Receptor-type tyrosine-protein phosphatase N2

Overview
NameReceptor-type tyrosine-protein phosphatase N2
Smed IDSMED30034325
Length (bp)2469
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Receptor-type tyrosine-protein phosphatase N2 (SMED30034325) t-SNE clustered cells

Violin plots show distribution of expression levels for Receptor-type tyrosine-protein phosphatase N2 (SMED30034325) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Receptor-type tyrosine-protein phosphatase N2 (SMED30034325) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Receptor-type tyrosine-protein phosphatase N2 (SMED30034325) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034325

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30034325SMESG000078547.1 SmedASXL_009203SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30034325SMESG000078547.1 dd_Smed_v4_6990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30034325SMESG000078547.1 dd_Smed_v4_6990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30034325SMESG000078547.1 dd_Smed_v6_6990_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30034325SMESG000078547.1 OX_Smed_1.0.13985ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Human
Match: PTPRN2 (protein tyrosine phosphatase receptor type N2 [Source:HGNC Symbol;Acc:HGNC:9677])

HSP 1 Score: 385.956 bits (990), Expect = 2.193e-119
Identity = 183/300 (61.00%), Postives = 225/300 (75.00%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E  V +NMDI TGHMILSYME H KNK   + EW ++ +Y+ E      A + EN+PKNR    + YD SRV LK   +  + DYINAS I+DHDP+ P YIATQ PL   V DFWQMVWE G VVIV LT L E+   +  HYWP EGS +++IYEVNLVSEHIW +++LVR+FYLKNL T ETRTVTQFHFLSW    +PSSSRS+L+FRRKVNK YR +S PII+HC+DG GR+GTY+L+D++LN++ KG KE+D+AATLEHLRDQR  +V+T+EQF F LT ++EEVN ILK L Q
Sbjct:  678 EEPVQSNMDISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNSSFVAQREENVPKNRSLAVLTYDHSRVLLKAENSHSHSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCVVIVMLTPLAENGVRQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWYDRGVPSSSRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDMVLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKALPQ 977          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Human
Match: PTPRN2 (protein tyrosine phosphatase receptor type N2 [Source:HGNC Symbol;Acc:HGNC:9677])

HSP 1 Score: 385.571 bits (989), Expect = 2.977e-119
Identity = 183/300 (61.00%), Postives = 225/300 (75.00%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E  V +NMDI TGHMILSYME H KNK   + EW ++ +Y+ E      A + EN+PKNR    + YD SRV LK   +  + DYINAS I+DHDP+ P YIATQ PL   V DFWQMVWE G VVIV LT L E+   +  HYWP EGS +++IYEVNLVSEHIW +++LVR+FYLKNL T ETRTVTQFHFLSW    +PSSSRS+L+FRRKVNK YR +S PII+HC+DG GR+GTY+L+D++LN++ KG KE+D+AATLEHLRDQR  +V+T+EQF F LT ++EEVN ILK L Q
Sbjct:  687 EEPVQSNMDISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNSSFVAQREENVPKNRSLAVLTYDHSRVLLKAENSHSHSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCVVIVMLTPLAENGVRQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWYDRGVPSSSRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDMVLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKALPQ 986          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Human
Match: PTPRN2 (protein tyrosine phosphatase receptor type N2 [Source:HGNC Symbol;Acc:HGNC:9677])

HSP 1 Score: 385.571 bits (989), Expect = 4.162e-119
Identity = 183/300 (61.00%), Postives = 225/300 (75.00%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E  V +NMDI TGHMILSYME H KNK   + EW ++ +Y+ E      A + EN+PKNR    + YD SRV LK   +  + DYINAS I+DHDP+ P YIATQ PL   V DFWQMVWE G VVIV LT L E+   +  HYWP EGS +++IYEVNLVSEHIW +++LVR+FYLKNL T ETRTVTQFHFLSW    +PSSSRS+L+FRRKVNK YR +S PII+HC+DG GR+GTY+L+D++LN++ KG KE+D+AATLEHLRDQR  +V+T+EQF F LT ++EEVN ILK L Q
Sbjct:  699 EEPVQSNMDISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNSSFVAQREENVPKNRSLAVLTYDHSRVLLKAENSHSHSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCVVIVMLTPLAENGVRQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWYDRGVPSSSRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDMVLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKALPQ 998          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Human
Match: PTPRN2 (protein tyrosine phosphatase receptor type N2 [Source:HGNC Symbol;Acc:HGNC:9677])

HSP 1 Score: 385.956 bits (990), Expect = 4.605e-119
Identity = 183/300 (61.00%), Postives = 225/300 (75.00%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E  V +NMDI TGHMILSYME H KNK   + EW ++ +Y+ E      A + EN+PKNR    + YD SRV LK   +  + DYINAS I+DHDP+ P YIATQ PL   V DFWQMVWE G VVIV LT L E+   +  HYWP EGS +++IYEVNLVSEHIW +++LVR+FYLKNL T ETRTVTQFHFLSW    +PSSSRS+L+FRRKVNK YR +S PII+HC+DG GR+GTY+L+D++LN++ KG KE+D+AATLEHLRDQR  +V+T+EQF F LT ++EEVN ILK L Q
Sbjct:  716 EEPVQSNMDISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNSSFVAQREENVPKNRSLAVLTYDHSRVLLKAENSHSHSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCVVIVMLTPLAENGVRQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWYDRGVPSSSRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDMVLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKALPQ 1015          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Human
Match: PTPRN (protein tyrosine phosphatase receptor type N [Source:HGNC Symbol;Acc:HGNC:9676])

HSP 1 Score: 381.719 bits (979), Expect = 1.079e-118
Identity = 168/300 (56.00%), Postives = 221/300 (73.67%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNE---SESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E     NMDI TGHMIL+YME H +N++    EW ++ +Y+ E      A    N+ KNR+ D +PYD +R+ LK   +    DYINAS I++HDP++P YIATQ PL   + DFWQMVWE G  VIV LT L E    +   YWP EG+ ++++YEVNLVSEHIW +++LVR+FYLKN+ T ETRT+TQFHFLSWP +  P+S+R +L+FRRKVNK YR +S PII+HC+DG GRTGTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  LV++++QF F LT ++EEVN ILK L Q
Sbjct:  590 EEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRGRSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFEFALTAVAEEVNAILKALPQ 889          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Celegans
Match: ida-1 (Receptor-type tyrosine-protein phosphatase-like ida-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGJ5])

HSP 1 Score: 274.633 bits (701), Expect = 2.674e-80
Identity = 132/295 (44.75%), Postives = 201/295 (68.14%), Query Frame = 3
Query: 1350 DEMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSL--KNAKNGD-YINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES-ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILK 2222
            +E  V T +DI TGH++L++++++       +++WN I  Y  E+     A K  +  +NR    +P+D + V +  K A+N D Y+NAS I D DP+  VYIA Q P    +  FWQ +W+ GV ++VNL+   E  +  +YWP  GS++   +E++LVSEHIWSD+YLVR+FYLKNL  ++TRT+TQFH+LSW  +  P+S++SILEFRRKVNKSYR +S+ +++H  DG GRTG Y  +D++  R+ +G++++D+ AT+EHLRDQR  +V T +QF  V   +++EVN++LK
Sbjct:  473 EETAVPT-IDISTGHVVLNFLQEYLSEPTKIEAQWNGIKDYRNEERTKTKAEKFAS--QNRT--ILPFDDNIVDIDGKTAENEDFYLNASFIYDDDPRQAVYIAAQTPASSQIAAFWQTIWQHGVCLVVNLSTPEECKQEKNYWPDTGSEVHGAFEIHLVSEHIWSDDYLVRSFYLKNLQNSQTRTITQFHYLSWQKESTPTSAKSILEFRRKVNKSYRGRSSAVLVHSWDGSGRTGVYCAVDVLCARLLRGIRQIDVVATVEHLRDQRDGMVATGDQFKLVYGCVAQEVNHLLK 762          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Celegans
Match: Y41D4A.5 (Tyrosine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:Q95Y26])

HSP 1 Score: 149.828 bits (377), Expect = 2.138e-38
Identity = 90/264 (34.09%), Postives = 152/264 (57.58%), Query Frame = 3
Query: 1494 EAAIKIENLPKNRYQDKIPYDKSRVSL-KNAKNGD-YINASIIVDHDPKLP----VYIATQAPLEKWVGDFWQMVWEQGV---VVIVNLTELNESESAHYWPKE--GSQIFNIYEVNLVSEHIWSD-EYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSIL---EFRRKVNKSYRSK-STPIIIHCNDGCGRTGTYILLDLILNRI-CKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E A+  ++  +NRY+D +PYDK+RV + K+++N + Y+NAS+I     +LP     +IA QAPL   + ++W+M+ E  V   V++  L ELN+ +   YWP++   S++F  YE+ L  E ++ D EYL+R   ++N  T E R V Q H+  WP    PS  + +L   +    +++    + S+PI++HC+ G GRTGT I ++ I  ++  + L  +D+   +  LR QR  +V+T++QF FV   I+      L I+ +
Sbjct:  119 ECAVAPQHYARNRYRDILPYDKNRVEIQKDSENPEGYMNASLI-----QLPGGKTEFIAAQAPLPATLDEWWKMIDEHRVSLVVILCKLVELNKIKCERYWPEQVGESELFGDYEITLEEEKLFDDDEYLMRCLKMENQTTGECRKVHQLHYREWPDHGCPSGEKQLLNMIDLMENIHEEVSPQDSSPILVHCSAGVGRTGTIIAINFIREQMKAETLHSIDIFGLVMTLRKQRASMVQTQDQFQFVHRCIASYCRRHLGIIEE 377          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 151.754 bits (382), Expect = 2.016e-37
Identity = 96/273 (35.16%), Postives = 140/273 (51.28%), Query Frame = 3
Query: 1428 NKEIFQSEWNSI-----LSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLKNAKN---GDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNESESA---HYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNN 2213
            N   FQSE+ SI      ++E   A +       N  KNRY +   YD SRV L N +     DYINA+ +  +D K   YIATQ PL +   DFW+MVWE+  V IV LT L E        YWP  G+  +   EV L+ E +    Y +R   LK +   E R +    + +WP   +P      L F ++V     + + PII HC+ G GRTG +I++D +L R+ +    +D+   +  LR QR ++V+TEEQ+ F+   + + VN+
Sbjct:  526 NNAGFQSEFESIETGQHFTWEHSSADM-------NKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYD-KPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLL-ESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERL-RYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNS 788          

HSP 2 Score: 144.436 bits (363), Expect = 4.346e-35
Identity = 83/237 (35.02%), Postives = 127/237 (53.59%), Query Frame = 3
Query: 1515 NLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNE---SESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYR--SKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISE 2201
            N PKNR    +PYD +RV ++    A   DYINAS I D   +   YIATQAP  +   DFW+ +WE    +I  L   NE    + + YWP E      +  V  ++E+     Y +R F + ++NT E RTV QFHF+ WP    P ++   L+F  +V+ +Y     + PI +HC  G GRT  +I L +IL+R+ +    +D+  T++ LR +R ++++  EQ+ F+     E
Sbjct:  841 NRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWI-DGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMK-HYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRM-RAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYE 1074          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 151.754 bits (382), Expect = 2.226e-37
Identity = 96/273 (35.16%), Postives = 140/273 (51.28%), Query Frame = 3
Query: 1428 NKEIFQSEWNSI-----LSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLKNAKN---GDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNESESA---HYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNN 2213
            N   FQSE+ SI      ++E   A +       N  KNRY +   YD SRV L N +     DYINA+ +  +D K   YIATQ PL +   DFW+MVWE+  V IV LT L E        YWP  G+  +   EV L+ E +    Y +R   LK +   E R +    + +WP   +P      L F ++V     + + PII HC+ G GRTG +I++D +L R+ +    +D+   +  LR QR ++V+TEEQ+ F+   + + VN+
Sbjct:  690 NNAGFQSEFESIETGQHFTWEHSSADM-------NKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYD-KPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLL-ESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERL-RYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNS 952          

HSP 2 Score: 144.821 bits (364), Expect = 4.243e-35
Identity = 83/237 (35.02%), Postives = 127/237 (53.59%), Query Frame = 3
Query: 1515 NLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNE---SESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYR--SKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISE 2201
            N PKNR    +PYD +RV ++    A   DYINAS I D   +   YIATQAP  +   DFW+ +WE    +I  L   NE    + + YWP E      +  V  ++E+     Y +R F + ++NT E RTV QFHF+ WP    P ++   L+F  +V+ +Y     + PI +HC  G GRT  +I L +IL+R+ +    +D+  T++ LR +R ++++  EQ+ F+     E
Sbjct: 1005 NRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWI-DGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMK-HYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRM-RAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYE 1238          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 151.754 bits (382), Expect = 2.522e-37
Identity = 96/273 (35.16%), Postives = 140/273 (51.28%), Query Frame = 3
Query: 1428 NKEIFQSEWNSI-----LSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLKNAKN---GDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNESESA---HYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNN 2213
            N   FQSE+ SI      ++E   A +       N  KNRY +   YD SRV L N +     DYINA+ +  +D K   YIATQ PL +   DFW+MVWE+  V IV LT L E        YWP  G+  +   EV L+ E +    Y +R   LK +   E R +    + +WP   +P      L F ++V     + + PII HC+ G GRTG +I++D +L R+ +    +D+   +  LR QR ++V+TEEQ+ F+   + + VN+
Sbjct:  659 NNAGFQSEFESIETGQHFTWEHSSADM-------NKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYD-KPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLL-ESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERL-RYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNS 921          

HSP 2 Score: 144.436 bits (363), Expect = 4.982e-35
Identity = 83/237 (35.02%), Postives = 127/237 (53.59%), Query Frame = 3
Query: 1515 NLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNE---SESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYR--SKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISE 2201
            N PKNR    +PYD +RV ++    A   DYINAS I D   +   YIATQAP  +   DFW+ +WE    +I  L   NE    + + YWP E      +  V  ++E+     Y +R F + ++NT E RTV QFHF+ WP    P ++   L+F  +V+ +Y     + PI +HC  G GRT  +I L +IL+R+ +    +D+  T++ LR +R ++++  EQ+ F+     E
Sbjct:  974 NRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWI-DGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMK-HYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRM-RAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYE 1207          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Fly
Match: IA-2 (gene:FBgn0031294 transcript:FBtr0301417)

