Expect = 5.072e-51
Identity = 94/214 (43.93%), Postives = 140/214 (65.42%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFF--CPSN---DLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPR-IWDVMVKASHMESIMCCPIN 795
            F + +   L++ QLF DP F  CP +   + L   S      QWKRP E+  +P+FI  G +R D+ QG LGDCWLLAAI SL+L+ +++++V+  DQ F  +Y G F F+ W+ G W DVV+DDRLPT +G+L+++HS+   EFWSALLEKA+AKL G Y+ L GG + +  E  TGGI +++ L  K++PR ++ ++ KA    +++ C I+
Sbjct:   32 FETLRSECLTRGQLFSDPTFPACPESLGFNELGPRSSKTRGVQWKRPGELTSSPEFIVGGATRTDICQGGLGDCWLLAAIASLTLNEDVLSRVVPSDQGFGDNYAGIFHFQFWQYGEWVDVVIDDRLPTRDGELLFVHSATGSEFWSALLEKAYAKLNGCYEALSGGSTTEGFEDFTGGIAEMYEL--KSAPRNMFQIIQKALESGALLGCSID 243          

HSP 2 Score: 132.494 bits (332), Expect = 6.715e-32
Identity = 91/267 (34.08%), Postives = 137/267 (51.31%), Query Frame = 1
Query: 1102 LIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGN--KQWKTYNEFGKW---SQNLGSDN----FHLNPQYRFTILVNEKDPGKL---CETIICITMLEGSLVNMPDSSFIYSIFKIEDARYLNAQ----LDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD*TLIFINPIN 1851
            L++GHAYSVT   EV     +  L+RIRNPWG +VEW GA+SDNS EWN+++  ER+ ++ +   DGEFWMSF +F  ++S LEIC +T D    +  K W      G W   S   G  N    F +NPQY+  +   + DP      C  +I +       +           + I + R  + Q    L  E+F T++   + E F++   + +R +LPPG Y+I+PST       DF +R+  E +  M  +D   I +N ++
Sbjct:  258 LVKGHAYSVTGATEVNFRGRKEKLIRIRNPWG-QVEWTGAWSDNSSEWNSVDPSERENVKAD---DGEFWMSFTEFSRHYSRLEICTLTPDTLASDSVKHWSVCKFDGSWRRGSTAGGCRNNPYTFWMNPQYKIKLDEEDDDPDDNEVGCSIVIGLIQKNRRKLRKSGEDMHTIGYAIYEVRGFHGQKEVHLSKEYFLTHAQKARSETFINLREVSTRFKLPPGEYLIVPSTFEPHKNGDFCVRVFSEKQSEMH-LDTCRIMVNLMD 519          
BLAST of Calpain vs. Ensembl Cavefish
Match: capn2a (calpain-2 catalytic subunit-like [Source:NCBI gene;Acc:107197131])

HSP 1 Score: 189.119 bits (479), Expect = 7.500e-51
Identity = 94/214 (43.93%), Postives = 140/214 (65.42%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFF--CPSN---DLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPR-IWDVMVKASHMESIMCCPIN 795
            F + +   L++ QLF DP F  CP +   + L   S      QWKRP E+  +P+FI  G +R D+ QG LGDCWLLAAI SL+L+ +++++V+  DQ F  +Y G F F+ W+ G W DVV+DDRLPT +G+L+++HS+   EFWSALLEKA+AKL G Y+ L GG + +  E  TGGI +++ L  K++PR ++ ++ KA    +++ C I+
Sbjct:   32 FETLRSECLTRGQLFSDPTFPACPESLGFNELGPRSSKTRGVQWKRPGELTSSPEFIVGGATRTDICQGGLGDCWLLAAIASLTLNEDVLSRVVPSDQGFGDNYAGIFHFQFWQYGEWVDVVIDDRLPTRDGELLFVHSATGSEFWSALLEKAYAKLNGCYEALSGGSTTEGFEDFTGGIAEMYEL--KSAPRNMFQIIQKALESGALLGCSID 243          

HSP 2 Score: 132.109 bits (331), Expect = 1.035e-31
Identity = 92/260 (35.38%), Postives = 137/260 (52.69%), Query Frame = 1
Query: 1102 LIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGN--KQWKTYNEFGKW---SQNLGSDN----FHLNPQYRFTILVNEKDPGKL---CETIICITM-----LEGSLVNMPDSSFIYSIFKI--EDARYLNAQLDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            L++GHAYSVT   EV     +  L+RIRNPWG +VEW GA+SDNS EWN+++  ER+ ++ +   DGEFWMSF +F  ++S LEIC +T D    +  K W      G W   S   G  N    F +NPQY+  +   + DP      C  +I +       L  S  +M   +  Y+I+++  E        L  E+F T++   + E F++   + +R +LPPG Y+I+PST       DF +R+  E +  M+  D
Sbjct:  258 LVKGHAYSVTGATEVNFRGRKEKLIRIRNPWG-QVEWTGAWSDNSSEWNSVDPSERENVKAD---DGEFWMSFTEFSRHYSRLEICTLTPDTLASDSVKHWSVCKFDGSWRRGSTAGGCRNNPYTFWMNPQYKIKLDEEDDDPDDNEVGCSIVIGLIQKNRRKLRKSGEDM--HTIGYAIYEVPPEFHGQKEVHLSKEYFLTHAQKARSETFINLREVSTRFKLPPGEYLIVPSTFEPHKNGDFCVRVFSEKQSEMQICD 511          
BLAST of Calpain vs. Ensembl Cavefish
Match: ENSAMXT00000014125.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000051.1:1440473:1447479:1 gene:ENSAMXG00000013724.2 transcript:ENSAMXT00000014125.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 178.718 bits (452), Expect = 8.714e-50
Identity = 95/215 (44.19%), Postives = 136/215 (63.26%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFFCPSNDLLYCS-----SDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHS 801
            F   +   L   QLF DP F  + + L  +     S      QW RP E+ +NPQFI DG +R DV QG LGDCWL+AAI SL+LD +++ +VI  +Q F ++Y G F F+LW+ G W DVVVDDRLPT NG+L+++HS + +EFW+ALLEKA+AK+  SY++L GG + +  E  TGGI + ++L S A   ++ +M +A    +++   I  S
Sbjct:   24 FEVLRSRCLRSGQLFCDPAFPAAPESLGFNELGPNSPKTAGVQWIRPGELCQNPQFIVDGATRTDVCQGSLGDCWLMAAIASLTLDRDVLARVIYPEQSFTENYAGIFHFQLWQYGQWVDVVVDDRLPTINGELLFVHSEDGNEFWTALLEKAYAKVNSSYESLKGGSAIEGFEDFTGGISERYQL-SNAPANLFKIMKQALRRGALLSTAIAVS 237          

HSP 2 Score: 78.5666 bits (192), Expect = 3.165e-15
Identity = 40/97 (41.24%), Postives = 63/97 (64.95%), Query Frame = 1
Query: 1102 LIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNF-NNDGEFWMSFQDFITYFSSLEICYVTSDINTGN 1389
            L++ HAYS+T  +EV      + L+R+RNPWG++ EW GA+SD S EW+ ++   +   +LN+  +DGEFWMS+ DF   +S +EIC +  +  + N
Sbjct:  247 LVKRHAYSITAAEEVQVGGRCVQLLRLRNPWGHK-EWSGAWSDESREWSKVSPEVKD--QLNYCADDGEFWMSYTDFKVEYSKVEICNLIPETPSNN 340          
BLAST of Calpain vs. Ensembl Cavefish
Match: capn8 (calpain 8 [Source:ZFIN;Acc:ZDB-GENE-050522-279])

HSP 1 Score: 184.882 bits (468), Expect = 1.317e-49
Identity = 106/270 (39.26%), Postives = 157/270 (58.15%), Query Frame = 1
Query:   55 KMAKNEQSRTVSMESNSETVTFDNTEFRVSKNLDDSKKWFNSQKKVLLSKNQLFHDPFF-CPSNDLLYCSSDHLDKFQ-------WKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPIN-----HSQVQLAQKL 825
            ++AK  Q +   + SN   + F+N ++              S ++  L +  LF DP F   S+ L Y   + L ++        WKRP E+  NP+FI +G +R D+ QG LGDCWLLAAI SL+LD++++ +V+   Q F + Y G F F+LW+ G W DVV+DDRLPT+NG+L+++HS    EFWSALLEKA+AKL  SY+ L GG + +     TGGI + + L  KA P +++++ KA    S++ C I+      S+    QKL
Sbjct:    7 ELAK-RQDKKEGLGSNDNAIPFNNQDYL-------------SLRRECLQRKTLFCDPTFPADSSSLGY---NQLGRYSSKTAGVVWKRPTELCSNPEFISNGATRMDIRQGALGDCWLLAAIASLTLDTDILARVVPPAQSFKEDYAGIFHFQLWQYGEWIDVVIDDRLPTKNGELLFVHSEEGSEFWSALLEKAYAKLNSSYEALSGGSTTEGFVDFTGGIAESYEL-RKAPPTLFNIIKKALSRGSMLGCSIDIANSYESEAMTRQKL 258          

