Tubulin alpha chain

Overview
NameTubulin alpha chain
Smed IDSMED30034324
Length (bp)2158
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tubulin alpha chain (SMED30034324) t-SNE clustered cells

Violin plots show distribution of expression levels for Tubulin alpha chain (SMED30034324) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tubulin alpha chain (SMED30034324) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tubulin alpha chain (SMED30034324) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034324

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30034324 SmedASXL_006528SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior sideSMED30034324 dd_Smed_v4_1623_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30034324 dd_Smed_v4_1623_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1C (tubulin alpha 1c [Source:HGNC Symbol;Acc:HGNC:20768])

HSP 1 Score: 362.844 bits (930), Expect = 6.574e-118
Identity = 175/355 (49.30%), Postives = 254/355 (71.55%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H+++T   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1B (tubulin alpha 1b [Source:HGNC Symbol;Acc:HGNC:18809])

HSP 1 Score: 361.303 bits (926), Expect = 2.536e-117
Identity = 174/355 (49.01%), Postives = 255/355 (71.83%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK + +IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1A (tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:20766])

HSP 1 Score: 359.762 bits (922), Expect = 1.066e-116
Identity = 173/355 (48.73%), Postives = 253/355 (71.27%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1A (tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:20766])

HSP 1 Score: 359.762 bits (922), Expect = 1.066e-116
Identity = 173/355 (48.73%), Postives = 253/355 (71.27%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 358.607 bits (919), Expect = 1.255e-116
Identity = 170/355 (47.89%), Postives = 253/355 (71.27%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTV+DE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++++  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACC+ YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-6 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:P91873])

HSP 1 Score: 355.14 bits (910), Expect = 3.825e-115
Identity = 165/349 (47.28%), Postives = 250/349 (71.63%), Query Frame = 2
Query: 1112 KEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            +E+I +HVGQAG+QI NA WELFC+EHG+   G    +  +  DE    +N  F E    K VPR + VDLEPTV+DE+R G YR+L+HP+ L+SG EDA+N +ARG Y++G++MI+  ++++ ++A +CN + GFV+ +S+GGGTGSGF SL++  L  E+ K  K+   I+P+P+++T++VEPYNSIL   T++E  D   + DNEA+++ C   +++ +PTY+N+NRLV+QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP   ++P+   +RA H++ T  ++T+  F PG Q + C+   GKYMA CL YRG V+P++IN A+A +K +  +QFV+WCP
Sbjct:    8 REVISIHVGQAGVQIGNACWELFCLEHGIQPDGYHVEDDTY--DEETETINTFFAETAGGKHVPRCLFVDLEPTVVDEVRTGTYRSLFHPEQLLSGKEDAANCYARGRYTIGREMIDVVMDRVKRLAENCNGLQGFVIFHSFGGGTGSGFLSLLMERLSTEYGKKPKLEFAIYPAPQVSTSMVEPYNSILMTHTTLEHSDCTFMVDNEAIYDICRRNLDLARPTYTNLNRLVAQIISSITASLRFEGALNVDLTEFQTNLVPYPRIHFPLVTYAPLVSAERASHEQNTVSDMTHACFEPGYQMVKCDPRRGKYMAVCLLYRGDVVPKDINSAIAAVKTKRTVQFVEWCP 354          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-9 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:Q20221])

HSP 1 Score: 353.214 bits (905), Expect = 1.649e-114
Identity = 162/351 (46.15%), Postives = 253/351 (72.08%), Query Frame = 2
Query: 1112 KEIIFLHVGQAGIQISNAQWELFCIEHGLDCQG--NTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            +E+I +HVGQAG+Q+ NA WEL+C+EHG+   G  N + +     D F    N  F E    K VPRAI VDLEPT IDEIR G Y+ L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ ++  +C  + GF++ +S+GGGTGSGF++L++  L  ++ K +K+   I+P+P+++T++VEPYNSIL+  T++E  D + + DNEA+++ C   +++ +PTY+N+NRL++Q++SS+T +LRF  +L+ DL  FQTNL+PYP++HFP   ++PI   ++A H+++T   IT   F PG Q + C+   GKYMACCL YRG V+P+++N A+A +K + +IQFVDWCP
Sbjct:    7 REVISIHVGQAGVQMGNACWELYCLEHGIQPDGMINEEDSLGVDDDSF----NTFFSETMAGKHVPRAIMVDLEPTPIDEIRTGTYKTLFHPEQLLTGKEDAANNYARGHYTIGKEIIDVVMDRVRRLVENCRGLQGFLVFHSFGGGTGSGFTALLMERLSVDYGKKSKLEFCIYPAPQVSTSMVEPYNSILTTHTTLEHSDCSFMVDNEAIYDICRRNLDLARPTYTNLNRLIAQVISSVTASLRFDGALNVDLTEFQTNLVPYPRIHFPLTTYAPIISAEKAYHEQMTVAEITQQCFEPGAQMVKCDPRRGKYMACCLLYRGDVVPKDVNAAIASVKTKRSIQFVDWCP 353          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: mec-12 (Tubulin alpha-3 chain Detyrosinated tubulin alpha-3 chain [Source:UniProtKB/Swiss-Prot;Acc:P91910])