HSP 1 Score: 364.385 bits (934), Expect = 2.166e-109
Identity = 169/294 (57.48%), Postives = 215/294 (73.13%), Query Frame = 3
Query: 1368 TNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRV---SLKNAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRS-KSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKIL 2228
            TNMDI TGHM+LSYME H +NK   Q EW ++  YE E +  EAA + +    NR    +PYD SRV    L NA+  DY+NAS I DHDP+ P Y+A Q PL   +  FWQM+WEQG VVIV L  L E+     A YWP+EG+++++IYEV+LVSEHIW D+YLVR+FYLKNL T+ETRTVTQFHFLSWP   +P+ ++++L+FRRKVNKSYR  +S PI++H + G GRTG YILLDL+L R+ KG +E+D+AATLEHLRDQR  +V T +QF FVL  ++EEV+ ILK L
Sbjct:  923 TNMDISTGHMVLSYMEDHLRNKGRLQREWEALCRYEAEPSAREAASQPQCAGLNRPGAPLPYDHSRVVLNHLANAEGLDYVNASTITDHDPRAPAYVAAQGPLPSTLAHFWQMIWEQGAVVIVALCRLQENGEVACARYWPEEGAEVYHIYEVHLVSEHIWCDDYLVRSFYLKNLRTSETRTVTQFHFLSWPHMGVPAQAKALLDFRRKVNKSYRGRRSCPIVVHGSAGAGRTGVYILLDLVLERMNKGAREIDIAATLEHLRDQRAGVVATRQQFEFVLMAVAEEVHAILKAL 1216          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Fly
Match: IA-2 (gene:FBgn0031294 transcript:FBtr0301416)

HSP 1 Score: 364.385 bits (934), Expect = 2.543e-109
Identity = 169/294 (57.48%), Postives = 215/294 (73.13%), Query Frame = 3
Query: 1368 TNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRV---SLKNAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRS-KSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKIL 2228
            TNMDI TGHM+LSYME H +NK   Q EW ++  YE E +  EAA + +    NR    +PYD SRV    L NA+  DY+NAS I DHDP+ P Y+A Q PL   +  FWQM+WEQG VVIV L  L E+     A YWP+EG+++++IYEV+LVSEHIW D+YLVR+FYLKNL T+ETRTVTQFHFLSWP   +P+ ++++L+FRRKVNKSYR  +S PI++H + G GRTG YILLDL+L R+ KG +E+D+AATLEHLRDQR  +V T +QF FVL  ++EEV+ ILK L
Sbjct:  936 TNMDISTGHMVLSYMEDHLRNKGRLQREWEALCRYEAEPSAREAASQPQCAGLNRPGAPLPYDHSRVVLNHLANAEGLDYVNASTITDHDPRAPAYVAAQGPLPSTLAHFWQMIWEQGAVVIVALCRLQENGEVACARYWPEEGAEVYHIYEVHLVSEHIWCDDYLVRSFYLKNLRTSETRTVTQFHFLSWPHMGVPAQAKALLDFRRKVNKSYRGRRSCPIVVHGSAGAGRTGVYILLDLVLERMNKGAREIDIAATLEHLRDQRAGVVATRQQFEFVLMAVAEEVHAILKAL 1229          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Fly
Match: IA-2 (gene:FBgn0031294 transcript:FBtr0332270)

HSP 1 Score: 363.999 bits (933), Expect = 4.031e-109
Identity = 169/294 (57.48%), Postives = 215/294 (73.13%), Query Frame = 3
Query: 1368 TNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRV---SLKNAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRS-KSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKIL 2228
            TNMDI TGHM+LSYME H +NK   Q EW ++  YE E +  EAA + +    NR    +PYD SRV    L NA+  DY+NAS I DHDP+ P Y+A Q PL   +  FWQM+WEQG VVIV L  L E+     A YWP+EG+++++IYEV+LVSEHIW D+YLVR+FYLKNL T+ETRTVTQFHFLSWP   +P+ ++++L+FRRKVNKSYR  +S PI++H + G GRTG YILLDL+L R+ KG +E+D+AATLEHLRDQR  +V T +QF FVL  ++EEV+ ILK L
Sbjct:  935 TNMDISTGHMVLSYMEDHLRNKGRLQREWEALCRYEAEPSAREAASQPQCAGLNRPGAPLPYDHSRVVLNHLANAEGLDYVNASTITDHDPRAPAYVAAQGPLPSTLAHFWQMIWEQGAVVIVALCRLQENGEVACARYWPEEGAEVYHIYEVHLVSEHIWCDDYLVRSFYLKNLRTSETRTVTQFHFLSWPHMGVPAQAKALLDFRRKVNKSYRGRRSCPIVVHGSAGAGRTGVYILLDLVLERMNKGAREIDIAATLEHLRDQRAGVVATRQQFEFVLMAVAEEVHAILKAL 1228          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Fly
Match: Ptpmeg2 (gene:FBgn0028341 transcript:FBtr0071407)

HSP 1 Score: 150.214 bits (378), Expect = 3.562e-38
Identity = 94/275 (34.18%), Postives = 148/275 (53.82%), Query Frame = 3
Query: 1422 QKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLKNAKN---GDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYW-PKEGSQI-FNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNK-------------SYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFV 2183
            Q+ +     E+  I +   E   + A ++  NL KNRY D + YD SRV L +       DYINA+  VD   +   YI+TQ PL K   DFW+M+WEQ  +VIV  T + E    +   YW P E S + F  Y V  +S    +++Y+V +  L+N+ T E R V+ + F SWP   +PSS+ ++L F +KV +             +   +  PI++HC+ G GRTGT+I LD+ ++R+ + +   D+  T+E +R QR + ++  +Q+ F 
Sbjct:  198 QRGRHGLIKEYADIRNRAPEGTFLHARMR-ANLTKNRYTDVLCYDHSRVVLAHEDGDEPSDYINANF-VDGYKQKNAYISTQGPLPKTSQDFWRMIWEQHCLVIVMTTRVMERGRVKCGQYWEPTEESSLEFGDYHVRTISVEC-NEDYMVASLELRNIKTDEIRNVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQAQLVQGLGDTWAGHPRGPPIVVHCSAGIGRTGTFITLDICISRL-EDVGTADIRGTVEKIRSQRAYSIQMPDQYVFC 468          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Fly
Match: Ptpmeg2 (gene:FBgn0028341 transcript:FBtr0333427)

HSP 1 Score: 150.214 bits (378), Expect = 3.562e-38
Identity = 94/275 (34.18%), Postives = 148/275 (53.82%), Query Frame = 3
Query: 1422 QKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLKNAKN---GDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYW-PKEGSQI-FNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNK-------------SYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFV 2183
            Q+ +     E+  I +   E   + A ++  NL KNRY D + YD SRV L +       DYINA+  VD   +   YI+TQ PL K   DFW+M+WEQ  +VIV  T + E    +   YW P E S + F  Y V  +S    +++Y+V +  L+N+ T E R V+ + F SWP   +PSS+ ++L F +KV +             +   +  PI++HC+ G GRTGT+I LD+ ++R+ + +   D+  T+E +R QR + ++  +Q+ F 
Sbjct:  198 QRGRHGLIKEYADIRNRAPEGTFLHARMR-ANLTKNRYTDVLCYDHSRVVLAHEDGDEPSDYINANF-VDGYKQKNAYISTQGPLPKTSQDFWRMIWEQHCLVIVMTTRVMERGRVKCGQYWEPTEESSLEFGDYHVRTISVEC-NEDYMVASLELRNIKTDEIRNVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQAQLVQGLGDTWAGHPRGPPIVVHCSAGIGRTGTFITLDICISRL-EDVGTADIRGTVEKIRSQRAYSIQMPDQYVFC 468          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Zebrafish
Match: ptprna (protein tyrosine phosphatase receptor type Na [Source:ZFIN;Acc:ZDB-GENE-030131-3511])

HSP 1 Score: 399.823 bits (1026), Expect = 1.603e-125
Identity = 181/300 (60.33%), Postives = 225/300 (75.00%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTEL---NESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E    +NMDI TGHMIL+YME H KNK+  Q EW ++ SY+ E + +  A    N+ KNRY D +PYD SRV LK   N   GDYINAS I+DHDP+LP YIATQ PL   V DFWQMVWE G  VIV +T L    E +   YWP EGS ++NIYEVNLVSEHIW  ++LVR+FYLKN+ T ETRT+TQFH LSWP + +PSS+R +L+FRRKVNK YR +S PII+HC++G GRTGTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  +V+T++QF F LT ++EEVN ILK L Q
Sbjct:  604 EEPAQSNMDISTGHMILAYMEDHLKNKDRLQKEWEALCSYQAEPSSVSVAQCESNMEKNRYPDFVPYDHSRVKLKAEVNPSKGDYINASTIIDHDPRLPAYIATQGPLPHTVADFWQMVWENGCTVIVMMTALVEDGEKQCERYWPDEGSSLYNIYEVNLVSEHIWCKDFLVRSFYLKNVQTQETRTLTQFHLLSWPANGIPSSTRPLLDFRRKVNKCYRGRSCPIIVHCSNGTGRTGTYILIDMVLNRMAKGVKEIDIAATLEHIRDQRPSMVRTKDQFEFALTAVAEEVNAILKALPQ 903          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Zebrafish
Match: ptprnb (protein tyrosine phosphatase receptor type Nb [Source:ZFIN;Acc:ZDB-GENE-100505-1])

HSP 1 Score: 390.193 bits (1001), Expect = 2.585e-122
Identity = 177/300 (59.00%), Postives = 224/300 (74.67%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTEL---NESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E    +NMDI TGHMIL+YME H KNK+    EW ++ SY+ E + I AA    N+ KNR  D +PYD SRV LK   N    DYINAS I++HDP++P YIATQ PL   + DFWQMVWE G  VIV +T L    E +   YWP EGS +++IYEVNLVSEHIW +++LVR+FYLKN+ T ETRT+TQFHFLSWP   +P+S+R +L+FRRKVNK YR +S PII+HC+DG GRTGTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  +V+T++QF F LT ++EEVN ILK L Q
Sbjct:  568 EEPAQSNMDISTGHMILAYMEDHLKNKDRLLKEWEALCSYQAEPSTISAAQSESNIKKNRCSDAVPYDHSRVKLKAEINPSRTDYINASTIIEHDPRMPAYIATQGPLSHTISDFWQMVWESGCTVIVMMTALVEDGEKQCDRYWPDEGSSLYHIYEVNLVSEHIWCNDFLVRSFYLKNVQTQETRTLTQFHFLSWPAQGIPTSTRPLLDFRRKVNKCYRGRSCPIIVHCSDGTGRTGTYILIDMVLNRMAKGVKEIDIAATLEHIRDQRPGMVRTKDQFEFALTAVAEEVNAILKALPQ 867          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Zebrafish
Match: AL928556.1 (protein tyrosine phosphatase receptor type Nb [Source:NCBI gene;Acc:564351])

HSP 1 Score: 389.423 bits (999), Expect = 3.526e-122
Identity = 177/300 (59.00%), Postives = 224/300 (74.67%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTEL---NESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E    +NMDI TGHMIL+YME H KNK+    EW ++ SY+ E + I AA    N+ KNR  D +PYD SRV LK   N    DYINAS I++HDP++P YIATQ PL   + DFWQMVWE G  VIV +T L    E +   YWP EGS +++IYEVNLVSEHIW +++LVR+FYLKN+ T ETRT+TQFHFLSWP   +P+S+R +L+FRRKVNK YR +S PII+HC+DG GRTGTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  +V+T++QF F LT ++EEVN ILK L Q
Sbjct:  556 EEPAQSNMDISTGHMILAYMEDHLKNKDRLLKEWEALCSYQAEPSTISAAQSESNIKKNRCSDAVPYDHSRVKLKAEINPSRTDYINASTIIEHDPRMPAYIATQGPLSHTISDFWQMVWESGCTVIVMMTALVEDGEKQCDRYWPDEGSSLYHIYEVNLVSEHIWCNDFLVRSFYLKNVQTQETRTLTQFHFLSWPAQGIPTSTRPLLDFRRKVNKCYRGRSCPIIVHCSDGTGRTGTYILIDMVLNRMAKGVKEIDIAATLEHIRDQRPGMVRTKDQFEFALTAVAEEVNAILKALPQ 855          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Zebrafish
Match: ptprnb (protein tyrosine phosphatase receptor type Nb [Source:ZFIN;Acc:ZDB-GENE-100505-1])

HSP 1 Score: 390.578 bits (1002), Expect = 5.188e-122
Identity = 177/300 (59.00%), Postives = 224/300 (74.67%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTEL---NESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E    +NMDI TGHMIL+YME H KNK+    EW ++ SY+ E + I AA    N+ KNR  D +PYD SRV LK   N    DYINAS I++HDP++P YIATQ PL   + DFWQMVWE G  VIV +T L    E +   YWP EGS +++IYEVNLVSEHIW +++LVR+FYLKN+ T ETRT+TQFHFLSWP   +P+S+R +L+FRRKVNK YR +S PII+HC+DG GRTGTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  +V+T++QF F LT ++EEVN ILK L Q
Sbjct:  617 EEPAQSNMDISTGHMILAYMEDHLKNKDRLLKEWEALCSYQAEPSTISAAQSESNIKKNRCSDAVPYDHSRVKLKAEINPSRTDYINASTIIEHDPRMPAYIATQGPLSHTISDFWQMVWESGCTVIVMMTALVEDGEKQCDRYWPDEGSSLYHIYEVNLVSEHIWCNDFLVRSFYLKNVQTQETRTLTQFHFLSWPAQGIPTSTRPLLDFRRKVNKCYRGRSCPIIVHCSDGTGRTGTYILIDMVLNRMAKGVKEIDIAATLEHIRDQRPGMVRTKDQFEFALTAVAEEVNAILKALPQ 916          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Zebrafish
Match: ptprn2 (protein tyrosine phosphatase receptor type N2 [Source:ZFIN;Acc:ZDB-GENE-030131-3758])

HSP 1 Score: 371.318 bits (952), Expect = 4.641e-114
Identity = 173/295 (58.64%), Postives = 217/295 (73.56%), Query Frame = 3
Query: 1368 TNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            TNMDI TGHMILSYME H +NK+    EW ++ SY+ E A      + +N+ +NR    + YD SR  LK   N    DYINAS I+DHDP+ P YI+ Q PL   V DFWQMVWE G VVIV LT L E+   +   YWP EGS +++IYEVNLVSEHIW D++LVR+FYLKN+ T ETRTVTQFHFLSW    +P S+R++L+FRRKVNK YR +S PII+HC+DG GR+GTYIL+D++LN++ KG KE+D+AATLEHLRDQR  +V+T++QF F LT ++EEVN ILK L Q
Sbjct:  692 TNMDISTGHMILSYMEDHLQNKDRLDKEWEALCSYQAEPAVCAVGQEEQNVQRNRPHGVLVYDHSRFILKLENNQSRSDYINASPIMDHDPRNPAYISAQGPLPSTVADFWQMVWESGCVVIVMLTPLAENGLKQCHQYWPDEGSDLYHIYEVNLVSEHIWCDDFLVRSFYLKNVQTNETRTVTQFHFLSWMDQNVPESARTLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYILIDMVLNKMAKGAKEIDIAATLEHLRDQRSGMVQTKDQFEFALTAVAEEVNAILKALPQ 986          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Xenopus
Match: gpr26 (G protein-coupled receptor 26 [Source:Xenbase;Acc:XB-GENE-990649])