HSP 2 Score: 126.331 bits (316), Expect = 7.880e-30
Identity = 81/248 (32.66%), Postives = 129/248 (52.02%), Query Frame = 1
Query: 1102 LIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDI--NTGNKQWKTYNEFGKW---SQNLGSDN----FHLNPQYRFTILVNEKDPGKL---CETIICITMLEGSL-----VNMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKYEFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCE 1794
            L++GHAYS+T  +EV      + LVR+RNPWG +VEW GA+SD+S EW+ +   E+  L+ +  +DGEFWM + DF+  +S +EIC +T D   + G  +W  Y   G W   S   G  N    F  NPQ+   +   + DP      C  ++ +   +G        ++    F   +F+ ++  +L   +     +  +  +   F++   +CSR +LPPG YVIIPST     + +F+LR+  E
Sbjct:  258 LVKGHAYSLTAAEEVHVSGRPVQLVRLRNPWG-QVEWTGAWSDDSKEWDRVLPEEKAKLDYS-ADDGEFWMEYSDFLNQYSKIEICNLTPDTLSSEGVCRWSCYQFEGSWKVGSTAGGCRNNPATFCSNPQFVIKLEEVDDDPHDGVDGCSFLVGLMQRDGRKERQFGRDLNTVGFAIYMFRGQNNIHLGPDV---LLRQRAIAMSDTFINLREVCSRFKLPPGEYVIIPSTFEPHRKGNFILRVFAE 500          
BLAST of Calpain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003998.1 (pep scaffold:Pmarinus_7.0:GL501031:16584:50555:1 gene:ENSPMAG00000003440.1 transcript:ENSPMAT00000003998.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 300.056 bits (767), Expect = 5.011e-92
Identity = 194/520 (37.31%), Postives = 276/520 (53.08%), Query Frame = 1
Query:  289 KRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKIVKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQ-INLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSD---INTGNKQWKTYNEFGKWSQNLG-------SDNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDS-----SFIYSIFKIE-DARYLNAQLDSEFFKTNSSYLK-YEFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCE 1794
            + P EI  NPQFI +G +R D+ QG LGDCWLLAAI SL+L   L+ +V+   Q F   Y G F F+ W+ G W DVV+DD LPT+N KL ++HS++ +EFWSALLEKA+AKL GSY+ L GG   +AME  TGG+ + + L  KA P ++ +M K     S+M C I+                   S    IN  K  +  +F  +S                    ++ +L S+       + + +++        +    E ++  GL++GHAYS+T + +V   EGQ + LVRIRNPWG EVEW GA+SDNS EW  ++  ER+ LE     DGEFWMSF DF   FS +EIC ++ D     +G++ W      G+W +          +  F  NPQ  F + ++E+D     + + C  ++     NM        +  Y+I++I   A      L  EFF  NSS  + + F++   +  R RLPPG+YVI+PST     EADFLLR+ CE
Sbjct:    1 RAPQEICYNPQFIVNGATRTDIKQGALGDCWLLAAIASLTLHPRLLARVVPEGQSFSDGYAGIFHFQFWQFGEWVDVVIDDLLPTQNNKLAFLHSTDRNEFWSALLEKAYAKLNGSYEALKGGSIAEAMEDFTGGVFEFYNL-KKAPPDLYRIMRKGLEKASMMGCSIDEGST-----------FKYRSTPRAINMSKMTA--TFRAWSSGI--------------RRFAERFLPSR-------LGHARLLASSGIEITSMFDLEARLPNGLVKGHAYSITGLDQVF-FEGQDVRLVRIRNPWG-EVEWNGAWSDNSWEWRVVDVSERRRLEQVRAEDGEFWMSFSDFKRNFSKMEICNLSPDTLRTQSGSRHWTVTAHEGRWLRGCTAGGCRNYAGTFWTNPQ--FHLRLHEEDDDPDDDEVACSFIVALMQKNMRRQKRDLLTIGYAIYEIPLKAPPGCTHLPGEFFVRNSSRARSHNFINLREVSDRFRLPPGHYVIVPSTYEPHQEADFLLRVYCE 481          
BLAST of Calpain vs. Ensembl Sea Lamprey
Match: capn3a (calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912-97])

HSP 1 Score: 298.901 bits (764), Expect = 8.805e-91
Identity = 193/575 (33.57%), Postives = 290/575 (50.43%), Query Frame = 1
Query:  151 LDDSKKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPR-IWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKIVKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNK--QWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGK---LCETIICITMLEGSLVNMPDSSFI---YSIFKI-EDARYLNAQLDSEFFKTNSSYLKY-EFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            +D   K F   + + LS + LF DP F   N+ +Y S +   +FQW RP E+   P+ I    +   + +G LGDCW+LAAI  ++++  L+ +VI   Q F+++Y G F F+ WR G W DVVVDDRLPT N +LV++ S+  +EFWSALLEKA+AK+ GSY+ L GG + +AME  TGG+ + F +  K  P+ ++ +MVKA+   S+M C I+     +  + G+  P+     +S ++ P                                           +HIQ+    I              E +   GL+  HAYS+T + EV      + LVR+RNPWG+ VEW G +SD S EWN I   E++ L+L    DGEFW+SFQDF   F+ LEIC ++ D    ++  +W      G+W +   +       D F  NPQYR  +   + DP     LC  I+ +            S+ +   ++I+++ E+ R     L  +FF  N+S  +   +++   +  R RLPPG YVI+PST     E +FLLR+  E     E +D
Sbjct:   46 IDTQGKSFEELRTLCLSHDVLFEDPDFPAHNNSIYFSQNAPMQFQWMRPKELCV-PRSIVIEANHTHICEGDLGDCWVLAAIACMTMNEELLARVIPAGQSFEENYAGIFHFQFWRFGEWVDVVVDDRLPTFNNQLVFVQSAERNEFWSALLEKAYAKVHGSYEALKGGNTTEAMEDFTGGVTEYFEM--KNPPKDLYKIMVKATSRRSLMGCSIDDG---MCWRCGVPAPDSIGLVRSNMSPPIL-----------------------------------------RHIQLTPIGIEDAKKRKIAMLTHAESRTPMGLVRNHAYSITGLDEVKHRSKIVQLVRLRNPWGH-VEWIGPWSDASKEWNEITPSEKQRLQLISAEDGEFWISFQDFCRNFTKLEICNLSPDALADDRTNKWTVSVSEGRWVRGCSAGGCRNYPDTFWTNPQYRLQLYDEDDDPDDNELLCSFIVALMQKNRRKERRQGSTMLTIGFAIYEVTEELRGSREHLPKDFFLYNASRARCNSYINLREVTERFRLPPGEYVIVPSTFEAHQEGEFLLRVFAEKHNVSEEMD 572          
BLAST of Calpain vs. Ensembl Sea Lamprey
Match: capn9 (calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2])

HSP 1 Score: 171.4 bits (433), Expect = 4.309e-46
Identity = 85/173 (49.13%), Postives = 116/173 (67.05%), Query Frame = 1
Query:  283 QWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLF--RLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPIN 795
            +W    EI +NP+FI DG +R D+ QG LGDCWLLAAI SL+L+  L+ +V+   Q F   Y G F F  + W  G W DV +DDRLPT+NG+LV++HS++  EFWSALLEKA++KL GSY+ L GG   +AME  TGG+ ++  L + A P ++ +M KA    S+M C I+
Sbjct:    3 KWGLSREIVQNPEFIVDGATRTDIKQGALGDCWLLAAIASLTLNDQLLAKVVPPGQNFRDGYAGIFHFQQKFWHFGEWMDVFIDDRLPTKNGQLVFVHSADKREFWSALLEKAYSKLNGSYEALKGGSIAEAMEDFTGGVYELLDLKT-APPDLFRIMCKARQKGSMMGCSID 174          

HSP 2 Score: 160.229 bits (404), Expect = 3.499e-42
Identity = 100/266 (37.59%), Postives = 141/266 (53.01%), Query Frame = 1
Query: 1075 QREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDI--NTGN-KQWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPG-----KLCETIICITMLEGSLVNMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKY-EFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCE-PELSMESVD 1821
            + E +   GL++GHAYS+T V EV     ++ L+RIRNPWG EVEW GA+SD++PEW  +++ ER  L+     DGEFWMSF DF+ +F+ +EIC +T D     G+ + W      G+W +   +       + F  NPQ+R   L NE D       K C  I+ +             +  Y+I+KI D       +  EFF  N+S  +   F++   +  R RLP G YVI+PST     EADFL+R+  E P  S ES D
Sbjct:  180 ESEARTSNGLVKGHAYSITGVDEVNYRGQKVKLLRIRNPWG-EVEWNGAWSDHAPEWKALDQGERNRLQQVMAEDGEFWMSFDDFMRHFTKMEICNLTPDRVEREGDPRYWTVTVHDGRWLKGCTAGGCRNFPETFWTNPQFRLK-LHNEDDEADETGSKACSFIVALMQKNMRKQQRNMLTMGYAIYKIPDQ---TGPMPKEFFLYNASKARSPSFINLREVSQRFRLPAGEYVIVPSTFEPHQEADFLVRVFAEKPNRSKESDD 440          
BLAST of Calpain vs. Ensembl Sea Lamprey
Match: capn1a (calpain 1, (mu/I) large subunit a [Source:ZFIN;Acc:ZDB-GENE-040426-1263])