HSP 1 Score: 376.326 bits (965), Expect = 3.404e-121
Identity = 171/300 (57.00%), Postives = 224/300 (74.67%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E  V +NMDI TGHMIL+YME H +N++    EW ++ +Y+ E      A    NL KNR  D +PYD +R+ L+   N    +YINAS I++HDP++P YIATQ PL   + DFWQMVWE G  VIV L+ L E    +   YWP EGS +++IYEVNLVSEHIW +++LVR+FYLKN+ T ETRT+TQFHFLSWP + +PSS+R +L+FRRKVNKS+R +S PII+HC+DG GRTGTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  +V+T++QF F LT ++EEVN ILK L Q
Sbjct:  204 EEPVQSNMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNNCSRAKNDTNLKKNRNPDFVPYDHARIKLRSETNPSRSEYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWENGCTVIVMLSPLVEDGVKQCDRYWPDEGSSLYHIYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGIPSSTRPLLDFRRKVNKSFRGRSCPIIVHCSDGAGRTGTYILVDMVLNRMAKGVKEIDIAATLEHVRDQRPGMVRTKDQFEFALTAVAEEVNAILKALPQ 503          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Xenopus
Match: gpr26 (G protein-coupled receptor 26 [Source:Xenbase;Acc:XB-GENE-990649])

HSP 1 Score: 379.793 bits (974), Expect = 6.182e-120
Identity = 171/300 (57.00%), Postives = 224/300 (74.67%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E  V +NMDI TGHMIL+YME H +N++    EW ++ +Y+ E      A    NL KNR  D +PYD +R+ L+   N    +YINAS I++HDP++P YIATQ PL   + DFWQMVWE G  VIV L+ L E    +   YWP EGS +++IYEVNLVSEHIW +++LVR+FYLKN+ T ETRT+TQFHFLSWP + +PSS+R +L+FRRKVNKS+R +S PII+HC+DG GRTGTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  +V+T++QF F LT ++EEVN ILK L Q
Sbjct:  408 EEPVQSNMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNNCSRAKNDTNLKKNRNPDFVPYDHARIKLRSETNPSRSEYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWENGCTVIVMLSPLVEDGVKQCDRYWPDEGSSLYHIYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGIPSSTRPLLDFRRKVNKSFRGRSCPIIVHCSDGAGRTGTYILVDMVLNRMAKGVKEIDIAATLEHVRDQRPGMVRTKDQFEFALTAVAEEVNAILKALPQ 707          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Xenopus
Match: gpr26 (G protein-coupled receptor 26 [Source:Xenbase;Acc:XB-GENE-990649])

HSP 1 Score: 379.022 bits (972), Expect = 2.054e-119
Identity = 171/300 (57.00%), Postives = 224/300 (74.67%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E  V +NMDI TGHMIL+YME H +N++    EW ++ +Y+ E      A    NL KNR  D +PYD +R+ L+   N    +YINAS I++HDP++P YIATQ PL   + DFWQMVWE G  VIV L+ L E    +   YWP EGS +++IYEVNLVSEHIW +++LVR+FYLKN+ T ETRT+TQFHFLSWP + +PSS+R +L+FRRKVNKS+R +S PII+HC+DG GRTGTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  +V+T++QF F LT ++EEVN ILK L Q
Sbjct:  428 EEPVQSNMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNNCSRAKNDTNLKKNRNPDFVPYDHARIKLRSETNPSRSEYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWENGCTVIVMLSPLVEDGVKQCDRYWPDEGSSLYHIYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGIPSSTRPLLDFRRKVNKSFRGRSCPIIVHCSDGAGRTGTYILVDMVLNRMAKGVKEIDIAATLEHVRDQRPGMVRTKDQFEFALTAVAEEVNAILKALPQ 727          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Xenopus
Match: gpr26 (G protein-coupled receptor 26 [Source:Xenbase;Acc:XB-GENE-990649])

HSP 1 Score: 376.326 bits (965), Expect = 6.988e-119
Identity = 171/300 (57.00%), Postives = 224/300 (74.67%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E  V +NMDI TGHMIL+YME H +N++    EW ++ +Y+ E      A    NL KNR  D +PYD +R+ L+   N    +YINAS I++HDP++P YIATQ PL   + DFWQMVWE G  VIV L+ L E    +   YWP EGS +++IYEVNLVSEHIW +++LVR+FYLKN+ T ETRT+TQFHFLSWP + +PSS+R +L+FRRKVNKS+R +S PII+HC+DG GRTGTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  +V+T++QF F LT ++EEVN ILK L Q
Sbjct:  382 EEPVQSNMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNNCSRAKNDTNLKKNRNPDFVPYDHARIKLRSETNPSRSEYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWENGCTVIVMLSPLVEDGVKQCDRYWPDEGSSLYHIYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGIPSSTRPLLDFRRKVNKSFRGRSCPIIVHCSDGAGRTGTYILVDMVLNRMAKGVKEIDIAATLEHVRDQRPGMVRTKDQFEFALTAVAEEVNAILKALPQ 681          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Xenopus
Match: gpr26 (G protein-coupled receptor 26 [Source:Xenbase;Acc:XB-GENE-990649])

HSP 1 Score: 381.719 bits (979), Expect = 5.123e-118
Identity = 171/300 (57.00%), Postives = 224/300 (74.67%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E  V +NMDI TGHMIL+YME H +N++    EW ++ +Y+ E      A    NL KNR  D +PYD +R+ L+   N    +YINAS I++HDP++P YIATQ PL   + DFWQMVWE G  VIV L+ L E    +   YWP EGS +++IYEVNLVSEHIW +++LVR+FYLKN+ T ETRT+TQFHFLSWP + +PSS+R +L+FRRKVNKS+R +S PII+HC+DG GRTGTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  +V+T++QF F LT ++EEVN ILK L Q
Sbjct:  668 EEPVQSNMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNNCSRAKNDTNLKKNRNPDFVPYDHARIKLRSETNPSRSEYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWENGCTVIVMLSPLVEDGVKQCDRYWPDEGSSLYHIYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGIPSSTRPLLDFRRKVNKSFRGRSCPIIVHCSDGAGRTGTYILVDMVLNRMAKGVKEIDIAATLEHVRDQRPGMVRTKDQFEFALTAVAEEVNAILKALPQ 967          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Mouse
Match: Ptprn (protein tyrosine phosphatase, receptor type, N [Source:MGI Symbol;Acc:MGI:102765])

HSP 1 Score: 385.185 bits (988), Expect = 2.567e-119
Identity = 171/300 (57.00%), Postives = 222/300 (74.00%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNE---SESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E     NMDI TGHMIL+YME H +N++    EW ++ +Y+ E     AA    N+ KNR+ D +PYD +R+ LK   +    DYINAS I++HDP++P YIATQ PL   + DFWQMVWE G  VIV LT L E    +   YWP EGS ++++YEVNLVSEHIW +++LVR+FYLKNL T ETRT+TQFHFLSWP +  P+S+R +L+FRRKVNK YR +S PII+HC+DG GRTGTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  LV++++QF F LT ++EEVN ILK L Q
Sbjct:  682 EEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCAAAQDESNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGSSLYHVYEVNLVSEHIWCEDFLVRSFYLKNLQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRGRSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFEFALTAVAEEVNAILKALPQ 981          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Mouse
Match: Ptprn2 (protein tyrosine phosphatase, receptor type, N polypeptide 2 [Source:MGI Symbol;Acc:MGI:107418])

HSP 1 Score: 379.407 bits (973), Expect = 6.191e-117
Identity = 178/300 (59.33%), Postives = 223/300 (74.33%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLKNA---KNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E  V +NMDI TGHMIL+YME H KNK   + EW ++ +Y+ E      A + EN PKNR    + YD SR+ LK+     + DYINAS I+DHDP+ P YIATQ PL   V DFWQMVWE G  VIV LT L+E+   +  HYWP EGS ++++YEVNLVSEHIW  ++LVR+FYLKNL T ETRTVTQFHFLSW    +PSS+RS+L+FRRKVNK YR +S PII+HC+DG GR+GTY+L+D++LN++ KG KE+D+AATLEHLRDQR  +V+T+EQF F LT ++EEVN ILK L Q
Sbjct:  702 EEPVQSNMDISTGHMILAYMEDHLKNKNRLEKEWEALCAYQAEPNSSLVAQREENAPKNRSLAVLTYDHSRILLKSQNSHGSSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCAVIVMLTPLSENGVRQCHHYWPDEGSNLYHVYEVNLVSEHIWCQDFLVRSFYLKNLQTNETRTVTQFHFLSWYDQGVPSSTRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDMVLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKALPQ 1001          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Mouse
Match: Ptprn2 (protein tyrosine phosphatase, receptor type, N polypeptide 2 [Source:MGI Symbol;Acc:MGI:107418])

HSP 1 Score: 280.796 bits (717), Expect = 5.395e-81
Identity = 134/231 (58.01%), Postives = 165/231 (71.43%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLKNA---KNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCN 2027
            E  V +NMDI TGHMIL+YME H KNK   + EW ++ +Y+ E      A + EN PKNR    + YD SR+ LK+     + DYINAS I+DHDP+ P YIATQ PL   V DFWQMVWE G  VIV LT L+E+   +  HYWP EGS ++++YEVNLVSEHIW  ++LVR+FYLKNL T ETRTVTQFHFLSW    +PSS+RS+L+FRRKVNK YR +S PII+HC+
Sbjct:  702 EEPVQSNMDISTGHMILAYMEDHLKNKNRLEKEWEALCAYQAEPNSSLVAQREENAPKNRSLAVLTYDHSRILLKSQNSHGSSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCAVIVMLTPLSENGVRQCHHYWPDEGSNLYHVYEVNLVSEHIWCQDFLVRSFYLKNLQTNETRTVTQFHFLSWYDQGVPSSTRSLLDFRRKVNKCYRGRSCPIIVHCS 932          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Mouse
Match: Ptprf (protein tyrosine phosphatase, receptor type, F [Source:MGI Symbol;Acc:MGI:102695])

HSP 1 Score: 166.777 bits (421), Expect = 9.878e-42
Identity = 94/265 (35.47%), Postives = 145/265 (54.72%), Query Frame = 3
Query: 1440 FQSEWNSI-----LSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRV---SLKNAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNESESA---HYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISE 2201
            F  E+ SI      ++E  ++++       N PKNRY + I YD SRV   S+      DYINA+ I D   K   YIATQ PL + +GDFW+MVWEQ    +V +T L E        YWP  G++ + + +V LV + +    Y +R F L    ++E R + QF F++WP   +P     IL F R+V       + P+++HC+ G GRTG +I++D +L R+ K  K +D+   +  +R QR ++V+TE+Q+ F+   + E
Sbjct: 1343 FSQEYESIDPGQQFTWENSNSEV-------NKPKNRYANVIAYDHSRVLLTSIDGVPGSDYINANYI-DGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPVRGTETYGLIQVTLV-DTVELATYTMRTFALHKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERM-KHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLE 1597          

HSP 2 Score: 145.591 bits (366), Expect = 5.601e-35
Identity = 82/233 (35.19%), Postives = 137/233 (58.80%), Query Frame = 3
Query: 1515 NLPKNRYQDKI----PYDKSRVSL---KNAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNE--SESAH-YWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRS--KSTPIIIHCNDGCGRTGTYILLDLILNRI-CKGLKEMDLAATLEHLRDQRMHLVKTEEQF 2174
            NLP N++++++    PY+ +RV L   +  +  DYINAS + D   +   YIATQ PL +   DFW+M+WE    +IV LT+L E   E  H YWP E S  +  + V+ ++E+    +Y++R F + +    ++RT+ QF F  WP   +P +    ++F  +V+K+     +  PI +HC+ G GRTG +I L ++L R+  +G+  +D+  T++ LR QR  +V+TE+Q+
Sbjct: 1651 NLPCNKFKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFL-DGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMP-QYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGV--VDMFQTVKTLRTQRPAMVQTEDQY 1879          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Mouse
Match: Ptprs (protein tyrosine phosphatase, receptor type, S [Source:MGI Symbol;Acc:MGI:97815])

HSP 1 Score: 166.777 bits (421), Expect = 1.008e-41
Identity = 99/277 (35.74%), Postives = 148/277 (53.43%), Query Frame = 3
Query: 1407 YMEKHQKNKEI-FQSEWNSI---LSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRV---SLKNAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEV 2207
            +ME+ + N  +    E+ SI     +  E + +EA     N PKNRY + I YD SRV    L+     DYINA+  VD   +   YIATQ PL +  GDFW+MVWEQ    +V +T L E    +   YWP  G++ +   +V L+ + +    + VR F L    ++E R V  F F +WP   +P      L F R+V       + PI++HC+ G GRTG +I++D +L RI K  K +D+   +  +R QR ++V+TE+Q+GF+   + E V
Sbjct: 1340 HMERLKANDSLKLSQEYESIDPGQQFTWEHSNLEA-----NKPKNRYANVIAYDHSRVILQPLEGIMGSDYINANY-VDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLL-DTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERI-KTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAV 1608          

HSP 2 Score: 143.28 bits (360), Expect = 2.547e-34
Identity = 84/235 (35.74%), Postives = 132/235 (56.17%), Query Frame = 3
Query: 1524 KNRYQDKIPYDKSRVSL---KNAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNE--SESAH-YWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRS--KSTPIIIHCNDGCGRTGTYILLDLILNRI-CKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISE 2201
            KNR  + +PY+ SRV L   +  +  DYINAS I D   +   YIATQ PL +   DFW+ +WE    ++V LT+L E   E  H YWP E S  +  + V+ ++E+    +Y++R F + +    ++RTV QF F  WP    P S    ++F  +V+K+     +  PI +HC+ G GRTG +I L ++L R+  +G+  +D+  T++ LR QR  +V+TE+++ F      E
Sbjct: 1667 KNRLVNILPYESSRVCLQPIRGVEGSDYINASFI-DGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMP-QYILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGV--VDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALE 1897          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. UniProt/SwissProt
Match: sp|O02695|PTPR2_MACNE (Receptor-type tyrosine-protein phosphatase N2 OS=Macaca nemestrina OX=9545 GN=PTPRN2 PE=2 SV=1)

HSP 1 Score: 387.882 bits (995), Expect = 4.502e-119
Identity = 184/300 (61.33%), Postives = 225/300 (75.00%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E  V +NMDI TGHMILSYME H KNK   + EW ++ +Y+ E      A K EN+PKNR    + YD SRV LK   +  + DYINAS I+DHDP+ P YIATQ PL   V DFWQMVWE G VVIV LT L E+   +  HYWP EGS +++IYEVNLVSEHIW +++LVR+FYLKNL T ETRTVTQFHFLSW    +PSSSRS+L+FRRKVNK YR +S PII+HC+DG GR+GTY+L+D++LN++ KG KE+D+AATLEHLRDQR  +V+T+EQF F LT ++EEVN ILK L Q
Sbjct:  714 EEPVQSNMDISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNSSLVAQKEENVPKNRSLAVLTYDHSRVLLKAENSHSHSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCVVIVMLTPLTENGVRQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWYDRGVPSSSRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDMVLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKALPQ 1013          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. UniProt/SwissProt
Match: sp|Q92932|PTPR2_HUMAN (Receptor-type tyrosine-protein phosphatase N2 OS=Homo sapiens OX=9606 GN=PTPRN2 PE=1 SV=2)

HSP 1 Score: 385.956 bits (990), Expect = 2.211e-118
Identity = 183/300 (61.00%), Postives = 225/300 (75.00%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E  V +NMDI TGHMILSYME H KNK   + EW ++ +Y+ E      A + EN+PKNR    + YD SRV LK   +  + DYINAS I+DHDP+ P YIATQ PL   V DFWQMVWE G VVIV LT L E+   +  HYWP EGS +++IYEVNLVSEHIW +++LVR+FYLKNL T ETRTVTQFHFLSW    +PSSSRS+L+FRRKVNK YR +S PII+HC+DG GR+GTY+L+D++LN++ KG KE+D+AATLEHLRDQR  +V+T+EQF F LT ++EEVN ILK L Q
Sbjct:  716 EEPVQSNMDISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNSSFVAQREENVPKNRSLAVLTYDHSRVLLKAENSHSHSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCVVIVMLTPLAENGVRQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWYDRGVPSSSRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDMVLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKALPQ 1015          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. UniProt/SwissProt
Match: sp|Q60673|PTPRN_MOUSE (Receptor-type tyrosine-protein phosphatase-like N OS=Mus musculus OX=10090 GN=Ptprn PE=1 SV=2)

HSP 1 Score: 384.8 bits (987), Expect = 2.403e-118
Identity = 171/300 (57.00%), Postives = 222/300 (74.00%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNE---SESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E     NMDI TGHMIL+YME H +N++    EW ++ +Y+ E     AA    N+ KNR+ D +PYD +R+ LK   +    DYINAS I++HDP++P YIATQ PL   + DFWQMVWE G  VIV LT L E    +   YWP EGS ++++YEVNLVSEHIW +++LVR+FYLKNL T ETRT+TQFHFLSWP +  P+S+R +L+FRRKVNK YR +S PII+HC+DG GRTGTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  LV++++QF F LT ++EEVN ILK L Q
Sbjct:  680 EEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCAAAQDESNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGSSLYHVYEVNLVSEHIWCEDFLVRSFYLKNLQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRGRSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFEFALTAVAEEVNAILKALPQ 979          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. UniProt/SwissProt
Match: sp|Q63259|PTPRN_RAT (Receptor-type tyrosine-protein phosphatase-like N OS=Rattus norvegicus OX=10116 GN=Ptprn PE=1 SV=2)

HSP 1 Score: 382.489 bits (981), Expect = 2.431e-117
Identity = 169/300 (56.33%), Postives = 221/300 (73.67%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNE---SESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E     NMDI TGHMIL+YME H +N++    EW ++ +Y+ E      A    N+ KNR+ D +PYD +R+ LK   +    DYINAS I++HDP++P YIATQ PL   + DFWQMVWE G  VIV LT L E    +   YWP EGS ++++YEVNLVSEHIW +++LVR+FYLKN+ T ETRT+TQFHFLSWP +  P+S+R +L+FRRKVNK YR +S PII+HC+DG GRTGTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  LV++++QF F LT ++EEVN ILK L Q
Sbjct:  684 EEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGSSLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRGRSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFEFALTAVAEEVNAILKALPQ 983          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. UniProt/SwissProt
Match: sp|P56722|PTPRN_BOVIN (Receptor-type tyrosine-protein phosphatase-like N OS=Bos taurus OX=9913 GN=PTPRN PE=1 SV=1)

HSP 1 Score: 382.104 bits (980), Expect = 2.455e-117
Identity = 169/300 (56.33%), Postives = 221/300 (73.67%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNE---SESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E     NMDI TGHMIL+YME H +N++    EW ++ +Y+ E      A    N+ KNR+ D +PYD +R+ LK   +    DYINAS I++HDP++P YIATQ PL   + DFWQMVWE G  VIV LT L E    +   YWP EGS ++++YEVNLVSEHIW +++LVR+FYLKN+ T ETRT+TQFHFLSWP +  P+S+R +L+FRRKVNK YR +S PII+HC+DG GRTGTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  LV++++QF F LT ++EEVN ILK L Q
Sbjct:  680 EEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGSSLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRGRSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFEFALTAVAEEVNAILKALPQ 979          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. TrEMBL
Match: A0A3R7QDB9 (Receptor-type tyrosine-protein phosphatase N2 OS=Penaeus vannamei OX=6689 GN=C7M84_006396 PE=4 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 1.941e-124
Identity = 180/293 (61.43%), Postives = 222/293 (75.77%), Query Frame = 3
Query: 1374 MDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSL---KNAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNESESA---HYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            MDI TGHM+LSYME H KNK+  + EW ++ +YE E      A+K EN  KNRY D +PYD +RV L    N    DYINAS I DHDP+ P YIATQ PL+    DFWQ+VWEQG VVIV LT L E+  A    YWP+EGS +++IYEV+LVSEHIW D+YLVR+FYLKN+ T ETRTVTQFHFLSWP    P+S++++LEFRRKVNKSYR +S PII+HC+DG GRTGTY L+D++LNR+ KG KE+D+AATLEH+RDQR H+VK++ QF FVL  ++EEV+ ILK L Q
Sbjct:    1 MDISTGHMVLSYMEDHLKNKDRLEQEWIALCAYEAEPCATTLALKPENNKKNRYPDAVPYDHNRVVLNSHANVNGSDYINASSITDHDPRNPAYIATQGPLDATAADFWQLVWEQGSVVIVMLTRLTENGHAFCHRYWPEEGSDLYHIYEVHLVSEHIWCDDYLVRSFYLKNVRTGETRTVTQFHFLSWPDSGTPASTKALLEFRRKVNKSYRGRSCPIIVHCSDGIGRTGTYCLIDMVLNRMAKGAKEIDIAATLEHIRDQRPHMVKSKAQFEFVLMAVAEEVHAILKALPQ 293          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. TrEMBL
Match: G1N0Q3 (Protein tyrosine phosphatase receptor type N2 OS=Meleagris gallopavo OX=9103 GN=PTPRN2 PE=4 SV=2)

HSP 1 Score: 385.956 bits (990), Expect = 7.183e-124
Identity = 181/300 (60.33%), Postives = 227/300 (75.67%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E  V +NMDI TGHMILSYME H KNK   + EW ++ +Y+ E      A K EN+ KNR +  +PYD SR+ LK   +  N DYINAS I+DHDP+ P +IATQ PL   V DFWQMVWE G VVIV LT L ES   +  HYWP EGS +++IYEVNLVSEHIW +++LVR+FYLKNL T ETRTVTQFHFLSW   ++P+S+RS+L+FRRKVNK YR +S P+++HC+DG GR+GTYIL+D++LN++ KG KE+D+AATLEHLRDQR  +V+T+EQF F LT ++EEVN ILK L Q
Sbjct:   50 EEPVQSNMDISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNATTVAQKEENVQKNRSRAVVPYDHSRICLKAENSHDNSDYINASPIMDHDPRNPAFIATQGPLPATVADFWQMVWENGCVVIVMLTPLTESGVKQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWNDQRVPASTRSLLDFRRKVNKCYRGRSCPVVVHCSDGAGRSGTYILIDMVLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKALPQ 349          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. TrEMBL
Match: A0A093G9S3 (Receptor-type tyrosine-protein phosphatase N2 (Fragment) OS=Dryobates pubescens OX=118200 GN=N307_09115 PE=4 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 9.827e-124
Identity = 199/377 (52.79%), Postives = 255/377 (67.64%), Query Frame = 3
Query: 1122 QKFRYKRDKLGDILKSKFPDNSSSSYKELFRGSNNKDTTIIKNKQGVARMNSKQHSGDXXXXXXXXXXXXXXXXXXDEMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLKNAK---NGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
             + R K   LG  + S  P    ++Y+EL R      T+        +R+NS   S        P  +  S++S   E  V +NMDI TGHMILSYME H KNK   + EW ++ +Y+ E      A + EN+ KNR Q  +PYD SR+ LK      N DYINAS I+DHDP+ P YIATQ PL   V DFWQMVWE G VVIV LT L E+   +  HYWP EGS +++IYEVNLVSEHIW +++LVR+FYLKNL T ETRTVTQFHFLSW   ++P+S+RS+L+FRRKVNK YR +S P+++HC+DG GR+GTYIL+D++LN++ KG KE+D+AATLEHLRDQR  +V+T+EQF F LT ++EEVN ILK L Q
Sbjct:   23 HRLREKLSALGADVGSDAP----AAYQELCRQRMAVKTSDRPEPLPASRVNSV--SSQFSDGPIPSPSARSSTSSWCEEPVQSNMDISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNSTTMAQQEENIQKNRSQAVVPYDHSRICLKGENSHDNSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWENGCVVIVMLTPLAENGVKQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWNDQRVPASTRSLLDFRRKVNKCYRGRSCPVVVHCSDGAGRSGTYILIDMVLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKALPQ 393          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. TrEMBL
Match: A0A091NQ37 (Receptor-type tyrosine-protein phosphatase N2 (Fragment) OS=Apaloderma vittatum OX=57397 GN=N311_02183 PE=4 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 1.518e-123
Identity = 181/300 (60.33%), Postives = 226/300 (75.33%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLKNAK---NGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E  V +NMDI TGHMILSYME H KNK   + EW ++ +Y+ E      A + EN+ KNR +  IPYD SR+ LK      N DYINAS I+DHDP+ P YIATQ PL   V DFWQMVWE G VVIV LT L E+   +  HYWP EGS +++IYEVNLVSEHIW +++LVR+FYLKNL T ETRTVTQFHFLSW   ++P+S+RS+L+FRRKVNK YR +S P+++HC+DG GR+GTYIL+D++LN++ KG KE+D+AATLEHLRDQR  +V+T+EQF F LT ++EEVN ILK L Q
Sbjct:   49 EEPVQSNMDISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNATTVAQQEENMQKNRSRAVIPYDHSRICLKGENSHDNSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWENGCVVIVMLTPLTENGVKQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWNDQRVPASTRSLLDFRRKVNKCYRGRSCPVVVHCSDGAGRSGTYILIDMVLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKALPQ 348          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. TrEMBL
Match: R7VWM3 (Receptor-type tyrosine-protein phosphatase N2 (Fragment) OS=Columba livia OX=8932 GN=A306_07862 PE=4 SV=1)

HSP 1 Score: 386.726 bits (992), Expect = 2.490e-123
Identity = 180/300 (60.00%), Postives = 227/300 (75.67%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLKNAKN---GDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E  V +NMDI TGHMILSYME H KNK   + EW ++ +Y+ E      A++ EN+ KNR Q  +PYD SR+ LK   +    DYINAS I+DHDP+ P YIATQ PL   V DFWQMVWE G VVIV LT L E+   +  HYWP EGS +++IYEVNLVSEHIW +++LVR+FYLKNL T ETRTVTQFHFLSW   ++P+S+RS+L+FRRKVNK YR +S P+++HC+DG GR+GTYIL+D++LN++ KG KE+D+AATLEHLRDQR  +V+T+EQF F LT ++EEVN ILK L Q
Sbjct:  109 EEPVQSNMDISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNATNIALQEENMQKNRSQAVVPYDHSRICLKGENSHDSSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWENGCVVIVMLTPLAENGVKQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWNDQRVPASTRSLLDFRRKVNKCYRGRSCPVVVHCSDGAGRSGTYILIDMVLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKALPQ 408          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Cavefish
Match: ptprna (protein tyrosine phosphatase receptor type Na [Source:ZFIN;Acc:ZDB-GENE-030131-3511])

HSP 1 Score: 395.971 bits (1016), Expect = 3.597e-124
Identity = 179/300 (59.67%), Postives = 224/300 (74.67%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTEL---NESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E    +NMDI TGHMIL+YME H KNK+  Q EW ++ SY+ E + +  A    NL KNRY D +PYD SRV LK   N    DYINASII+DHDP++P YIATQ PL   + DFWQMVWE G  VIV +T L    E +   YWP EGS ++NIYEVNLVSEHIW  ++LVR+FYLKN+ T ETRT+TQFH LSWP   +P+S+R +L+FRRKVNK YR +S PII+HC++G GRTGTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  +V+T++QF F LT ++EEVN ILK L Q
Sbjct:  603 EEPAQSNMDISTGHMILAYMEDHLKNKDRLQKEWEALCSYQAEPSSVSIAQNERNLEKNRYPDFVPYDHSRVKLKPEVNPNREDYINASIIIDHDPRMPAYIATQGPLPHTIADFWQMVWENGCTVIVMMTALLEDGEQQCERYWPDEGSSLYNIYEVNLVSEHIWCKDFLVRSFYLKNVQTQETRTLTQFHLLSWPAQGIPTSTRPLLDFRRKVNKCYRGRSCPIIVHCSEGTGRTGTYILIDMVLNRMAKGVKEIDIAATLEHIRDQRQSMVRTKDQFEFALTAVAEEVNAILKALPQ 902          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Cavefish
Match: ptprnb (receptor-type tyrosine-protein phosphatase-like N [Source:NCBI gene;Acc:103043557])

HSP 1 Score: 388.652 bits (997), Expect = 3.509e-121
Identity = 176/300 (58.67%), Postives = 223/300 (74.33%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTEL---NESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E    +NMDI TGHMIL+YME H KNK+    EW ++ SY+ E + +  A    NL KNR  D +PYD SRV LK   N    DYINAS I++HDP++P YIATQ PL   + DFWQMVWE G  VIV +T L    E +   YWP EGS +++IYEVNLVSEHIW +++LVR+FYLKN+ T ETRT+TQFHFLSWP   +P+S+R +L+FRRKVNK YR +S PII+HC+DG GRTGTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  +V+T++QF F LT ++EEVN ILK L Q
Sbjct:  624 EEPAQSNMDISTGHMILAYMEDHVKNKDRLMKEWEALCSYQAEPSTVSVAQSESNLKKNRCPDAVPYDHSRVKLKAEINPSRTDYINASTIIEHDPRMPAYIATQGPLSHTISDFWQMVWENGCTVIVMMTALVEDGEKQCDRYWPDEGSSLYHIYEVNLVSEHIWCNDFLVRSFYLKNVQTQETRTLTQFHFLSWPAQGIPTSTRPLLDFRRKVNKCYRGRSCPIIVHCSDGTGRTGTYILIDMVLNRMAKGVKEIDIAATLEHIRDQRPGMVRTKDQFEFALTAVAEEVNAILKALPQ 923          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Cavefish
Match: ptprna (protein tyrosine phosphatase receptor type Na [Source:ZFIN;Acc:ZDB-GENE-030131-3511])