HSP 1 Score: 170.244 bits (430), Expect = 5.033e-45
Identity = 93/223 (41.70%), Postives = 133/223 (59.64%), Query Frame = 1
Query:  145 KNLDDSKKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCS------SDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPR-IWDVMVKASHMESIMCCPI 792
            +N     K F   KK  L +  LF DP F  S   L+        +   +  +WKRP E+ ++P+FI  G +R D+ QG L DCWLL+AI SL+L  +L+ +V+ + Q F + Y G FLFR  + G W DV VDDRLPT+ G+LV++ S   +EFWSALLEKA+AKL G Y+ L  G+  +A+   TGG+ + F + +  +PR  WD + +A    +I+CC I
Sbjct:   21 RNFKTKSKTFQEIKKECLQRKILFEDPDFPASLSSLHIRVQPTVITQSNNFIEWKRPWELVRHPEFIVSGATRADINQGTLPDCWLLSAIASLTLYPDLLAKVVPMGQSFHEDYAGIFLFRFCQYGEWVDVHVDDRLPTKKGELVFVQSGTGNEFWSALLEKAYAKLNGCYEALAYGFPVEALCDFTGGVGETFTMNN--APRDYWDGISRAIKKGAIICCGI 241          

HSP 2 Score: 114.775 bits (286), Expect = 7.454e-27
Identity = 79/246 (32.11%), Postives = 120/246 (48.78%), Query Frame = 1
Query: 1099 GLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNKQ--WKTYNEFGKWSQNLGSDN---------FHLNPQYRFTILV--NEKDPGKLCETIICITMLEGSLVNMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKY-EFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCE 1794
            GL+EGHAYS+T V ++      + L+R+RNP+G +VE+ G +SD S  WN + E ++K L +    DGEFW+S +DF   F  +EIC+  S++   +++  W        W + L +           F LN Q+  T+L   N  D    C  ++ +T             F+     I  A     +L  +  +     ++  EF++   +  R  LPPGNY+IIP T   G EA FLLRI  E
Sbjct:  257 GLVEGHAYSITGVIKLKFPGKTVQLIRVRNPYG-KVEYTGPWSDGSTTWNEVPEEDQKRLHVR-AEDGEFWISDKDFRKNFHLVEICHQGSEVEIEHRKNLWICELHNSMWLKGLNAGGSRRHRVFKEFPLNYQFFLTLLEEDNVMDVCHGCHFLLSLTQKHRRKFRKIGIDFVPIGIYIYKAVVPGKKLTPQQLRKEKPLVESPEFIARREVTMRMTLPPGNYIIIPCTESAGQEAQFLLRIFME 500          
BLAST of Calpain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007888.1 (pep scaffold:Pmarinus_7.0:GL477427:174304:193458:1 gene:ENSPMAG00000007039.1 transcript:ENSPMAT00000007888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.658 bits (348), Expect = 7.182e-35
Identity = 88/251 (35.06%), Postives = 134/251 (53.39%), Query Frame = 1
Query: 1102 LIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNK--QWKTYNEFGKWSQNL---GSDNF--HLNPQYRFTILVNEKDPGKL-----CETIICITMLEGSLVNMPDSSFI---YSIFKIEDARYLNAQ--LDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPE 1800
            L++GHAYS+T   EV      + LVRIRNPWG +VEW GA+SDN+P+W  +++ +R  L+++   DGEFWMSF+DF+  FS LEIC +T D    +    W   N  G W +     G  NF  HL  +++F +   E+D         C  I+ +   E           +   Y+I+++ +      Q  L  ++F+ +SS  + E F++   +  R  LP G Y+++PST     EADF+LRI  E +
Sbjct:   72 LVKGHAYSLTGTTEVDYQGQMVRLVRIRNPWG-QVEWTGAWSDNAPQWGYVSDEDRGRLQVS-QEDGEFWMSFEDFLRQFSRLEICNLTPDALDDDSLGHWSANNFEGSWVRGCSAGGCRNFIVHLWEKWKFHLKHTEEDDDPHDNEAGCTFIVALMQKERRKKRRQGGDVLTVGYAIYEVPEQFVGQPQVKLKKDYFQYHSSKARSEVFINLREVSQRFTLPAGEYIVVPSTFEPNQEADFILRIFSEKQ 320          
BLAST of Calpain vs. Ensembl Nematostella
Match: EDO40193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7W7])

HSP 1 Score: 181.8 bits (460), Expect = 6.520e-49
Identity = 92/217 (42.40%), Postives = 133/217 (61.29%), Query Frame = 1
Query:  184 KKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYF---DKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQKL 825
            ++ + S  + F D  F   +  ++ S      F+WKRP +I ++P     G SR D+ QG+LGDCWLLAAI +L+  S LMN+V+  D      D++Y GA  F +W+ G W DV++DDRLPT NGKLV++HSS  +EFWSALLEKA+AKL GSY++L GG + +A+E  TGG+ + F L       ++ +M  A    ++M C I     ++  KL
Sbjct:   10 RRQVRSTGKPFEDDEFLAIDSSIFFSKRPPRPFEWKRPSDICEDPHMFVGGASRLDIQQGMLGDCWLLAAIAALTQHSALMNKVVPQDYVANPNDRNYTGALKFCIWQYGEWKDVIIDDRLPTYNGKLVFVHSSERNEFWSALLEKAYAKLNGSYESLKGGQTGEALEDFTGGLAESFDLNKNVPKDLFCIMQTAEKRHALMGCSIAAKANEIEAKL 226          

HSP 2 Score: 169.859 bits (429), Expect = 9.880e-45
Identity = 94/264 (35.61%), Postives = 150/264 (56.82%), Query Frame = 1
Query: 1081 EIKVDTGLIEGHAYSVTNVKEVCSLEGQ----INLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSD--INTGNKQWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLV---NMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            E K++ GL++GHAY+VT  ++V +   +    + LVR+RNPWGNE EWKGA+ D S EW  +++ E+K + L F +DGEFWMSF DF  +F++LEIC + +D  +   +  +++ +E G W + L +         FH NPQ+R T+  ++ D   LC  II +   +        +   +  +SI+K+E+ +     LD EFF+ ++S  +   F++   +  R  LPPG YV+IP+T     E +F+LR+  E       VD
Sbjct:  223 EAKLNNGLVKGHAYTVTGCRQVKAKTRRGDLDVELVRVRNPWGNEREWKGAWGDGSSEWQLLSDYEKKSIGLTFEDDGEFWMSFDDFKKHFTTLEICMLGADSAMEGSSVGFESRSEHGMWRRGLTAGGCRNFIKTFHKNPQFRITLQDSDDDADDLCTVIIALMQKDRRKEKKHGINPLTIGFSIYKLEEEKDKQGNLDMEFFQYHASTARSPVFINSREVVGRYALPPGEYVVIPTTFNPNEEGNFVLRMYSEKAHKTCEVD 486          
BLAST of Calpain vs. Ensembl Nematostella
Match: EDO48633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ83])

HSP 1 Score: 176.407 bits (446), Expect = 3.736e-47
Identity = 102/263 (38.78%), Postives = 153/263 (58.17%), Query Frame = 1
Query: 1075 QREIKVDTGLIEGHAYSVTNVKE--VCSLEG--QINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGN--KQWKTYNEFGKWSQNLGSD-------NFHLNPQYRFTILVNEKDPGKLCETIICITMLEGS-LVNMPDSSFI-YSIFKIEDARYLNAQLDSEFFKTNSSY-LKYEFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCE-PELSME 1812
            Q E  ++ GLI  HAYS+T +++  + SL G  +++L+R+RNP  N  EW+GA+SD SPEWN ++  E++ L L F++DGEFWMSF DF+  F+ LEIC +T D    N  ++W   NE G+W + + +        +F+ NPQ+R  +   + D  +LC  I+ +  ++ S  V +PD + I ++I+K         +LD  FF+ N +  +   F     I SR RL  G YV+IPST   G E DFLLRI  E P+ + E
Sbjct:  226 QYEGTLENGLITRHAYSITGLRKATLSSLRGRPEVDLIRLRNPHANSSEWRGAWSDRSPEWNMLSSQEKRELNLTFDDDGEFWMSFDDFLNNFTRLEICMLTPDSMEQNDRRKWDVQNEKGRWQKGVTAGGCRNFIASFYTNPQFRVCLKNPDDDDDELCTVIVSLMRVDHSHRVKIPDRAPIGFAIYKAPSDMRKGDRLDRAFFEYNKAVAMTTSFSKLREISSRYRLHAGEYVVIPSTFNPGQEGDFLLRIFSERPQYASE 488          