HSP 1 Score: 357.066 bits (915), Expect = 2.465e-113
Identity = 171/300 (57.00%), Postives = 213/300 (71.00%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTEL---NESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E    +NMDI TGHMIL+YME H KNK+  Q EW ++ SY+ E + +  A    NL KNRY D +PYD SRV LK   N    DYINASII+DHDP++P YIATQ PL   + DFWQMVWE G  VIV +T L    E +   YWP EGS ++NIYEVNLVSEHIW  ++LVR+FYLKN+ T ETRT+TQFH LSWP   +P+S+R +L+FRR       +  T IIIH     GRTGTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  +V+T++QF F LT ++EEVN ILK L Q
Sbjct:  261 EEPAQSNMDISTGHMILAYMEDHLKNKDRLQKEWEALCSYQAEPSSVSIAQNERNLEKNRYPDFVPYDHSRVKLKPEVNPNREDYINASIIIDHDPRMPAYIATQGPLPHTIADFWQMVWENGCTVIVMMTALLEDGEQQCERYWPDEGSSLYNIYEVNLVSEHIWCKDFLVRSFYLKNVQTQETRTLTQFHLLSWPAQGIPTSTRPLLDFRRY------TIHTLIIIHSR--TGRTGTYILIDMVLNRMAKGVKEIDIAATLEHIRDQRQSMVRTKDQFEFALTAVAEEVNAILKALPQ 552          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Cavefish
Match: ptprna (protein tyrosine phosphatase receptor type Na [Source:ZFIN;Acc:ZDB-GENE-030131-3511])

HSP 1 Score: 365.54 bits (937), Expect = 8.787e-113
Identity = 176/301 (58.47%), Postives = 220/301 (73.09%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTEL---NESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKT-EEQFGFVLTTISEEVNNILKILNQ 2234
            E    +NMDI TGHMIL+YME H KNK+  Q EW ++ SY+ E + +  A    NL KNRY D +P D SRV LK   N    DYINASII+DHDP++P YIATQ PL   + DFWQMVWE G  VIV +T L    E +   YWP EGS ++NIYEVNLVSEHIW  ++LVR+FYLKN+ T ETRT+TQFH LSWP   +P+S+R +L+F RKVNK YR +S PII+HC +G GRTGTYIL+D++LNR+ K +KE+D+AATLEH+RDQR  +V+T ++QF F LT ++EEVN ILK L Q
Sbjct:  602 EEPAQSNMDISTGHMILAYMEDHLKNKDRLQKEWEALCSYQAEPSSVSIAQNERNLEKNRYPDFVP-DHSRVKLKPEVNPNREDYINASIIIDHDPRMPAYIATQGPLPHTIADFWQMVWENGCTVIVMMTALLEDGEQQCERYWPDEGSSLYNIYEVNLVSEHIWCKDFLVRSFYLKNVQTQETRTLTQFHLLSWPAQGIPTSTRPLLDF-RKVNKCYRGRSCPIIVHC-EGTGRTGTYILIDMVLNRMAK-VKEIDIAATLEHIRDQRQSMVRTKQDQFEFALTAVAEEVNAILKALPQ 898          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Cavefish
Match: ptprnb (receptor-type tyrosine-protein phosphatase-like N [Source:NCBI gene;Acc:103043557])

HSP 1 Score: 358.607 bits (919), Expect = 5.772e-110
Identity = 162/277 (58.48%), Postives = 206/277 (74.37%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTEL---NESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTE 2165
            E    +NMDI TGHMIL+YME H KNK+    EW ++ SY+ E + +  A    NL KNR  D +PYD SRV LK   N    DYINAS I++HDP++P YIATQ PL   + DFWQMVWE G  VIV +T L    E +   YWP EGS +++IYEVNLVSEHIW +++LVR+FYLKN+ T ETRT+TQFHFLSWP   +P+S+R +L+FRRKVNK YR +S PII+HC+DG GRTGTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  +V+T+
Sbjct:  595 EEPAQSNMDISTGHMILAYMEDHVKNKDRLMKEWEALCSYQAEPSTVSVAQSESNLKKNRCPDAVPYDHSRVKLKAEINPSRTDYINASTIIEHDPRMPAYIATQGPLSHTISDFWQMVWENGCTVIVMMTALVEDGEKQCDRYWPDEGSSLYHIYEVNLVSEHIWCNDFLVRSFYLKNVQTQETRTLTQFHFLSWPAQGIPTSTRPLLDFRRKVNKCYRGRSCPIIVHCSDGTGRTGTYILIDMVLNRMAKGVKEIDIAATLEHIRDQRPGMVRTK 871          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002532.1 (pep scaffold:Pmarinus_7.0:GL478137:167104:182177:1 gene:ENSPMAG00000002308.1 transcript:ENSPMAT00000002532.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 231.106 bits (588), Expect = 7.353e-71
Identity = 112/210 (53.33%), Postives = 148/210 (70.48%), Query Frame = 3
Query: 1617 VDHDPKLPVYIATQAPLEKWVGDFWQ-MVWEQGVVVIVNLTELNESESAH---YWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGL--KEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKIL 2228
            +DHDP+ PVYIA QAPL   V DFWQ MVWE G  V+V LT L E+   H   YWP+EGS+ ++IYEVNLVSEH+W +++LVR+ YLKN  T ETRT+TQFH+LSWP    PSS+ S+L+FRR+   S +    P  I C +   R  TY+ +   L++  + L  KE+D+AATLE +RDQR+ +V+T+EQFGF LT ++EEVN IL+ L
Sbjct:    5 MDHDPRTPVYIAAQAPLANTVVDFWQQMVWESGCTVVVMLTPLMENRVEHCYRYWPEEGSRTYHIYEVNLVSEHVWCEDFLVRSLYLKNALTAETRTLTQFHYLSWPDQAAPSSAASLLDFRRQEPPSLQQPECPTPISCQNVYTRPCTYLYICSALSKFTRSLSTKEIDIAATLEFIRDQRLGMVETKEQFGFALTAVAEEVNAILRSL 214          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002534.1 (pep scaffold:Pmarinus_7.0:GL478137:167116:182177:1 gene:ENSPMAG00000002308.1 transcript:ENSPMAT00000002534.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 228.794 bits (582), Expect = 4.826e-70
Identity = 113/213 (53.05%), Postives = 147/213 (69.01%), Query Frame = 3
Query: 1617 VDHDPKLPVYIATQAPLEKWVGDFWQ-MVWEQGVVVIVNLTELNESESAH---YWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTY-----ILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKIL 2228
            +DHDP+ PVYIA QAPL   V DFWQ MVWE G  V+V LT L E+   H   YWP+EGS+ ++IYEVNLVSEH+W +++LVR+ YLKN  T ETRT+TQFH+LSWP    PSS+ S+L+FRR+   SY    TP  +H    CG    +     +++D    R C   KE+D+AATLE +RDQR+ +V+T+EQFGF LT ++EEVN IL+ L
Sbjct:    1 MDHDPRTPVYIAAQAPLANTVVDFWQQMVWESGCTVVVMLTPLMENRVEHCYRYWPEEGSRTYHIYEVNLVSEHVWCEDFLVRSLYLKNALTAETRTLTQFHYLSWPDQAAPSSAASLLDFRRQEPPSYTRPCTPRRVHARQ-CGAASRFYTVYSLVVDTAYKRPCT--KEIDIAATLEFIRDQRLGMVETKEQFGFALTAVAEEVNAILRSL 210          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008162.1 (pep scaffold:Pmarinus_7.0:GL477877:143952:159832:-1 gene:ENSPMAG00000007379.1 transcript:ENSPMAT00000008162.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 159.458 bits (402), Expect = 7.089e-43
Identity = 93/256 (36.33%), Postives = 148/256 (57.81%), Query Frame = 3
Query: 1434 EIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSL---KNAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQG---VVVIVNLTELNESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTT----ETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQ 2171
            ++F+ E+N + S E      EAA + EN  KNRY + +PYD+SRV L   ++    DYINAS I  +  K   +IA Q P E+ + DFW+M+WEQ    +V++ NL E   ++ + YWP +G   +    V++    +  D Y +R F ++ +       + R VTQFHF SWP   +P +   +L+F +KV  S  S S PI++HC+ G GRTGT+I++D +L+ I +  + +D+   +  +R QR  +V+T+ Q
Sbjct:   33 KLFRDEFNGLPS-EHPQLMCEAASQEENKDKNRYINILPYDQSRVQLSPIESVPGSDYINASYINGYREK-NKFIAAQGPKEETINDFWRMIWEQNTSTIVMVTNLQERKHTKCSQYWPDKGCWTYGSVRVSVEDITVLVD-YTIRKFCVQLVGEGPGKHQARLVTQFHFTSWPDFGVPFTPIGMLKFLKKVKTSNPSYSGPIVVHCSAGVGRTGTFIVIDAMLDMI-QAEQRVDVFGFVSRIRAQRCQMVQTDLQ 284          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Sea Lamprey
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:ZFIN;Acc:ZDB-GENE-030131-9834])

HSP 1 Score: 161.77 bits (408), Expect = 5.207e-41
Identity = 88/254 (34.65%), Postives = 146/254 (57.48%), Query Frame = 3
Query: 1440 FQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQ---GVVVIVNLTELNESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFV 2183
            F+ E+ S   +E + A  + A + EN  KNRY + I YD SRV L      +N DYINA+  VD   +   YIATQ PL   VG FW+M+W++    ++++ NL E+   +   YWP +GS ++   +V L    + S EY++R F ++     + R V QFHF  WP   +P  +  +L F R++       + P+++HC+ G GRTG Y+++D++L+ + +    +D+   +  LR +R+++V+TEEQ+ F+
Sbjct:  918 FKEEYESF--FEGQSAPWDVAKRDENRAKNRYGNIIAYDHSRVMLNVLDEEQNSDYINANY-VDGYYRTHHYIATQGPLPDTVGGFWRMIWQERSASIIMVTNLVEVGRIKCCKYWP-DGSDVYGDIKVTLADTEMLS-EYIIRTFRVERAGQEDIREVRQFHFTGWPDHGVPYHATGLLAFIRRIKALDPPHAGPLVVHCSAGAGRTGCYMVIDIMLD-MAESEGVIDIYNCVRELRTRRVNMVQTEEQYVFI 1165          

HSP 2 Score: 83.5741 bits (205), Expect = 1.407e-16
Identity = 60/185 (32.43%), Postives = 92/185 (49.73%), Query Frame = 3
Query: 1431 KEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK--NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNESE-SAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTE--TRTVTQFHFLSWPVDK-LPSSSRSILEF 1967
            K+ FQ+          ED  I  A+   N  KNRY D +P D+    L   N  + +YINA+++ D   +   +I TQ PL   V DFW++V++     IV L EL+ ++    YWP+EG       +V  V+ ++  D  + R F + N+   +   R V QFH+L WP  + +P+S  S L  
Sbjct: 1205 KDEFQTLNMVTPPLRVEDCSI--ALLPRNHEKNRYHDVLPPDRCLPFLITINGDSSNYINAALM-DSYRQPSAFIVTQHPLPNTVKDFWRLVFDYHCTSIVMLNELDSNKYCPQYWPEEGMLCHGPIQVEFVAFNMEGD-IITRTFRICNVARPQDGCRMVEQFHYLGWPAGREVPTSRHSFLRL 1385          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Sea Lamprey
Match: ptpra (protein tyrosine phosphatase receptor type A [Source:ZFIN;Acc:ZDB-GENE-020107-1])

HSP 1 Score: 158.303 bits (399), Expect = 1.979e-40
Identity = 93/270 (34.44%), Postives = 153/270 (56.67%), Query Frame = 3
Query: 1428 NKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRV---SLKNAKNGDYINASIIVDHDPKLPVYIATQA--PLEKWVGDFWQMVWE---QGVVVIVNLTELNESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNL----NTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISE 2201
            + ++F+ E+NS+ S   + A  EAA K EN  KNRY + +PYD  RV   SL+   + DYINAS +  +  K   +IA Q   P E+ + D+W+M+WE     +V++ NL E  E + A YWP +G   +    V++    +  D Y +R F ++ +    N    R +TQFHF SWP   +P +   +L+F +KV       + PI++HC+ G GRTGT+I++D +L+ I +  +++D+   +  +R QR  +V+T+ Q+ F+   + E
Sbjct:  183 DNKLFREEFNSLPSCPIQ-ATCEAASKEENKEKNRYVNILPYDNFRVHLTSLEGVPDSDYINASYVNGYQEKNK-FIAAQGKGPKEETLNDYWRMIWELNTATIVMVTNLKERKECKCAQYWPDQGCWTYGNLRVSVEDVTVLVD-YTIRKFLIQVVGDIPNKKPPRLITQFHFTSWPDFGVPFAPIGMLKFLKKVKTCNPPYAGPIVVHCSAGVGRTGTFIVIDAMLDMI-QTERKVDVFGFVTRIRAQRCQMVQTDMQYVFIYQALLE 448          

HSP 2 Score: 150.214 bits (378), Expect = 7.629e-38
Identity = 90/263 (34.22%), Postives = 139/263 (52.85%), Query Frame = 3
Query: 1440 FQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSL---KNAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNE---SESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYR-SKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEV 2207
             + E+  + + + ++ K+       N+ KNR    IPYD +RV +   +  +  DYIN S I  +  K   ++A Q PL++ V DFW+MVWE     IV LTEL E    + A YWP EG+  +    + L  E+   D Y VR+F + N    ++R + QFHF  WP   +P   + ++     V K  + + + PI +HC+ G GRTGT+  L  IL R+ K    +D+  T++ LR QR H+V+T EQ+ F    + E +
Sbjct:  481 LEDEFKKLTTVKIQNEKMRTGNLPANMKKNRVLQIIPYDFNRVIIPMKRGEEFTDYINGSFIDGYRQK-DAFLAGQGPLQQTVEDFWRMVWEWRSCSIVMLTELEERGQEKCARYWPTEGTITYGDIIIELKQENS-HDSYTVRDFSVSNTRENKSRQIRQFHFHGWPEIGIPEDGKGMISLIAAVQKQQQHTGNHPITVHCSAGAGRTGTFCALCTILERV-KTEGILDVFQTVKSLRTQRPHMVQTLEQYEFCYKVVQEYI 740          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Yeast
Match: PTP1 (Phosphotyrosine-specific protein phosphatase; dephosphorylates a broad range of substrates in vivo, including Fpr3p; localized to the cytoplasm and the mitochondria; proposed to be a negative regulator of filamentation [Source:SGD;Acc:S000002389])

HSP 1 Score: 108.612 bits (270), Expect = 3.885e-26
Identity = 81/279 (29.03%), Postives = 125/279 (44.80%), Query Frame = 3
Query: 1491 IEAAIKIENLPKNRYQDKIPYDKSRVSLKNAKNGDYINASIIVDHDPKLPV----YIATQAPLEKWVGDFWQMVWEQG------VVVIVNLTELNESESAHYWPKEG--------------------SQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLN--TTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILN------RICKGLKEMDLAA----------TLEHLRDQRMHLVKTEEQFGFV 2183
            +  +I+  N  +NRY + +PY+++RV LK     DYINAS +  + P   +    YIATQ P  K    FWQM +         +V++  L E N  +   YWP+ G                    +Q  +  ++  V+ H   D Y V +  L   +      +TV  F+F  W     P     I+E     + S  S+  PII+HC+ G GRTGT+I LD +++       I +  +  D A            +  LR QRM +V+T++QF F+
Sbjct:   44 LGVSIEPRNDARNRYVNIMPYERNRVHLKTLSGNDYINASYVKVNVPGQSIEPGYYIATQGPTRKTWDQFWQMCYHNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEEVVPIMELCAH-SHSLNSRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLFI 321          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Yeast
Match: PTP2 (Nuclear phosphotyrosine-specific phosphatase involved in osmosensing; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; with Msg5p co-regulates the calcium signaling pathway [Source:SGD;Acc:S000005734])

HSP 1 Score: 48.1358 bits (113), Expect = 5.028e-6
Identity = 41/126 (32.54%), Postives = 58/126 (46.03%), Query Frame = 3
Query: 1509 IENLPKNRYQDKIPYDKSRVSLK---------------------------NAKN-----GDYINASII----VDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLT---ELNESESAHYW 1769
            I++  KNRY + +PY+ SRV L                            +AKN      DYINA+ +    ++ D K   YIATQAPL   + DFW+++    V VI++L    ELN  +   YW
Sbjct:  406 IQSFTKNRYSNILPYEHSRVKLPHSPKPPAVSEASTTETKTDKSYPMCPVDAKNHSCKPNDYINANYLKLTQINPDFK---YIATQAPLPSTMDDFWKVITLNKVKVIISLNSDDELNLRKWDIYW 528          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Nematostella
Match: EDO48949 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI09])

HSP 1 Score: 375.941 bits (964), Expect = 1.206e-124
Identity = 175/298 (58.72%), Postives = 224/298 (75.17%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNE---SESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKIL 2228
            E  V  NMDI TGH++LSYME H  NK     EW ++ +YE E +  +   + +N+ KNRY D +PYD +RVSL+   NA   DYINAS I DHDP+ P YIATQ PL   V DFWQMVWEQGVVVIVNLT L++    +   YWP++G + ++IYEV+LVSEHIW D+YLVR+FYLKNL T+ETRTVTQFHFLSWP   +P++ + +LEFRRKVNK +R +S PI++HC+ G GRTG YIL+DL+LN++ +G KE+D+AAT+EHLRDQR H+VKT+ QF F LT ++EEVN IL+ L
Sbjct:    2 EEPVVPNMDISTGHVVLSYMEDHLSNKNRLNKEWEALCNYEAEPSVADLGKQDKNVRKNRYSDVLPYDHNRVSLRETANATGSDYINASFITDHDPRNPAYIATQGPLAHTVSDFWQMVWEQGVVVIVNLTRLSDLGLPQCHRYWPEDGHETYHIYEVHLVSEHIWCDDYLVRSFYLKNLQTSETRTVTQFHFLSWPDLNVPTTPKPLLEFRRKVNKCFRGRSCPIVVHCSGGVGRTGCYILIDLVLNKMMRGAKEIDIAATVEHLRDQRPHMVKTKAQFEFALTAVAEEVNAILQAL 299          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Nematostella
Match: EDO30982 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ92])

HSP 1 Score: 167.548 bits (423), Expect = 4.391e-47
Identity = 93/242 (38.43%), Postives = 138/242 (57.02%), Query Frame = 3
Query: 1494 EAAIKIENLPKNRYQDKIPYDKSRVSLKNAKN---GDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISE 2201
            EAA K  N  KNRY + + YD SRV L+   N    DYINAS + D+D     YIATQ  +E   GDFW+M+W++   VIV LT L E    +   YWP   S+  N+  V L    +++D Y++R F +  +  TE R V Q+HF  WP   +P  + ++L  RRK+ K     + P +IHC+ G GRTG ++++D +L R  K  K +D+   ++ +R+ R H+V+T EQ+ F+   + E
Sbjct:    3 EAAKKRVNKAKNRYANIVTYDHSRVVLEKLSNDPHSDYINASYLRDYDGSPKAYIATQGCVEPSSGDFWRMMWQERRCVIVMLTGLIEGHKKKCHQYWPDSTSKYCNL-RVTLRKTEVFAD-YIIRTFVMSQVGQTEERYVYQYHFTVWPDKGVPQYATAVLGLRRKITKDSLPGARPWVIHCSAGVGRTGAFLVIDAML-RQAKKQKTVDIFNYVKAIREDRPHMVQTSEQYVFIHLAVLE 241          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Nematostella
Match: EDO29624 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ92])

HSP 1 Score: 167.548 bits (423), Expect = 4.391e-47
Identity = 93/242 (38.43%), Postives = 138/242 (57.02%), Query Frame = 3
Query: 1494 EAAIKIENLPKNRYQDKIPYDKSRVSLKNAKN---GDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISE 2201
            EAA K  N  KNRY + + YD SRV L+   N    DYINAS + D+D     YIATQ  +E   GDFW+M+W++   VIV LT L E    +   YWP   S+  N+  V L    +++D Y++R F +  +  TE R V Q+HF  WP   +P  + ++L  RRK+ K     + P +IHC+ G GRTG ++++D +L R  K  K +D+   ++ +R+ R H+V+T EQ+ F+   + E
Sbjct:    3 EAAKKRVNKAKNRYANIVTYDHSRVVLEKLSNDPHSDYINASYLRDYDGSPKAYIATQGCVEPSSGDFWRMMWQERRCVIVMLTGLIEGHKKKCHQYWPDSTSKYCNL-RVTLRKTEVFAD-YIIRTFVMSQVGQTEERYVYQYHFTVWPDKGVPQYATAVLGLRRKITKDSLPGARPWVIHCSAGVGRTGAFLVIDAML-RQAKKQKTVDIFNYVKAIREDRPHMVQTSEQYVFIHLAVLE 241          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Nematostella
Match: EDO30980 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ90])

HSP 1 Score: 164.081 bits (414), Expect = 7.055e-46
Identity = 92/242 (38.02%), Postives = 137/242 (56.61%), Query Frame = 3
Query: 1494 EAAIKIENLPKNRYQDKIPYDKSRVSLKNAKN---GDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISE 2201
            EAA K  N  KNRY + + YD SRV L+   N    DYINAS + D+D     YIATQ  +    GDFW+M+W++   VIV LT L E    +   YWP   S+  N+  V L    +++D Y++R F +  +  TE R V Q+HF  WP   +P  + ++L  RRK+ K     + P +IHC+ G GRTG ++++D +L R  K  K +D+   ++ +R+ R H+V+T EQ+ F+   + E
Sbjct:    3 EAAKKRVNKAKNRYANIVTYDHSRVVLEKLSNDPHSDYINASYLRDYDGSPKAYIATQGNICINAGDFWRMMWQERRCVIVMLTGLIEGHKKKCHQYWPDSTSKYCNL-RVTLRKTEVFAD-YIIRTFVMSQVGQTEERYVYQYHFTVWPDKGVPQYATAVLGLRRKITKDSLPGARPWVIHCSAGVGRTGAFLVIDAML-RQAKKQKTVDIFNYVKAIREDRPHMVQTSEQYVFIHLAVLE 241          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Nematostella
Match: EDO31736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX30])

HSP 1 Score: 169.474 bits (428), Expect = 1.185e-44
Identity = 93/244 (38.11%), Postives = 140/244 (57.38%), Query Frame = 3
Query: 1494 EAAIKIENLPKNRYQDKIPYDKSRVSLKNA---KNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQ---GVVVIVNLTELNESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEV 2207
            EAA K  N  KNRY + + YD SRV L+     ++ DYINAS I  +D     +IA+Q PL     DFW+MVWEQ    +V++ NL EL +++   YWP + ++ +    V L    I++ EY +R F L     + +R V QFHF  WP   +P  + ++L FRRKV       + P+I+HC+ G GRTG YI++D +L +  K  + +D+   L  LR  R H+V+T+EQ+ F+ + + E +
Sbjct:   38 EAARKPANKNKNRYANIVAYDHSRVVLERVNGDEDSDYINASFIHGYDGTPRSFIASQGPLPPAFEDFWRMVWEQNSQSIVMLTNLVELGKTKCHKYWP-DKTETYGGVTVTLHQSEIFA-EYEIRTFILSKAKQSGSRMVRQFHFTVWPDKGVPQYATAVLAFRRKVRALNPRDAGPVIVHCSAGVGRTGAYIVIDAMLEQ-AKKSRTVDIRNYLIALRKDRPHMVQTKEQYSFIHSAVLEAL 278          

HSP 2 Score: 108.227 bits (269), Expect = 1.947e-24
Identity = 73/247 (29.55%), Postives = 124/247 (50.20%), Query Frame = 3
Query: 1494 EAAIKIENLPKNRYQDKIPYDKSRVSLKNA---KNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNE--SESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKS-YRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNI 2216
            EAA K  N  KNRY + + YD SR+ L+     ++ DYINAS I  H  +   +IATQ PL + V DFW+MV +  +  IV L  L+E   E   YWP  G   +    V+++S+    D  +     +       T  V   H +SWP   +P  + S+L+   +   S  +  + P+++ C++G GR+GT+  +  +L R+ K  + +D+   ++ +R      V++  Q+ F    I + +++ 
Sbjct:  325 EAARKPANKNKNRYANIVAYDHSRLVLERVNGNEDSDYINASFIHAHRGR-NAFIATQHPLLETVEDFWRMVTDYDIGTIVMLNNLHELDQEYPKYWPDHGPTKYGHIGVSVLSKQEQGD-VICTKLKVTRKKVRRTHEVRHLHHVSWPDKCIPEVACSVLDLLDEAQTSQQQCGNAPVLVQCSNGVGRSGTFCAISSVLERL-KTEQVIDVFQVIKRIRVNLPGAVESPTQYMFCYQIIQKYLDSF 568          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Medaka
Match: ptprna (receptor-type tyrosine-protein phosphatase-like N [Source:NCBI gene;Acc:101166592])

HSP 1 Score: 378.637 bits (971), Expect = 7.055e-122
Identity = 174/300 (58.00%), Postives = 220/300 (73.33%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTEL---NESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E    +NMDI TGHMIL+YME H +NK+  Q EW ++ SY+ E   +  A  + N+ KNR+   +PYD SRV LK   N    DYINAS I DHDP+ P YIATQ PL   V DFWQMVWE G  VIV +T L    E +   YWP EGS +++IYEVNLVSEHIW  ++LVR+FYLKN+ T ETRT+TQFH LSWP D +P+S+R +L+FRRKVNK Y+ +S PII+HC+DG  R+GTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  LV+T++QF F LT ++EEVN ILK L Q
Sbjct:  237 EEPAQSNMDISTGHMILAYMEDHLRNKDRLQKEWEALCSYQAEPCSVAVAQTLNNIEKNRHAVALPYDHSRVKLKTEVNPNKQDYINASFIFDHDPRQPSYIATQGPLAHTVADFWQMVWENGCTVIVMMTALVEDGEKQCERYWPDEGSSLYHIYEVNLVSEHIWCKDFLVRSFYLKNVQTQETRTLTQFHLLSWPGDGIPTSTRPLLDFRRKVNKCYKGRSCPIIVHCSDGTSRSGTYILIDMVLNRMAKGVKEIDIAATLEHIRDQRPGLVRTKDQFEFALTAVAEEVNAILKALPQ 536          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Medaka
Match: ENSORLT00000002122.2 (receptor-type tyrosine-protein phosphatase-like N [Source:NCBI gene;Acc:101170654])

HSP 1 Score: 386.726 bits (992), Expect = 7.757e-121
Identity = 174/300 (58.00%), Postives = 221/300 (73.67%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTEL---NESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E     NMDI TGHMIL+YME H +NK+    EW ++ SY+ E + +  A    N  KNR  D +PYD SRV LK   N    DYINAS I++HDP++P YIATQ PL   + DFWQMVWE G  VIV +T L    E +   YWP EGS +++IYEVNLVSEHIW +++LVR+FYLKN+ T ETRT+TQFHFLSWP   +P+S+R +L+FRRKVNK YR +S PII+HC+DG GRTGTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  +V+T++QF F LT ++EEVN ILK L Q
Sbjct:  589 EEPAQANMDISTGHMILAYMEDHLRNKDRLMKEWEALCSYQAEPSTVSVAQSEANAKKNRIPDSVPYDHSRVKLKAEINPSRSDYINASTIIEHDPRMPAYIATQGPLSHTISDFWQMVWENGCTVIVMMTALVEDGEKQCDRYWPDEGSSLYHIYEVNLVSEHIWCNDFLVRSFYLKNVQTQETRTLTQFHFLSWPAQGIPTSTRPLLDFRRKVNKCYRGRSCPIIVHCSDGTGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGMVRTKDQFEFALTAVAEEVNAILKALPQ 888          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Medaka
Match: ptprna (receptor-type tyrosine-protein phosphatase-like N [Source:NCBI gene;Acc:101166592])

HSP 1 Score: 380.563 bits (976), Expect = 3.745e-118
Identity = 174/300 (58.00%), Postives = 220/300 (73.33%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTEL---NESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E    +NMDI TGHMIL+YME H +NK+  Q EW ++ SY+ E   +  A  + N+ KNR+   +PYD SRV LK   N    DYINAS I DHDP+ P YIATQ PL   V DFWQMVWE G  VIV +T L    E +   YWP EGS +++IYEVNLVSEHIW  ++LVR+FYLKN+ T ETRT+TQFH LSWP D +P+S+R +L+FRRKVNK Y+ +S PII+HC+DG  R+GTYIL+D++LNR+ KG+KE+D+AATLEH+RDQR  LV+T++QF F LT ++EEVN ILK L Q
Sbjct:  633 EEPAQSNMDISTGHMILAYMEDHLRNKDRLQKEWEALCSYQAEPCSVAVAQTLNNIEKNRHAVALPYDHSRVKLKTEVNPNKQDYINASFIFDHDPRQPSYIATQGPLAHTVADFWQMVWENGCTVIVMMTALVEDGEKQCERYWPDEGSSLYHIYEVNLVSEHIWCKDFLVRSFYLKNVQTQETRTLTQFHLLSWPGDGIPTSTRPLLDFRRKVNKCYKGRSCPIIVHCSDGTSRSGTYILIDMVLNRMAKGVKEIDIAATLEHIRDQRPGLVRTKDQFEFALTAVAEEVNAILKALPQ 932          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Medaka
Match: ENSORLT00000035149.1 (receptor-type tyrosine-protein phosphatase N2 [Source:NCBI gene;Acc:101175682])