HSP 2 Score: 161.77 bits (408), Expect = 4.228e-42
Identity = 89/219 (40.64%), Postives = 135/219 (61.64%), Query Frame = 1
Query:  139 VSKNLDDSKKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDK-SYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPI 792
            +S+     ++ F S ++ LL+  +LF D  F  SN +L+     + +  WKRP EI K+PQFI  G S  DV QG + +CW +AA+  L+ + +L++ V   DQ F+  SY G F F  W+ G W +++VDD LPT NG+L +  S + DEFWSALLEKA+AKL GSY+ +  G   +A++ +TGG+I+   L +     +++VM+KA   +S+M C I
Sbjct:    1 MSRRALHKRERFASLQRQLLNSKRLFEDRDFPASNRVLFTRRRSV-QLIWKRPHEISKSPQFIARGFSSSDVAQGRIRNCWFVAALADLTTNIDLLHHVCPPDQSFEPGSYCGMFRFNFWQFGEWVEIIVDDYLPTYNGRLYFTKSDDPDEFWSALLEKAYAKLCGSYEAMSLGRISEALQDMTGGMIENVDLQNPPHG-LFNVMMKAYERQSLMGCSI 217          
BLAST of Calpain vs. Ensembl Nematostella
Match: EDO48536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ84])

HSP 1 Score: 151.369 bits (381), Expect = 1.304e-38
Identity = 74/169 (43.79%), Postives = 108/169 (63.91%), Query Frame = 1
Query:  301 EIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQY----FDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPIN 795
            EI   P+F  DG SR D+ QG+LG+CWLLAA+  L+    L+++++    Y    F   Y G  +F+LW+ G W  V++DDRLPT  GKLV++HS   +EFW ALLEKA+AK+ GSY+ L GG + +A+E  TGG+ ++F L   A   ++ +M +A    ++M C IN
Sbjct:   12 EICSEPRFYVDGASRLDIKQGVLGNCWLLAAMSVLAQHKPLVDRIMPEGVYEADRFSPRYTGKVVFKLWQYGEWVTVIIDDRLPTYKGKLVFVHSPEKNEFWCALLEKAYAKIHGSYEALKGGLTGEALEDFTGGLSEVFVL-EDAPANLFQIMQRAEKRSALMGCSIN 179          

HSP 2 Score: 108.612 bits (270), Expect = 1.152e-24
Identity = 54/133 (40.60%), Postives = 82/133 (61.65%), Query Frame = 1
Query: 1150 SLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNKQWKTYN---EFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGKLCE 1518
            S  G + L+RIRNPWG+E EW GA+ D SPEW  +++ E++ L+L F+ DGEFWMSF+DF ++F  LE+C +  + N  +K   ++N   E G W +++ +       + FH NPQ+R   LV+      +CE
Sbjct:  183 STRGGVELIRIRNPWGDEKEWTGAWGDRSPEWQELSQDEKRSLDLEFDVDGEFWMSFEDFKSHFDKLEVCMLDVE-NAIDKTQISFNSRLENGFWRKHVSAGGCRNFLETFHTNPQFR---LVSRVMSRMICE 311          

HSP 3 Score: 62.3882 bits (150), Expect = 3.438e-10
Identity = 32/88 (36.36%), Postives = 53/88 (60.23%), Query Frame = 1
Query: 1582 YSIFKIEDA---RYLNAQLDSEFFKTNSSYLKYEFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD*TLIF 1836
            ++++KI+D    +Y  ++LD E+F+ N S  +  F++   +  R  L PG YVI+PST ++  EADFLLRI  E  +S  ++  +  F
Sbjct:  395 FALYKIDDITKRKYGVSRLDKEYFQFNKSTERSTFINSREVVGRFELAPGEYVIVPSTFIQNAEADFLLRIFSEKAVSSSALTESTFF 482          
BLAST of Calpain vs. Ensembl Nematostella
Match: EDO34860 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN59])

HSP 1 Score: 140.198 bits (352), Expect = 6.357e-35
Identity = 84/189 (44.44%), Postives = 109/189 (57.67%), Query Frame = 1
Query:  178 SQKKVLLSKN-QLFHDPFFCP-SNDLLYCSSDHLDKFQWKRPLEI--RKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILV------DQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRL 714
            S+ K    KN QLF D  F P ++ L Y  S   +  +WKRP EI     P    DG    DV QG LG+CW +AA  SL+L   L+ +VI        D    ++Y G F FR +R+G W +VVVDD LPT NGKLVY+HS   +EFWSAL+EKA+AKL G+Y+ L  G +  A+   TGG+ +   L
Sbjct:   13 SKLKAECEKNEQLFVDSVFKPETSSLYYSRSCPPEPVEWKRPSEICHPAVPHLFVDGADSHDVTQGKLGNCWFVAACSSLALRPFLLYKVIPDKDKQEWDPKKPENYQGIFRFRFYRQGEWTEVVVDDLLPTVNGKLVYIHSKEKNEFWSALIEKAYAKLAGTYEALAAGSTADALVDFTGGVAEAISL 201          

HSP 2 Score: 131.724 bits (330), Expect = 3.921e-32
Identity = 87/255 (34.12%), Postives = 131/255 (51.37%), Query Frame = 1
Query: 1075 QREIKVDTGLIEGHAYSVTNVKEVCSLEGQINL--------VRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSD--INTGNKQWKTYNEFGKWS--QNLGS-----DNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKYEFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRIL 1788
            + E ++DTGLI+GHAY VT VK+V   EG ++L        +R+RNPWG E EW G +SD S EW  +   +RK + + F NDGEFWM F DF   F+   +C+V +   I+   KQW  Y     W+  QN G      D F  NPQY F+I  NE +   +  +++     +     + + +  + I K+E+ R    ++ S F K   S     F++   + +R  L  G Y+++PST        F++RI 
Sbjct:  241 EMEQRLDTGLIKGHAYGVTMVKKVTVGEGLLSLFNKKHFYMIRLRNPWG-EKEWNGRWSDESEEWKKLKPGDRKKMGIVFENDGEFWMEFDDFCREFTDCTLCHVINKAMIHKVFKQWHIYKHNYNWTQGQNAGGCVQNQDTFLKNPQYAFSITDNEGEDAMV--SLMQEDRRKDKSKGVGNLTIGFYIMKVEENR--KYRVHSMFPKAGDSI----FINAREVMNRFFLAAGRYLVVPSTYEPHTPGHFMMRIF 486          
BLAST of Calpain vs. Ensembl Nematostella
Match: EDO37991 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE78])

HSP 1 Score: 88.1965 bits (217), Expect = 3.280e-18
Identity = 59/171 (34.50%), Postives = 90/171 (52.63%), Query Frame = 1
Query:  214 FHDPFFCPSNDLLYCS---SDHLDKFQWKRPLEI------RKN-PQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPT-ENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGG 693
            F D  F P    LY +   S+H     W RP EI      R N P  +       D++QG+LGDCW L+++  L+    L+ ++++  +    S  GA+  RL ++G W  +++DD LP  + G+ VY  + +  + W  L+EKA AKL GSY+ L  G S + + TLTG 
Sbjct:   44 FVDDSFPPVLKSLYINPRHSEHPRVADWLRPNEIDNFSTCRTNIPWAVFRNPRPSDIIQGVLGDCWFLSSLAVLAERPELLEKILITREV---SPQGAYQVRLCKDGKWTVILIDDLLPCNQRGQPVYSWA-HRRQLWVPLIEKAMAKLHGSYEALTAGRSIEGLATLTGA 210          

HSP 2 Score: 68.1662 bits (165), Expect = 6.763e-12
Identity = 37/90 (41.11%), Postives = 54/90 (60.00%), Query Frame = 1
Query: 1096 TGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYV 1365
             GL   HAYSV +V++V      I L+R+RNPWG +  W G +SD S  W    E+ R  L ++   +G FWMS +DF+ YF S+++C +
Sbjct:  268 VGLQTHHAYSVLDVRDVHG----IRLLRLRNPWG-QYSWTGDWSDASSLWTP--EL-RHELMVHGAQEGVFWMSLEDFMKYFDSVDVCKI 349          
BLAST of Calpain vs. Ensembl Medaka
Match: capn3b (calpain-3 [Source:NCBI gene;Acc:101169329])