HSP 1 Score: 380.948 bits (977), Expect = 6.617e-118
Identity = 176/295 (59.66%), Postives = 224/295 (75.93%), Query Frame = 3
Query: 1368 TNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            +NMDI TGHMILSYME H KNK+  + EW ++ +Y+ E +     +K  N  KNR    I YD SR++L+   +  N DYINAS I+DHDP+ P YIATQ PL   V DFWQMVWE G VVIV LT L E+   +  HYWP EGS +++IYEVNLVSEHIW D++LVR+FYLKN+ T ETRTVTQFHFL+W    +P +SR++L+FRRKVNK YR +S PII+HC+DG GR+GTYIL+D++LN++ KG KE+D+AATLEHLRDQR  +V+T++QF F LTT++EEVN ILK+L Q
Sbjct:  673 SNMDISTGHMILSYMEDHLKNKDRLEKEWEALCAYQAEPSARTIGLKDGNAKKNRSAAVIAYDHSRITLRVENSQGNSDYINASPIMDHDPRNPSYIATQGPLPSTVADFWQMVWENGCVVIVMLTPLVENGVKQCYHYWPDEGSNLYHIYEVNLVSEHIWCDDFLVRSFYLKNMQTNETRTVTQFHFLTWLNQNVPETSRTLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYILIDMVLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKDQFEFALTTVAEEVNAILKVLPQ 967          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Medaka
Match: ptprn2 (protein tyrosine phosphatase receptor type N2 [Source:NCBI gene;Acc:101159780])

HSP 1 Score: 382.104 bits (980), Expect = 1.820e-117
Identity = 178/300 (59.33%), Postives = 222/300 (74.00%), Query Frame = 3
Query: 1353 EMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            E  V +NMDI TGHMILSYME H KNK   + EW ++ SY+ E +        +N  +NR    + YD SR++LK   N  N DYINAS I+DHDP+ P YIA Q PL   V DFWQMVWE G VVIV LT L+E+   +  HYWP EGS +++IYEVNLVSEHIW +++LVR+FYLKNL T ETRTVTQFHFLSW    +P+S+R++L+FRRKVNK YR +S PII+HC+DG GR+GTYIL+D++LNR+ KG KE+D+AATLEHLRDQR  +V+ +EQF F LT ++EEVN ILK L Q
Sbjct:  766 EEPVPSNMDISTGHMILSYMEDHLKNKNRLEREWEALCSYQAEPSACSVGQGEQNSKRNRSDGVVAYDHSRITLKAENNHGNSDYINASPIMDHDPRNPTYIAAQGPLASTVADFWQMVWESGCVVIVMLTPLSENGVKQCHHYWPDEGSDVYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWMDRGIPTSARTLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYILIDMVLNRMAKGAKEIDIAATLEHLRDQRAGMVQIKEQFEFALTAVAEEVNAILKALPQ 1065          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Planmine SMEST
Match: SMESG000078547.1 (SMESG000078547.1)

HSP 1 Score: 1412.13 bits (3654), Expect = 0.000e+0
Identity = 726/729 (99.59%), Postives = 727/729 (99.73%), Query Frame = 3
Query:   48 MAAKILLFILPFSVLTVDFQNPESNSVKVDEIVLSNIYNGKLIGCKYQNLCPINRVCYNDKLFGTCVSQSDNANFIYELVTEFQNILELAMRDLFEENFKWSDFYTQCFLQSVLMSSEFQQFLDIQHCKPTIDPLLVFDPENLQLDQSQQKEDSEIEIPRVYTRKQKSQGSEAFYNKIRSMLHEIQDKKRIDSHYENREMINPKSNSEEAKSVTKVNYADPKLIRKVLKVAKRRSNDWVWLKFNKKVSISDQPKILNSVINSMPNSVNIVKYEWRSDPSIFNFKLHPDSVFHSENVTNFFNNHKGIIPGYTILDTGTGRLQSPIRQEEIRSDQNFLITXXXXXXXXXXXXXXXXXXCIQKFRYKRDKLGDILKSKFPDNSSSSYKELFRGSNNKDTTIIKNKQGVARMNSKQHSGDXXXXXXXXXXXXXXXXXXDEMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLKNAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 2234
            MAAKILLFILPFSVLTVDFQNPESNSVKVDEIVLSNIYNGKLIGCKYQNLCPINRVCYNDKLFGTCVSQSDNANFIYELVTEFQNILELAMRDLFEENFKWSDFYTQCFLQSVLMSSEFQQFLDIQHCKPTIDPLLV DPENLQLDQSQQKEDSEIEIPRVYTRKQKSQGSEAFYNKIRSMLHEIQDKKRIDSHYENREMINPKSNSEEAKSVTKVNYADPKLIRKVLKVAKRRSNDWVWLKFNKKVSISDQPKILNSVINSMPNSVNIVKYEWRSDPSIFNFKLHPDSVFHSENVTNFFNNHKGIIPGYTILDTGTGRLQ PIRQEEIRSDQNFLITLVICCVVFLGVILVLIGFCIQKFRYKRDKLGDILKSKFPDNSSSSYKELFRGSNNKDTTIIKNKQGVARMNSKQHSGDTPAASSPVSTRSSTSSWTDEMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRV+LKNAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ
Sbjct:    1 MAAKILLFILPFSVLTVDFQNPESNSVKVDEIVLSNIYNGKLIGCKYQNLCPINRVCYNDKLFGTCVSQSDNANFIYELVTEFQNILELAMRDLFEENFKWSDFYTQCFLQSVLMSSEFQQFLDIQHCKPTIDPLLVVDPENLQLDQSQQKEDSEIEIPRVYTRKQKSQGSEAFYNKIRSMLHEIQDKKRIDSHYENREMINPKSNSEEAKSVTKVNYADPKLIRKVLKVAKRRSNDWVWLKFNKKVSISDQPKILNSVINSMPNSVNIVKYEWRSDPSIFNFKLHPDSVFHSENVTNFFNNHKGIIPGYTILDTGTGRLQFPIRQEEIRSDQNFLITLVICCVVFLGVILVLIGFCIQKFRYKRDKLGDILKSKFPDNSSSSYKELFRGSNNKDTTIIKNKQGVARMNSKQHSGDTPAASSPVSTRSSTSSWTDEMQVATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVALKNAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTISEEVNNILKILNQ 729          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Planmine SMEST
Match: SMESG000041505.1 (SMESG000041505.1)

HSP 1 Score: 159.073 bits (401), Expect = 1.480e-39
Identity = 101/259 (39.00%), Postives = 143/259 (55.21%), Query Frame = 3
Query: 1440 FQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLKNAKNG--DYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQG---VVVIVNLTELNESESAHYWPKEGSQIFNIYEVNLVSEHIWSDE---YLVRNFYLKNL---NTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFV 2183
            FQ+E+ +I S +T    I AAI+ EN  KNRY +  PYD SRV +++   G  DYINAS I D   +   YIATQ PL + V DFWQMVWEQ    +V+I N  E   S+   YW    ++  N    N+    I+  E   Y  R F ++N+      + RTV  + +  W    +P SS  +L F R   K +   S PII+HC+ G GRTGTYI ++  + ++ +    +++   LEH+R QRM LV+TE Q+ F+
Sbjct:  655 FQAEFEAIESMDTTKWVISAAIQKENKSKNRYTNIFPYDHSRVIIQSPPFGKSDYINASFI-DGFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYW--SPNKTLNC--GNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDVPPSSLPVLVFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQE-HHINVRGFLEHIRQQRMKLVQTESQYTFI 907          

HSP 2 Score: 58.9214 bits (141), Expect = 1.739e-8
Identity = 55/223 (24.66%), Postives = 104/223 (46.64%), Query Frame = 3
Query: 1440 FQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNESESAHYWPKE--GSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLS-WPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICK 2090
              +++   +++E  D     + K  NL KNR    +P +  R++L      +  +YINAS I  +  ++  +I TQ PL++   DFW+MVW++   +I+ L+  N  +   +WP     +  F  ++V+  SE     E+ V+  +L + +  +       H L  WP     S    +L     +N   +  S PI++    G  R G ++ +  +L+++ K
Sbjct:  945 LDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYW-QMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNENMHQ---FWPGPDNNALTFRWFKVHCNSE---KTEFSVQYSFLISSSREDYALDCTMHCLKYWP--NTVSECSELLRLLFDINS--KKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRK 1156          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Planmine SMEST
Match: SMESG000041505.1 (SMESG000041505.1)

HSP 1 Score: 159.073 bits (401), Expect = 1.537e-39
Identity = 101/259 (39.00%), Postives = 143/259 (55.21%), Query Frame = 3
Query: 1440 FQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLKNAKNG--DYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQG---VVVIVNLTELNESESAHYWPKEGSQIFNIYEVNLVSEHIWSDE---YLVRNFYLKNL---NTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFV 2183
            FQ+E+ +I S +T    I AAI+ EN  KNRY +  PYD SRV +++   G  DYINAS I D   +   YIATQ PL + V DFWQMVWEQ    +V+I N  E   S+   YW    ++  N    N+    I+  E   Y  R F ++N+      + RTV  + +  W    +P SS  +L F R   K +   S PII+HC+ G GRTGTYI ++  + ++ +    +++   LEH+R QRM LV+TE Q+ F+
Sbjct:  645 FQAEFEAIESMDTTKWVISAAIQKENKSKNRYTNIFPYDHSRVIIQSPPFGKSDYINASFI-DGFKRPYAYIATQGPLTETVADFWQMVWEQNSEIIVMISNFVERGRSKCEIYW--SPNKTLNC--GNISVHQIYQKEMAFYTERAFRIRNIRLKKNIKDRTVYHYQYTDWRDFDVPPSSLPVLVFVRATTKHWSESSGPIIVHCSAGVGRTGTYICIESQIRQLDQE-HHINVRGFLEHIRQQRMKLVQTESQYTFI 897          

HSP 2 Score: 58.9214 bits (141), Expect = 1.722e-8
Identity = 55/223 (24.66%), Postives = 104/223 (46.64%), Query Frame = 3
Query: 1440 FQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLK---NAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNESESAHYWPKE--GSQIFNIYEVNLVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLS-WPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICK 2090
              +++   +++E  D     + K  NL KNR    +P +  R++L      +  +YINAS I  +  ++  +I TQ PL++   DFW+MVW++   +I+ L+  N  +   +WP     +  F  ++V+  SE     E+ V+  +L + +  +       H L  WP     S    +L     +N   +  S PI++    G  R G ++ +  +L+++ K
Sbjct:  935 LDTQFKKCINFEPSDYDYMESKKRYNLVKNRSDTIMPIESRRINLSCEPGVEGSNYINASAIQGYW-QMKEFIITQHPLDETEQDFWKMVWDENCSLIILLSNENMHQ---FWPGPDNNALTFRWFKVHCNSE---KTEFSVQYSFLISSSREDYALDCTMHCLKYWP--NTVSECSELLRLLFDINS--KKYSGPIVVIDEYGSSRAGIFVAMSSLLHQLRK 1146          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Planmine SMEST
Match: SMESG000022143.1 (SMESG000022143.1)

HSP 1 Score: 158.303 bits (399), Expect = 2.034e-39
Identity = 98/286 (34.27%), Postives = 154/286 (53.85%), Query Frame = 3
Query: 1362 VATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLKNAKNGDYINASII---VDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQI-FNIYEVN-LVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTI 2195
            +++N+D +     L ++E   +N +I Q ++ S+   +     +EA  K EN  KNRY+D  PYD++RV LKN  + DYINASII   ++ +  +  YIA Q PL +   DFWQM WEQ   +IV LT L+E    +   YWP+    I F  ++++ LV E+     + +R+  +    + E R V    ++SWP   +P+     + F  KV K       PI++HC+ G GRTG  I ++  +  I +  K ++L   L+ +RDQR  +++T  QF FV   I
Sbjct:  754 LSSNLDPFKES--LKFLENSVENDDILQ-QFESVYRKKPGLTMMEAK-KTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFI-EARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAI 1034          
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Planmine SMEST
Match: SMESG000022143.1 (SMESG000022143.1)

HSP 1 Score: 157.918 bits (398), Expect = 2.199e-39
Identity = 98/286 (34.27%), Postives = 154/286 (53.85%), Query Frame = 3
Query: 1362 VATNMDIYTGHMILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKIPYDKSRVSLKNAKNGDYINASII---VDHDPKLPVYIATQAPLEKWVGDFWQMVWEQGVVVIVNLTELNES---ESAHYWPKEGSQI-FNIYEVN-LVSEHIWSDEYLVRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRSKSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRMHLVKTEEQFGFVLTTI 2195
            +++N+D +     L ++E   +N +I Q ++ S+   +     +EA  K EN  KNRY+D  PYD++RV LKN  + DYINASII   ++ +  +  YIA Q PL +   DFWQM WEQ   +IV LT L+E    +   YWP+    I F  ++++ LV E+     + +R+  +    + E R V    ++SWP   +P+     + F  KV K       PI++HC+ G GRTG  I ++  +  I +  K ++L   L+ +RDQR  +++T  QF FV   I
Sbjct:  729 LSSNLDPFKES--LKFLENSVENDDILQ-QFESVYRKKPGLTMMEAK-KTENFSKNRYRDISPYDQTRVILKNNGSSDYINASIINMQINDNGMINKYIAAQGPLLRTSEDFWQMCWEQNTYLIVMLTALSEQGRPKCHKYWPQIYETIEFGDFQISCLVEEYSEDGGFAIRDLMVYRTVSKEERRVQHMQYISWPDHGVPAVHYEFINFVYKVRKFRSGHFEPIVVHCSAGIGRTGVLITMETAMCFI-EARKPINLVDILQTMRDQRASMIQTPAQFKFVCEAI 1009          
The following BLAST results are available for this feature:
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRN22.193e-11961.00protein tyrosine phosphatase receptor type N2 [Sou... [more]
PTPRN22.977e-11961.00protein tyrosine phosphatase receptor type N2 [Sou... [more]
PTPRN24.162e-11961.00protein tyrosine phosphatase receptor type N2 [Sou... [more]
PTPRN24.605e-11961.00protein tyrosine phosphatase receptor type N2 [Sou... [more]
PTPRN1.079e-11856.00protein tyrosine phosphatase receptor type N [Sour... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ida-12.674e-8044.75Receptor-type tyrosine-protein phosphatase-like id... [more]
Y41D4A.52.138e-3834.09Tyrosine-protein phosphatase [Source:UniProtKB/Tr... [more]
ptp-32.016e-3735.16Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-32.226e-3735.16Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-32.522e-3735.16Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IA-22.166e-10957.48gene:FBgn0031294 transcript:FBtr0301417[more]
IA-22.543e-10957.48gene:FBgn0031294 transcript:FBtr0301416[more]
IA-24.031e-10957.48gene:FBgn0031294 transcript:FBtr0332270[more]
Ptpmeg23.562e-3834.18gene:FBgn0028341 transcript:FBtr0071407[more]
Ptpmeg23.562e-3834.18gene:FBgn0028341 transcript:FBtr0333427[more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprna1.603e-12560.33protein tyrosine phosphatase receptor type Na [Sou... [more]
ptprnb2.585e-12259.00protein tyrosine phosphatase receptor type Nb [Sou... [more]
AL928556.13.526e-12259.00protein tyrosine phosphatase receptor type Nb [Sou... [more]
ptprnb5.188e-12259.00protein tyrosine phosphatase receptor type Nb [Sou... [more]
ptprn24.641e-11458.64protein tyrosine phosphatase receptor type N2 [Sou... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpr263.404e-12157.00G protein-coupled receptor 26 [Source:Xenbase;Acc:... [more]
gpr266.182e-12057.00G protein-coupled receptor 26 [Source:Xenbase;Acc:... [more]
gpr262.054e-11957.00G protein-coupled receptor 26 [Source:Xenbase;Acc:... [more]
gpr266.988e-11957.00G protein-coupled receptor 26 [Source:Xenbase;Acc:... [more]
gpr265.123e-11857.00G protein-coupled receptor 26 [Source:Xenbase;Acc:... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptprn2.567e-11957.00protein tyrosine phosphatase, receptor type, N [So... [more]
Ptprn26.191e-11759.33protein tyrosine phosphatase, receptor type, N pol... [more]
Ptprn25.395e-8158.01protein tyrosine phosphatase, receptor type, N pol... [more]
Ptprf9.878e-4235.47protein tyrosine phosphatase, receptor type, F [So... [more]
Ptprs1.008e-4135.74protein tyrosine phosphatase, receptor type, S [So... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O02695|PTPR2_MACNE4.502e-11961.33Receptor-type tyrosine-protein phosphatase N2 OS=M... [more]
sp|Q92932|PTPR2_HUMAN2.211e-11861.00Receptor-type tyrosine-protein phosphatase N2 OS=H... [more]
sp|Q60673|PTPRN_MOUSE2.403e-11857.00Receptor-type tyrosine-protein phosphatase-like N ... [more]
sp|Q63259|PTPRN_RAT2.431e-11756.33Receptor-type tyrosine-protein phosphatase-like N ... [more]
sp|P56722|PTPRN_BOVIN2.455e-11756.33Receptor-type tyrosine-protein phosphatase-like N ... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7QDB91.941e-12461.43Receptor-type tyrosine-protein phosphatase N2 OS=P... [more]
G1N0Q37.183e-12460.33Protein tyrosine phosphatase receptor type N2 OS=M... [more]
A0A093G9S39.827e-12452.79Receptor-type tyrosine-protein phosphatase N2 (Fra... [more]
A0A091NQ371.518e-12360.33Receptor-type tyrosine-protein phosphatase N2 (Fra... [more]
R7VWM32.490e-12360.00Receptor-type tyrosine-protein phosphatase N2 (Fra... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprna3.597e-12459.67protein tyrosine phosphatase receptor type Na [Sou... [more]
ptprnb3.509e-12158.67receptor-type tyrosine-protein phosphatase-like N ... [more]
ptprna2.465e-11357.00protein tyrosine phosphatase receptor type Na [Sou... [more]
ptprna8.787e-11358.47protein tyrosine phosphatase receptor type Na [Sou... [more]
ptprnb5.772e-11058.48receptor-type tyrosine-protein phosphatase-like N ... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002532.17.353e-7153.33pep scaffold:Pmarinus_7.0:GL478137:167104:182177:1... [more]
ENSPMAT00000002534.14.826e-7053.05pep scaffold:Pmarinus_7.0:GL478137:167116:182177:1... [more]
ENSPMAT00000008162.17.089e-4336.33pep scaffold:Pmarinus_7.0:GL477877:143952:159832:-... [more]
ptprk5.207e-4134.65protein tyrosine phosphatase receptor type K [Sour... [more]
ptpra1.979e-4034.44protein tyrosine phosphatase receptor type A [Sour... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PTP13.885e-2629.03Phosphotyrosine-specific protein phosphatase; deph... [more]
PTP25.028e-632.54Nuclear phosphotyrosine-specific phosphatase invol... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO489491.206e-12458.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309824.391e-4738.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO296244.391e-4738.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309807.055e-4638.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317361.185e-4438.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprna7.055e-12258.00receptor-type tyrosine-protein phosphatase-like N ... [more]
ENSORLT00000002122.27.757e-12158.00receptor-type tyrosine-protein phosphatase-like N ... [more]
ptprna3.745e-11858.00receptor-type tyrosine-protein phosphatase-like N ... [more]
ENSORLT00000035149.16.617e-11859.66receptor-type tyrosine-protein phosphatase N2 [Sou... [more]
ptprn21.820e-11759.33protein tyrosine phosphatase receptor type N2 [Sou... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase N2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078547.10.000e+099.59SMESG000078547.1[more]
SMESG000041505.11.480e-3939.00SMESG000041505.1[more]
SMESG000041505.11.537e-3939.00SMESG000041505.1[more]
SMESG000022143.12.034e-3934.27SMESG000022143.1[more]
SMESG000022143.12.199e-3934.27SMESG000022143.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034325 ID=SMED30034325|Name=Receptor-type tyrosine-protein phosphatase N2|organism=Schmidtea mediterranea sexual|type=transcript|length=2469bp
TCTATAAATATGCGAATTAATTTTAGAATGAGTTTATAGGATGGATAATG
GCTGCAAAAATTTTATTATTTATTTTACCATTTAGTGTTTTGACTGTTGA
TTTTCAAAATCCAGAATCTAATTCAGTTAAAGTAGATGAAATAGTATTAA
GCAACATCTACAACGGTAAATTAATCGGTTGCAAGTATCAAAATTTGTGC
CCGATTAATCGAGTTTGTTATAACGATAAATTATTCGGTACTTGTGTAAG
TCAATCGGATAATGCAAACTTCATATACGAATTGGTTACTGAATTTCAAA
ACATTCTCGAATTAGCAATGAGAGATTTGTTTGAGGAAAATTTTAAATGG
AGCGATTTTTACACGCAATGTTTTTTGCAATCGGTTTTAATGTCTTCAGA
ATTTCAACAATTTCTCGACATTCAACATTGTAAACCGACCATTGATCCAT
TACTTGTGTTCGATCCAGAAAATTTGCAACTTGATCAATCCCAACAGAAA
GAAGATTCTGAAATAGAAATTCCAAGAGTTTACACTCGAAAGCAAAAGTC
TCAAGGAAGTGAAGCATTTTACAACAAAATTCGATCGATGTTACACGAAA
TTCAAGACAAGAAACGCATTGATTCGCACTATGAAAATCGAGAAATGATC
AATCCAAAATCAAACAGTGAAGAAGCGAAATCTGTGACAAAAGTTAATTA
TGCAGATCCGAAACTCATTCGTAAAGTTTTGAAAGTTGCTAAAAGAAGAT
CGAATGATTGGGTTTGGTTAAAATTTAATAAAAAGGTTAGCATCAGTGAT
CAGCCGAAAATTTTAAATTCTGTAATAAATTCCATGCCTAATTCTGTGAA
TATCGTTAAGTACGAATGGAGATCAGATCCTTCAATTTTTAATTTCAAGC
TTCATCCGGATTCAGTTTTTCATTCGGAAAACGTGACGAATTTTTTTAAT
AATCACAAAGGCATCATTCCTGGGTATACTATTCTAGATACTGGTACTGG
AAGGTTGCAGTCTCCGATAAGACAGGAAGAAATTCGAAGCGATCAAAATT
TTCTCATCACATTGGTCATATGTTGTGTCGTATTTCTCGGAGTAATTCTC
GTGTTGATTGGATTTTGTATACAAAAGTTTCGATACAAACGAGATAAGCT
TGGAGACATTTTGAAGTCGAAGTTTCCTGATAATTCTTCGTCAAGTTATA
AGGAATTATTTCGAGGATCAAACAATAAAGATACAACAATCATTAAAAAC
AAACAAGGAGTGGCAAGGATGAATAGCAAGCAGCACAGTGGAGATACACC
GGCTGCTTCTTCTCCCGTTTCAACACGAAGTAGTACATCATCATGGACGG
ATGAAATGCAAGTGGCTACAAATATGGATATTTATACCGGGCATATGATT
TTGTCTTATATGGAGAAGCATCAAAAGAATAAAGAGATATTTCAATCGGA
ATGGAATTCGATTCTATCCTATGAAACTGAAGATGCGAAAATTGAAGCTG
CAATAAAGATTGAGAATCTCCCTAAAAACCGCTACCAAGATAAAATTCCC
TATGATAAAAGTAGAGTATCACTGAAAAATGCGAAAAATGGTGATTACAT
TAATGCCAGTATCATTGTGGATCATGATCCTAAATTACCTGTATATATTG
CAACACAAGCTCCTTTGGAGAAATGGGTAGGAGATTTCTGGCAAATGGTT
TGGGAACAAGGCGTAGTGGTTATCGTTAATTTGACTGAATTAAATGAGAG
CGAATCCGCTCATTATTGGCCAAAAGAGGGATCCCAAATTTTCAATATCT
ATGAGGTCAACTTGGTGTCCGAGCATATATGGAGCGATGAATATTTGGTG
AGAAATTTCTACTTGAAAAATTTAAACACTACGGAAACTCGAACTGTTAC
ACAGTTTCATTTTCTTAGCTGGCCAGTTGATAAATTACCAAGCAGTTCAC
GTTCAATTTTGGAATTTAGAAGAAAAGTTAATAAAAGTTATCGATCGAAG
TCTACTCCCATTATTATTCATTGCAACGATGGATGTGGACGTACCGGAAC
TTATATCCTTTTGGATTTAATTCTTAACCGAATCTGCAAGGGTCTTAAAG
AAATGGATCTTGCTGCAACTTTAGAACATCTTAGAGACCAGAGAATGCAT
TTAGTAAAAACTGAGGAGCAGTTTGGATTTGTGTTGACCACAATATCAGA
AGAAGTCAATAACATCCTAAAGATTCTCAATCAGTGAACACTTGAATAGA
TTGGAAAATTATTTACATAATTTATGTTTATCACCATGAACTTGTTTACA
AAAGATTATTGTCACTCGCAATCATCTTACATGTTGTGTTGTGAAATTTT
GATTATTATCAGAGTTCTCTTTTGTTGATTCGTGGACGTTTTTGTTTCTC
CGGTTTTGTGATTAGTTTTTAACTTTGTAGATTTTTGTGATATTTAATAT
AAATTGACAAGTAATAAAA
back to top

protein sequence of SMED30034325-orf-1

>SMED30034325-orf-1 ID=SMED30034325-orf-1|Name=SMED30034325-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=730bp
MAAKILLFILPFSVLTVDFQNPESNSVKVDEIVLSNIYNGKLIGCKYQNL
CPINRVCYNDKLFGTCVSQSDNANFIYELVTEFQNILELAMRDLFEENFK
WSDFYTQCFLQSVLMSSEFQQFLDIQHCKPTIDPLLVFDPENLQLDQSQQ
KEDSEIEIPRVYTRKQKSQGSEAFYNKIRSMLHEIQDKKRIDSHYENREM
INPKSNSEEAKSVTKVNYADPKLIRKVLKVAKRRSNDWVWLKFNKKVSIS
DQPKILNSVINSMPNSVNIVKYEWRSDPSIFNFKLHPDSVFHSENVTNFF
NNHKGIIPGYTILDTGTGRLQSPIRQEEIRSDQNFLITLVICCVVFLGVI
LVLIGFCIQKFRYKRDKLGDILKSKFPDNSSSSYKELFRGSNNKDTTIIK
NKQGVARMNSKQHSGDTPAASSPVSTRSSTSSWTDEMQVATNMDIYTGHM
ILSYMEKHQKNKEIFQSEWNSILSYETEDAKIEAAIKIENLPKNRYQDKI
PYDKSRVSLKNAKNGDYINASIIVDHDPKLPVYIATQAPLEKWVGDFWQM
VWEQGVVVIVNLTELNESESAHYWPKEGSQIFNIYEVNLVSEHIWSDEYL
VRNFYLKNLNTTETRTVTQFHFLSWPVDKLPSSSRSILEFRRKVNKSYRS
KSTPIIIHCNDGCGRTGTYILLDLILNRICKGLKEMDLAATLEHLRDQRM
HLVKTEEQFGFVLTTISEEVNNILKILNQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: cellular component
TermDefinition
GO:0030141secretory granule
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0030658transport vesicle membrane
GO:0030667secretory granule membrane
GO:0030672synaptic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0045202synapse
Vocabulary: INTERPRO
TermDefinition
IPR000242PTPase_domain
IPR003595Tyr_Pase_cat
IPR029021Prot-tyrosine_phosphatase-like
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0016791phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0006629lipid metabolic process
GO:0007269neurotransmitter secretion
GO:0035335peptidyl-tyrosine dephosphorylation
GO:0035773insulin secretion involved in cellular response to glucose stimulus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000242PTP type protein phosphatasePRINTSPR00700PRTYPHPHTASEcoord: 702..712
score: 44.06
coord: 654..672
score: 55.88
coord: 533..553
score: 59.61
coord: 615..632
score: 39.44
coord: 516..523
score: 71.03
coord: 686..701
score: 30.18
IPR000242PTP type protein phosphataseSMARTSM00194PTPc_3coord: 464..721
e-value: 1.6E-94
score: 330.0
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 490..716
e-value: 1.0E-66
score: 224.9
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 465..719
score: 46.419
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 616..718
e-value: 2.0E-33
score: 127.1
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 435..727
e-value: 2.9E-94
score: 317.7
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 446..727
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 405..433
NoneNo IPR availablePANTHERPTHR46106:SF4IA-2 PROTEIN TYROSINE PHOSPHATASE, ISOFORM Ccoord: 50..210
NoneNo IPR availablePANTHERPTHR46106FAMILY NOT NAMEDcoord: 143..728
coord: 50..210
NoneNo IPR availablePANTHERPTHR46106:SF4IA-2 PROTEIN TYROSINE PHOSPHATASE, ISOFORM Ccoord: 143..728
NoneNo IPR availableCDDcd14610R-PTP-N2coord: 447..723
e-value: 5.89008E-140
score: 410.602
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.727
NoneNo IPR availableTMHMMTMhelixcoord: 335..357
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 657..667
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 635..710
score: 17.98