HSP 1 Score: 309.686 bits (792), Expect = 2.470e-94
Identity = 200/552 (36.23%), Postives = 281/552 (50.91%), Query Frame = 1
Query:  166 KWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKIVKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNKQ--WKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGK---LCETIICITMLEGSLVNMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLR 1782
            K F   +   + K  LF DP F  ++  L+ S     K +WKRP EI +NPQFI DG +R D+ QG LGDCWLLAAI  L+L   L+ +VI  +Q F ++Y G F F+ WR G W D+VVDDR+PT N  LV+  S   +EFWSALLEKA+AKL GSY+ L GG +  AME  TGG+ ++F L S+A   ++ +M KA    S+M C I+ S  +         P   N+    I+   +   +S LC                                  H     N I              E + + GL+ GHAYS+  ++EV S +G+I L+R+RNPWG  V WKG +S NS EW+ ++  +R  L+       EFWMSF DF   F+ LE+C +T D  TG+++  W      G+W +   +       D F  NPQYR   L  E DP +   LC  ++ +      +     + F+   F I + +  N  L  +FF  N+S  K + +++   +  R RLPPG YVI+P+T     E +FLLR
Sbjct:   61 KTFLELRDKYVKKKVLFEDPLFPANDSSLFYSHKPSMKIEWKRPTEICENPQFIIDGANRTDICQGELGDCWLLAAIACLTLSEKLLYRVIPPEQSFTENYAGIFHFQFWRYGEWIDIVVDDRIPTCNNLLVFTKSFRENEFWSALLEKAYAKLHGSYEALKGGNTLDAMEDFTGGVTELFEL-SEAPKGLFIIMKKALERGSLMGCSIDVSGQEKC-------PGKSNNMHLYIHSQIENKMLSCLCIV--------------------------------HQVTTANDI--------------ESRTNQGLVRGHAYSIIALEEV-SEDGKIRLIRLRNPWG-WVLWKGPWSVNSKEWSTVSTADRDNLKKQTLEMSEFWMSFDDFKKNFTKLEMCNLTPDALTGDERQSWTVSINEGRWVRGSSAGGCRNFPDTFWTNPQYRLR-LYEEDDPEEEQVLCTVVVALMQKGRRMQRHAGAKFLTIGFSIYELQGQNQHLQKDFFLYNASKAKCKAYINLREVTERFRLPPGEYVILPTTFKAHEEGEFLLR 555          
BLAST of Calpain vs. Ensembl Medaka
Match: zgc:55262 (calpain-1 catalytic subunit [Source:NCBI gene;Acc:101155642])

HSP 1 Score: 241.121 bits (614), Expect = 1.469e-69
Identity = 169/572 (29.55%), Postives = 266/572 (46.50%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFF-CPSNDL----LYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNN--KIVKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDI--NTGNKQWKTYNEFGKWSQNLGSD-------NFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPD---SSFIYSIFKIED--ARYLNAQLDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            + S K   L   +LF D  F C ++ L    L   S      +W RP E+ K P+FI DG +R D+ QG LGDCWLLAAI SL+L+ NL+++V+   Q F + Y G F F+ W+ G W DVV+DDRLP ++GKL+++HS    EFWSALLEKA+AKL G Y+ L GG + +  E  TGG+ +++ L  K  P ++ ++ +A    S++ C I+                        I     + A++F                      ++  G+ YS T    +    N  ++V+  N PWG                                    +    PW ++          S EW+ ++   R  L+ N + DGEFWM+F DF+  FS +EIC +T+D   NT  K+W +    G+W +   +         F LNPQ++ ++   +      C  ++ +   +            +  ++++++ D      N  L  +FF T++S  + E F++   + SR RLP G Y+++PST     EADF+LR+  E     E +D
Sbjct:   38 YESLKAQCLRSGKLFEDNLFPCAASSLGFNELGPRSSKTYGVRWMRPTELCKRPEFIVDGATRTDICQGALGDCWLLAAIASLTLNDNLLHRVVPHGQCFKQGYAGIFHFQFWQFGEWVDVVIDDRLPAKDGKLLFVHSVEGTEFWSALLEKAYAKLNGCYEALSGGSTSEGFEDFTGGVTEMYDL-IKPPPDLFGIISRAVERGSLLGCSID------------------------ITSSTDREAVTF---------------------KKLVKGHAYSLTGVDEVMYRGNLTRLVRMRN-PWGE-----------------------------------MEWTGPWSDD----------SKEWSYVDSSVRDRLQ-NRSEDGEFWMAFSDFLREFSRVEICNLTADALDNTQMKKWSSSLFQGEWRRGSTAGGCRNYPATFWLNPQFKISLQHPDVSGKPDCSFLVGLMQKDRRKKRQEGKDMETIGFALYEVPDEFKGSSNVHLKRDFFLTHASSARSELFINLREVSSRLRLPAGEYIVVPSTFEPNKEADFVLRVFSEKPADSEELD 516          
BLAST of Calpain vs. Ensembl Medaka
Match: zgc:55262 (calpain-1 catalytic subunit [Source:NCBI gene;Acc:101155642])

HSP 1 Score: 239.965 bits (611), Expect = 2.219e-69
Identity = 173/592 (29.22%), Postives = 274/592 (46.28%), Query Frame = 1
Query:  172 FNSQKKVLLSKNQLFHDPFF-CPSNDL----LYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNN--KIVKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDI--NTGNKQWKTYNEFGKW---SQNLGSDN----FHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPD---SSFIYSIFKIED--ARYLNAQLDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD*TLIFINPINFCQQ*NDVQL 1881
            + S K   L   +LF D  F C ++ L    L   S      +W RP E+ K P+FI DG +R D+ QG LGDCWLLAAI SL+L+ NL+++V+   Q F + Y G F F+ W+ G W DVV+DDRLP ++GKL+++HS    EFWSALLEKA+AKL G Y+ L GG + +  E  TGG+ +++ L  K  P ++ ++ +A    S++ C I+                        I     + A++F                      ++  G+ YS T    +    N  ++V+  N PWG                                    +    PW ++          S EW+ ++   R  L+ N + DGEFWM+F DF+  FS +EIC +T+D   NT  K+W +    G+W   S   G  N    F LNPQ++ ++   +      C  ++ +   +            +  ++++++ D      N  L  +FF T++S  + E F++   + SR RLP G Y+++PST     EADF+LR+  E     + +   L  +   + C    D+++
Sbjct:   38 YESLKAQCLRSGKLFEDNLFPCAASSLGFNELGPRSSKTYGVRWMRPTELCKRPEFIVDGATRTDICQGALGDCWLLAAIASLTLNDNLLHRVVPHGQCFKQGYAGIFHFQFWQFGEWVDVVIDDRLPAKDGKLLFVHSVEGTEFWSALLEKAYAKLNGCYEALSGGSTSEGFEDFTGGVTEMYDL-IKPPPDLFGIISRAVERGSLLGCSID------------------------ITSSTDREAVTF---------------------KKLVKGHAYSLTGVDEVMYRGNLTRLVRMRN-PWGE-----------------------------------MEWTGPWSDD----------SKEWSYVDSSVRDRLQ-NRSEDGEFWMAFSDFLREFSRVEICNLTADALDNTQMKKWSSSLFQGEWRRGSTAGGCRNYPATFWLNPQFKISLQHPDVSGKPDCSFLVGLMQKDRRKKRQEGKDMETIGFALYEVPDEFKGSSNVHLKRDFFLTHASSARSELFINLREVSSRLRLPAGEYIVVPSTFEPNKEADFVLRVFSEKPADSDCLCLLLDIVRVTDLCLCQQDMEI 536          
BLAST of Calpain vs. Ensembl Medaka
Match: capn9 (calpain 9 [Source:NCBI gene;Acc:101158662])

HSP 1 Score: 194.126 bits (492), Expect = 7.329e-53
Identity = 100/211 (47.39%), Postives = 137/211 (64.93%), Query Frame = 1
Query:  166 KWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPR-IWDVMVKASHMESIMCCPIN 795
            K F   ++  L K  LF DP F   +  L+ S     + QWKRP EI +NP+FI  G  R D+ QG LGDCWLLAAI SL+L  + M +V+  DQ FD +Y G F F+ W+   W DVVVDDRLPT   +L+ +HS++ DEFWSALLEKA+AKL GSY++L GG + +AME  TGG+ +++   +K++P  ++ +M KA    S+M C I+
Sbjct:   25 KTFEQLRQECLQKGVLFEDPDFPAVDSSLFYSQTVPVQIQWKRPKEICENPKFIVGGADRTDICQGQLGDCWLLAAIASLTLKKDAMARVVPPDQDFDHNYAGIFHFQFWQHNKWLDVVVDDRLPTVRNRLIMLHSASNDEFWSALLEKAYAKLNGSYESLKGGSTMEAMEDFTGGVGEMYE--TKSAPENLFSIMKKALDRGSMMGCSID 233          

HSP 2 Score: 142.895 bits (359), Expect = 2.860e-35
Identity = 81/253 (32.02%), Postives = 132/253 (52.17%), Query Frame = 1
Query: 1066 TPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDI--NTGNKQWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCE 1794
            +  + E K  TGL++GHAYS+T ++E+      + L+R+RNPWG +VEW GA+SDNS EWN I++ E+  +  N   DGEFWM F+DF   +  +EIC +T D   +   + W      G W +   +       D F  NPQ+R  +   + D   +C  +I +       +           F + +A    +Q++ +FF+ + S  +   +++   +  R  LPPG Y+++P+T     EADF++RI  E
Sbjct:  236 SSAESEAKTSTGLVKGHAYSITGMEELQFRGQTVKLIRVRNPWG-QVEWNGAWSDNSREWNYIDKKEKDRILQNSLEDGEFWMEFEDFKKNYDKVEICNMTPDALDDDTKRHWAVNVFEGNWIRGSTAGGCRNYIDTFWTNPQFRLQLEDADDDDDDVCSVVIALMQKNRRKLRKEGLDLETIGFAVYEAPDDESQVEKDFFRYHPSKARSRTYINMREVSERFTLPPGKYLLVPTTYQPHQEADFIIRIFSE 487          
BLAST of Calpain vs. Ensembl Medaka
Match: capn3b (calpain-3 [Source:NCBI gene;Acc:101169329])

HSP 1 Score: 192.586 bits (488), Expect = 7.564e-52
Identity = 99/200 (49.50%), Postives = 130/200 (65.00%), Query Frame = 1
Query:  196 LSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPIN 795
            + K  LF DP F  ++  L+ S     K +WKRP EI +NPQFI DG +R D+ QG LGDCWLLAAI  L+L   L+ +VI  +Q F ++Y G F F+ WR G W D+VVDDR+PT N  LV+  S   +EFWSALLEKA+AKL GSY+ L GG +  AME  TGG+ ++F L S+A   ++ +M KA    S+M C I+
Sbjct:   72 VKKKVLFEDPLFPANDSSLFYSHKPSMKIEWKRPTEICENPQFIIDGANRTDICQGELGDCWLLAAIACLTLSEKLLYRVIPPEQSFTENYAGIFHFQFWRYGEWIDIVVDDRIPTCNNLLVFTKSFRENEFWSALLEKAYAKLHGSYEALKGGNTLDAMEDFTGGVTELFEL-SEAPKGLFIIMKKALERGSLMGCSID 270          

HSP 2 Score: 147.902 bits (372), Expect = 9.648e-37
Identity = 94/277 (33.94%), Postives = 149/277 (53.79%), Query Frame = 1
Query: 1081 EIKVDTGLIEGHAYSVTNVKEV--CSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNKQ--WKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGK---LCETIICITMLEGSLVNMPDSSFI---YSIFKI-EDARYLNAQLDSEFFKTNSSYLKYE-FLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD*TLIFINPINF 1854
            E + + GL+ GHAYS+  ++E    S +G+I L+R+RNPWG  V WKG +S NS EW+ ++  +R  L+       EFWMSF DF   F+ LE+C +T D  TG+++  W      G+W +   +       D F  NPQYR   L  E DP +   LC  ++ +      +     + F+   +SI+++ ++ +  N  L  +FF  N+S  K + +++   +  R RLPPG YVI+P+T     E +FLLR+  E + + E  + ++  I PI F
Sbjct:  278 ESRTNQGLVRGHAYSIIALEECDQVSEDGKIRLIRLRNPWG-WVLWKGPWSVNSKEWSTVSTADRDNLKKQTLEMSEFWMSFDDFKKNFTKLEMCNLTPDALTGDERQSWTVSINEGRWVRGSSAGGCRNFPDTFWTNPQYRLR-LYEEDDPEEEQVLCTVVVALMQKGRRMQRHAGAKFLTIGFSIYEVPKELQGQNQHLQKDFFLYNASKAKCKAYINLREVTERFRLPPGEYVILPTTFKAHEEGEFLLRVFSENKSTSEEAETSIDKIEPIVF 552          
BLAST of Calpain vs. Planmine SMEST
Match: SMESG000067771.1 (SMESG000067771.1)

HSP 1 Score: 1191.41 bits (3081), Expect = 0.000e+0
Identity = 587/588 (99.83%), Postives = 587/588 (99.83%), Query Frame = 1
Query:   58 MAKNEQSRTVSMESNSETVTFDNTEFRVSKNLDDSKKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSXXXXXXXXXXTQGKPIKTEISDGYLYSKTNDKHIQINNNKIVKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNKQWKTYNEFGKWSQNLGSDNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKYEFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 1821
            MAKNEQSRTVSMESNSETVTFDNTEFRVSKNLDDSKKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSKKRKSIKNKKTQGKPIKTEISDGYLYSK NDKHIQINNNKIVKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNKQWKTYNEFGKWSQNLGSDNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKYEFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD
Sbjct:    1 MAKNEQSRTVSMESNSETVTFDNTEFRVSKNLDDSKKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSKKRKSIKNKKTQGKPIKTEISDGYLYSKINDKHIQINNNKIVKEPNEPWGTPVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNKQWKTYNEFGKWSQNLGSDNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKYEFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD 588          
BLAST of Calpain vs. Planmine SMEST
Match: SMESG000067761.1 (SMESG000067761.1)

HSP 1 Score: 276.559 bits (706), Expect = 1.571e-82
Identity = 135/243 (55.56%), Postives = 173/243 (71.19%), Query Frame = 1
Query:   94 ESNSETVTFDNTEFRVSKNLDDSKKWFNSQKKVLLSKNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQVQLAQK 822
            +++SE++    + F VSK+L +SK WF +QK++L +KN LF DPFF  +N  LY       K +WKRP E+++N  FI DG SRFDVVQG LGDCWLLAA+ SLS+   LM QVI  DQ FD+ YVGAF+FRLW+ G WYDVVVDDRLPT  G+LVY+HS +L+EFWSALLEKA+AK+ GSY+ L GG S +AME  TGGI ++F LGS A P +WD+M+K     S+M C I     ++  K
Sbjct:   32 QTDSESIY--GSRFHVSKSLKESKDWFYNQKRMLKAKNSLFEDPFFPANNTSLYYREAPPQKIEWKRPKEMQQNVAFIADGLSRFDVVQGELGDCWLLAAVSSLSMYPALMYQVIPSDQDFDRDYVGAFMFRLWQFGTWYDVVVDDRLPTVRGRLVYLHSKDLNEFWSALLEKAYAKVAGSYEALKGGSSSEAMEDFTGGITEMFDLGSSAPPNLWDIMMKGVTRASLMGCSIEADPTKVEAK 272          

HSP 2 Score: 214.157 bits (544), Expect = 8.891e-60
Identity = 111/277 (40.07%), Postives = 167/277 (60.29%), Query Frame = 1
Query: 1069 PVQREIKVDTGLIEGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNK------QWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDSSFI----YSIFKIEDARYLNAQLDSEFFKTNSSYLKY-EFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD*TLIFINP 1845
            P + E K + GLI+GHAYS+T+VK V S  G++NLVR+RNPWGN  EW GAYSD SPEWN I++VERK L L F +DGEFWM+FQDF+ YF+ LEIC+++ +    NK      +W+   E G+W +N+ +       + FHLNPQ++  ++  +++  +   T+I   M +       +   +    Y+I++++D  Y  + LD  +F+  +S+ K   F++   +C R +LP G YVI+PST  +G EA FLLRI  E     + +D     + P
Sbjct:  266 PTKVEAKAEKGLIKGHAYSITDVKSVNSKRGRVNLVRVRNPWGNSCEWTGAYSDKSPEWNEISDVERKRLGLTFEDDGEFWMNFQDFVKYFTKLEICHLSPESELENKAGIKKSKWEMCIENGEWQKNVSAGGCRNFIETFHLNPQFKVKVVDPDENDNENTGTLIIGLMQKEMRSRRKEGQDLFTIGYAIYQMKDNAYDKSLLDKRYFQITASFAKSPTFINLREVCGRHKLPIGKYVIVPSTFNQGEEAKFLLRIFSEQPYDSKQIDEKTEIVAP 542          
BLAST of Calpain vs. Planmine SMEST
Match: SMESG000039299.1 (SMESG000039299.1)

HSP 1 Score: 213.772 bits (543), Expect = 3.295e-59
Identity = 109/213 (51.17%), Postives = 140/213 (65.73%), Query Frame = 1
Query:  202 KNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDK-SYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPI----NHSQVQLAQKL 825
            + +L+ DP F   N+ LY S     K  WKRP EI +NP+FI +G SRFDV QG LGDCWLLAA+  LSL S L NQV+  DQ F K SY G F FR WR G W +V+VDDRLPT N KLVYMHS++ +EFWSALLEKA+AK+ GSY++L GG + +A+E  TGG+ + F +  +    ++D+M KA    S+M C I      ++ QL   L
Sbjct:  109 RGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGL 321          

HSP 2 Score: 174.096 bits (440), Expect = 1.699e-45
Identity = 105/265 (39.62%), Postives = 151/265 (56.98%), Query Frame = 1
Query: 1069 PVQREIKVDTGLIEGHAYSVTNVKEV----CSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICY-----VTSDINTGNK--QWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDS----SFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKY-EFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCE 1794
            P + E ++  GLI GHAYS+T+VK V        G+I L+RIRNPWGNE EWKG++SD SPEWN I++ +R  + L F++DGEFWMS+QDFI  F  +EIC+     + +D   G K  +W+   E G+W + L +       D F  NPQ+R  ++  ++D  +   TII   M +       +     +  Y+I++++D       LD  +FK N S  K   F++   +C R +LPPG YVI+PST     EA FL+RI  E
Sbjct:  310 PRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKVVDPDEDDDENLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDEN--QGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSE 572          
BLAST of Calpain vs. Planmine SMEST
Match: SMESG000039299.1 (SMESG000039299.1)

HSP 1 Score: 213.386 bits (542), Expect = 3.920e-59
Identity = 106/198 (53.54%), Postives = 135/198 (68.18%), Query Frame = 1
Query:  202 KNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDK-SYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPI 792
            + +L+ DP F   N+ LY S     K  WKRP EI +NP+FI +G SRFDV QG LGDCWLLAA+  LSL S L NQV+  DQ F K SY G F FR WR G W +V+VDDRLPT N KLVYMHS++ +EFWSALLEKA+AK+ GSY++L GG + +A+E  TGG+ + F +  +    ++D+M KA    S+M C I
Sbjct:  109 RGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSI 306          

HSP 2 Score: 174.096 bits (440), Expect = 1.762e-45
Identity = 105/265 (39.62%), Postives = 151/265 (56.98%), Query Frame = 1
Query: 1069 PVQREIKVDTGLIEGHAYSVTNVKEV----CSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICY-----VTSDINTGNK--QWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDS----SFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKY-EFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCE 1794
            P + E ++  GLI GHAYS+T+VK V        G+I L+RIRNPWGNE EWKG++SD SPEWN I++ +R  + L F++DGEFWMS+QDFI  F  +EIC+     + +D   G K  +W+   E G+W + L +       D F  NPQ+R  ++  ++D  +   TII   M +       +     +  Y+I++++D       LD  +FK N S  K   F++   +C R +LPPG YVI+PST     EA FL+RI  E
Sbjct:  310 PRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKVVDPDEDDDENLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDEN--QGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSE 572          
BLAST of Calpain vs. Planmine SMEST
Match: SMESG000039299.1 (SMESG000039299.1)

HSP 1 Score: 213.001 bits (541), Expect = 4.209e-59
Identity = 106/198 (53.54%), Postives = 135/198 (68.18%), Query Frame = 1
Query:  202 KNQLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVVQGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDK-SYVGAFLFRLWREGVWYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGGYSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPI 792
            + +L+ DP F   N+ LY S     K  WKRP EI +NP+FI +G SRFDV QG LGDCWLLAA+  LSL S L NQV+  DQ F K SY G F FR WR G W +V+VDDRLPT N KLVYMHS++ +EFWSALLEKA+AK+ GSY++L GG + +A+E  TGG+ + F +  +    ++D+M KA    S+M C I
Sbjct:  109 RGKLYEDPDFPAVNESLYFSQRPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDMKKEVPKNLFDIMFKAFSRCSLMGCSI 306          

HSP 2 Score: 174.096 bits (440), Expect = 1.686e-45
Identity = 105/265 (39.62%), Postives = 151/265 (56.98%), Query Frame = 1
Query: 1069 PVQREIKVDTGLIEGHAYSVTNVKEV----CSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNINEVERKGLELNFNNDGEFWMSFQDFITYFSSLEICY-----VTSDINTGNK--QWKTYNEFGKWSQNLGS-------DNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLVNMPDS----SFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKY-EFLSEGMICSRCRLPPGNYVIIPSTAVKGIEADFLLRILCE 1794
            P + E ++  GLI GHAYS+T+VK V        G+I L+RIRNPWGNE EWKG++SD SPEWN I++ +R  + L F++DGEFWMS+QDFI  F  +EIC+     + +D   G K  +W+   E G+W + L +       D F  NPQ+R  ++  ++D  +   TII   M +       +     +  Y+I++++D       LD  +FK N S  K   F++   +C R +LPPG YVI+PST     EA FL+RI  E
Sbjct:  310 PRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKVVDPDEDDDENLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDEN--QGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSE 572          
The following BLAST results are available for this feature:
BLAST of Calpain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAPN93.195e-5146.01calpain 9 [Source:HGNC Symbol;Acc:HGNC:1486][more]
CAPN35.186e-5147.39calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480][more]
CAPN35.817e-5147.39calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480][more]
CAPN96.585e-5146.01calpain 9 [Source:HGNC Symbol;Acc:HGNC:1486][more]
CAPN36.686e-5147.39calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480][more]
back to top
BLAST of Calpain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clp-41.125e-5345.19CaLPain family [Source:UniProtKB/TrEMBL;Acc:Q8IAA... [more]
clp-42.229e-5345.19CaLPain family [Source:UniProtKB/TrEMBL;Acc:Q8IAA... [more]
clp-73.688e-5345.67CaLPain family [Source:UniProtKB/TrEMBL;Acc:U4PMH... [more]
clp-73.688e-5345.67CaLPain family [Source:UniProtKB/TrEMBL;Acc:U4PMH... [more]
clp-62.519e-5243.05CaLPain family [Source:UniProtKB/TrEMBL;Acc:Q9N4B... [more]
back to top
BLAST of Calpain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CalpA1.728e-5648.13gene:FBgn0012051 transcript:FBtr0086530[more]
CalpA5.245e-5548.13gene:FBgn0012051 transcript:FBtr0340532[more]
CalpA5.862e-5548.13gene:FBgn0012051 transcript:FBtr0112869[more]
CalpA5.862e-5548.13gene:FBgn0012051 transcript:FBtr0086529[more]
CalpB3.080e-5447.85gene:FBgn0025866 transcript:FBtr0076343[more]
back to top
BLAST of Calpain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capn3b1.985e-5346.12calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149][more]
capn3b2.230e-5346.08calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149][more]
capn3b2.232e-5346.08calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149][more]
capn87.024e-5345.87calpain 8 [Source:ZFIN;Acc:ZDB-GENE-050522-279][more]
capn87.222e-5345.87calpain 8 [Source:ZFIN;Acc:ZDB-GENE-050522-279][more]
back to top
BLAST of Calpain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAPN33.662e-9935.69calpain 3 [Source:NCBI gene;Acc:100497532][more]
CAPN34.407e-9735.56calpain 3 [Source:NCBI gene;Acc:100497532][more]
CAPN31.763e-9135.53calpain 3 [Source:NCBI gene;Acc:100497532][more]
CAPN31.882e-9135.53calpain 3 [Source:NCBI gene;Acc:100497532][more]
CAPN36.991e-8935.82calpain 3 [Source:NCBI gene;Acc:100497532][more]
back to top
BLAST of Calpain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Capn15.506e-7230.92calpain 1 [Source:MGI Symbol;Acc:MGI:88263][more]
Capn15.506e-7230.92calpain 1 [Source:MGI Symbol;Acc:MGI:88263][more]
Capn18.458e-7130.57calpain 1 [Source:MGI Symbol;Acc:MGI:88263][more]
Capn81.242e-5145.50calpain 8 [Source:MGI Symbol;Acc:MGI:2181366][more]
Capn32.928e-5046.45calpain 3 [Source:MGI Symbol;Acc:MGI:107437][more]
back to top
BLAST of Calpain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P43368|CAN3_PIG8.514e-9334.47Calpain-3 OS=Sus scrofa OX=9823 GN=CAPN3 PE=2 SV=2[more]
sp|Q92177|CAN3_CHICK3.316e-9135.49Calpain-3 OS=Gallus gallus OX=9031 GN=CAPN3 PE=2 S... [more]
sp|Q9TTH8|CAN3_SHEEP2.898e-8833.62Calpain-3 OS=Ovis aries OX=9940 GN=CAPN3 PE=2 SV=1[more]
sp|Q9GLG7|CAN3_MACFA9.397e-7832.01Calpain-3 OS=Macaca fascicularis OX=9541 GN=CAPN3 ... [more]
sp|P97571|CAN1_RAT3.287e-7231.70Calpain-1 catalytic subunit OS=Rattus norvegicus O... [more]
back to top
BLAST of Calpain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A310SH886.093e-10035.80Calpain-B OS=Eufriesea mexicana OX=516756 GN=WN48_... [more]
E2ADL62.087e-9935.63Calpain-A OS=Camponotus floridanus OX=104421 GN=EA... [more]
A0A026WP622.714e-9935.63Calpain-B OS=Ooceraea biroi OX=2015173 GN=X777_008... [more]
E9IT453.452e-9835.34Uncharacterized protein (Fragment) OS=Solenopsis i... [more]
A0A452GPR94.287e-9836.55Calpain 3 OS=Gopherus agassizii OX=38772 GN=CAPN3 ... [more]
back to top
BLAST of Calpain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capn3b1.068e-5350.00calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149][more]
capn2a5.072e-5143.93calpain-2 catalytic subunit-like [Source:NCBI gene... [more]
capn2a7.500e-5143.93calpain-2 catalytic subunit-like [Source:NCBI gene... [more]
ENSAMXT00000014125.28.714e-5044.19pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
capn81.317e-4939.26calpain 8 [Source:ZFIN;Acc:ZDB-GENE-050522-279][more]
back to top
BLAST of Calpain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003998.15.011e-9237.31pep scaffold:Pmarinus_7.0:GL501031:16584:50555:1 g... [more]
capn3a8.805e-9133.57calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912... [more]
capn94.309e-4649.13calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2][more]
capn1a5.033e-4541.70calpain 1, (mu/I) large subunit a [Source:ZFIN;Acc... [more]
ENSPMAT00000007888.17.182e-3535.06pep scaffold:Pmarinus_7.0:GL477427:174304:193458:1... [more]
back to top
BLAST of Calpain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calpain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO401936.520e-4942.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486333.736e-4738.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485361.304e-3843.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348606.357e-3544.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379913.280e-1834.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calpain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capn3b2.470e-9436.23calpain-3 [Source:NCBI gene;Acc:101169329][more]
zgc:552621.469e-6929.55calpain-1 catalytic subunit [Source:NCBI gene;Acc:... [more]
zgc:552622.219e-6929.22calpain-1 catalytic subunit [Source:NCBI gene;Acc:... [more]
capn97.329e-5347.39calpain 9 [Source:NCBI gene;Acc:101158662][more]
capn3b7.564e-5249.50calpain-3 [Source:NCBI gene;Acc:101169329][more]
back to top
BLAST of Calpain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067771.10.000e+099.83SMESG000067771.1[more]
SMESG000067761.11.571e-8255.56SMESG000067761.1[more]
SMESG000039299.13.295e-5951.17SMESG000039299.1[more]
SMESG000039299.13.920e-5953.54SMESG000039299.1[more]
SMESG000039299.14.209e-5953.54SMESG000039299.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034337 ID=SMED30034337|Name=Calpain|organism=Schmidtea mediterranea sexual|type=transcript|length=2041bp
CTTGAATCAAGAAAGTTAATTTAACTGGTAGTTTTTAATCCTCATTTTGA
TACCAAAATGGCCAAGAATGAACAATCCAGAACGGTTTCTATGGAATCAA
ACTCTGAAACTGTGACATTTGATAACACTGAATTTCGTGTTTCCAAAAAC
CTTGATGATAGTAAAAAATGGTTCAACAGCCAAAAGAAAGTCTTGTTATC
CAAAAATCAACTTTTTCACGATCCGTTTTTTTGTCCTAGTAATGATTTGC
TTTATTGTAGCTCGGATCATTTAGACAAATTTCAATGGAAAAGACCCCTG
GAAATACGCAAAAATCCTCAATTCATCAAAGATGGCAGAAGTAGATTTGA
TGTAGTTCAAGGACTGCTAGGTGACTGTTGGCTTTTGGCCGCTATCGGAT
CATTGTCATTGGATTCAAATTTAATGAATCAAGTGATCCTAGTGGATCAG
TATTTTGATAAAAGTTATGTTGGAGCTTTCTTGTTTCGTTTATGGCGTGA
AGGGGTTTGGTACGATGTAGTCGTCGACGATAGATTACCAACTGAAAATG
GGAAATTAGTGTACATGCATTCCAGTAATCTAGATGAATTTTGGTCTGCT
CTTTTAGAAAAAGCTTTTGCTAAACTTAAAGGATCTTATAAAAATTTGGA
TGGGGGATATAGTTGGAAAGCAATGGAAACGTTGACTGGAGGTATTATAA
AAATTTTTAGACTTGGTTCTAAAGCATCTCCAAGAATTTGGGATGTTATG
GTAAAAGCTTCACATATGGAATCAATTATGTGTTGTCCAATAAACCATTC
GCAAGTCCAACTTGCTCAGAAACTGGGATTATTTATTCCCAATCCAAAGA
ATTCAGACAAATCTGTGATTAATGAGCCCAAAAAGAAAAGTGCGATTTCA
TTTTTATGTTTCTCAAAGAAACGCAAGTCAATTAAAAATAAAAAAACCCA
AGGAAAGCCAATCAAAACAGAAATATCAGATGGTTATTTGTATTCGAAAA
CCAACGATAAGCATATTCAAATAAATAACAACAAAATCGTGAAAGAACCC
AACGAGCCATGGGGAACCCCGGTGCAAAGGGAAATAAAAGTAGATACTGG
ATTGATAGAAGGTCATGCGTATTCCGTAACAAATGTTAAAGAAGTATGTT
CTTTGGAGGGTCAAATAAATTTAGTTAGAATCAGAAATCCGTGGGGGAAT
GAAGTTGAGTGGAAAGGGGCTTATTCGGATAATTCTCCAGAATGGAATAA
TATCAACGAAGTCGAGCGCAAAGGCCTAGAATTAAATTTTAATAATGACG
GAGAATTTTGGATGTCTTTTCAAGATTTCATTACGTATTTTTCCTCTCTG
GAAATATGTTATGTTACATCTGACATCAACACGGGAAATAAACAATGGAA
AACTTACAATGAGTTTGGGAAATGGAGTCAAAACCTTGGAAGTGATAACT
TCCATTTGAACCCTCAATACCGATTTACTATTCTAGTTAATGAGAAAGAT
CCTGGCAAGCTATGCGAGACAATCATATGCATTACAATGCTAGAAGGAAG
CCTCGTTAACATGCCAGATTCATCTTTCATCTATTCAATTTTCAAGATTG
AAGATGCTAGATATTTGAACGCGCAACTTGACTCGGAATTTTTCAAAACT
AATTCGTCCTATTTGAAATATGAATTCTTGAGTGAAGGAATGATTTGCAG
CCGATGTCGCCTACCTCCGGGAAATTATGTGATTATTCCATCAACTGCGG
TTAAAGGGATCGAAGCTGATTTTCTTTTAAGAATTTTGTGTGAGCCCGAA
TTGTCAATGGAATCAGTAGATTAAACGTTAATATTTATTAATCCGATAAA
TTTCTGTCAACAGTGAAATGATGTGCAATTGATTTGGAAAGCAATGTAGT
ATTATATCTCTCATTTTCTTAAAAAAATAGATTCAGCTTGAAGGAAAAAC
TGGTTTAAAATTTACGATAATTAATAGGGTCCTATACAAGGATGTGTCCC
TTGGTAAATGTTGTCTATTGGTTGGCTTTAATGTTACTGTG
back to top

protein sequence of SMED30034337-orf-1

>SMED30034337-orf-1 ID=SMED30034337-orf-1|Name=SMED30034337-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=589bp
MAKNEQSRTVSMESNSETVTFDNTEFRVSKNLDDSKKWFNSQKKVLLSKN
QLFHDPFFCPSNDLLYCSSDHLDKFQWKRPLEIRKNPQFIKDGRSRFDVV
QGLLGDCWLLAAIGSLSLDSNLMNQVILVDQYFDKSYVGAFLFRLWREGV
WYDVVVDDRLPTENGKLVYMHSSNLDEFWSALLEKAFAKLKGSYKNLDGG
YSWKAMETLTGGIIKIFRLGSKASPRIWDVMVKASHMESIMCCPINHSQV
QLAQKLGLFIPNPKNSDKSVINEPKKKSAISFLCFSKKRKSIKNKKTQGK
PIKTEISDGYLYSKTNDKHIQINNNKIVKEPNEPWGTPVQREIKVDTGLI
EGHAYSVTNVKEVCSLEGQINLVRIRNPWGNEVEWKGAYSDNSPEWNNIN
EVERKGLELNFNNDGEFWMSFQDFITYFSSLEICYVTSDINTGNKQWKTY
NEFGKWSQNLGSDNFHLNPQYRFTILVNEKDPGKLCETIICITMLEGSLV
NMPDSSFIYSIFKIEDARYLNAQLDSEFFKTNSSYLKYEFLSEGMICSRC
RLPPGNYVIIPSTAVKGIEADFLLRILCEPELSMESVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0004198calcium-dependent cysteine-type endopeptidase activity
GO:0005509calcium ion binding
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR036213Calpain_III_sf
IPR022684Calpain_cysteine_protease
IPR001300Peptidase_C2_calpain_cat
IPR022683Calpain_III
IPR022682Calpain_domain_III
IPR000169Pept_cys_AS
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022684Peptidase C2, calpain familyPRINTSPR00704CALPAINcoord: 37..60
score: 29.58
coord: 101..117
score: 71.76
coord: 77..99
score: 54.35
coord: 167..190
score: 66.53
coord: 551..579
score: 49.43
coord: 137..162
score: 60.13
coord: 192..219
score: 41.79
IPR022683Peptidase C2, calpain, domain IIISMARTSM007202calcoord: 446..585
e-value: 1.5E-11
score: 54.4
IPR001300Peptidase C2, calpain, catalytic domainSMARTSM00230cys_prot_2coord: 34..445
e-value: 5.5E-114
score: 394.6
IPR001300Peptidase C2, calpain, catalytic domainPFAMPF00648Peptidase_C2coord: 53..434
e-value: 2.7E-107
score: 358.2
IPR001300Peptidase C2, calpain, catalytic domainPROSITEPS50203CALPAIN_CATcoord: 52..437
score: 66.379
IPR001300Peptidase C2, calpain, catalytic domainCDDcd00044CysPccoord: 44..435
e-value: 3.55444E-96
score: 294.625
IPR022682Peptidase C2, calpain, large subunit, domain IIIPFAMPF01067Calpain_IIIcoord: 462..579
e-value: 9.3E-18
score: 64.9
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 334..443
e-value: 7.6E-39
score: 134.4
NoneNo IPR availableGENE3DG3DSA:2.60.120.380coord: 444..588
e-value: 2.6E-20
score: 74.8
NoneNo IPR availablePANTHERPTHR10183:SF396CALPAIN-A-RELATEDcoord: 38..257
coord: 340..579
NoneNo IPR availablePANTHERPTHR10183CALPAINcoord: 38..257
coord: 340..579
IPR000169Cysteine peptidase, cysteine active sitePROSITEPS00139THIOL_PROTEASE_CYScoord: 101..112
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 39..447
IPR036213Calpain large subunit, domain III superfamilySUPERFAMILYSSF49758Calpain large subunit, middle domain (domain III)coord: 447..586