HSP 1 Score: 351.288 bits (900), Expect = 7.811e-114
Identity = 165/351 (47.01%), Postives = 255/351 (72.65%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFY-KDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E+I +H+GQAG+QI NA WEL+C+EHG+   G    +      D+ F+     F E  + + VPRA+ VDLEPTVIDEIR G YR+L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ ++A +C  + GF++ +S+GGGTGSGF+SL++  L  ++ K  K+   I+P+P+++TAVVEPYNSIL+  T++E  D + + DNEA+++ C   ++I +P+Y+N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A FSP+   ++A H++++   IT   F P NQ + C+   GKYMA CL +RG V+P+++N A+A IK + +IQFVDWCP
Sbjct:    1 MREVISIHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSLGGSDDSFS---TFFSETGSGRHVPRAVMVDLEPTVIDEIRTGTYRSLFHPEQLITGKEDAANNYARGHYTIGKEIIDLTLDRIRRLADNCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKAKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCSFMVDNEAIYDICRRNLDIERPSYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATFSPVISAEKAYHEQLSVAEITNMCFEPHNQMVKCDPRHGKYMAVCLLFRGDVVPKDVNAAIATIKTKRSIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 350.132 bits (897), Expect = 2.304e-113
Identity = 161/350 (46.00%), Postives = 254/350 (72.57%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E+I +HVGQAG+QI NA WEL+C+EHG+   G     S    + F       F +  + ++VPR+I VDLEPTV+DEIR G Y+ L+HP+ +++G EDA+NN+ARG Y+VGK++I+  ++++ ++A +C+ + GF + +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   +++ +P+Y+N+NR++SQ++SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H+ ++  +IT   F P NQ + C+   GKYMA CL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPTQSTNEGESF----TTFFSDTGSGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDVERPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCP 346          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 350.132 bits (897), Expect = 2.304e-113
Identity = 161/350 (46.00%), Postives = 254/350 (72.57%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E+I +HVGQAG+QI NA WEL+C+EHG+   G     S    + F       F +  + ++VPR+I VDLEPTV+DEIR G Y+ L+HP+ +++G EDA+NN+ARG Y+VGK++I+  ++++ ++A +C+ + GF + +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   +++ +P+Y+N+NR++SQ++SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H+ ++  +IT   F P NQ + C+   GKYMA CL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPTQSTNEGESF----TTFFSDTGSGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDVERPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCP 346          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub84B (gene:FBgn0003884 transcript:FBtr0081639)

HSP 1 Score: 357.836 bits (917), Expect = 3.295e-116
Identity = 169/355 (47.61%), Postives = 252/355 (70.99%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTV+DE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++++  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP   ++P+   ++A H++++   IT   F P NQ + C+   GKYMACC+ YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub85E (gene:FBgn0003886 transcript:FBtr0082087)

HSP 1 Score: 357.451 bits (916), Expect = 4.172e-116
Identity = 169/355 (47.61%), Postives = 254/355 (71.55%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +H+GQAG+QI NA WEL+C+EHG+   G+     T G  D   D F    +  F E    K VPRA+ VDLEPTV+DE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++++  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H+++T   IT   F P NQ + C+   GKYMACC+ YRG V+P+++N A+A IK + +IQFVDWCP
Sbjct:    1 MRECISVHIGQAGVQIGNACWELYCLEHGIQPDGHMPSDKTVGGGD---DSF----STFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDVVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYMNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISVEKAYHEQLTVAEITNACFEPANQMVKCDPRRGKYMACCMLYRGDVVPKDVNAAIATIKTKRSIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub84D (gene:FBgn0003885 transcript:FBtr0081538)

HSP 1 Score: 353.214 bits (905), Expect = 1.808e-114
Identity = 167/355 (47.04%), Postives = 251/355 (70.70%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTV+DE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++++  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   ++P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP   ++P+   ++A H++++   IT   F P NQ +  +   GKYMACC+ YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKVDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub67C (gene:FBgn0087040 transcript:FBtr0076393)

HSP 1 Score: 329.717 bits (844), Expect = 2.538e-105
Identity = 157/359 (43.73%), Postives = 242/359 (67.41%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYKDEFFAGVN---------IIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E++ + +GQ GIQI NA WEL+ +EHG++  G+ K   +       A V            F E    K VPR+I VDLEPTVID++R G  R L+HP+ L+SG EDA+NN+ARG YS+GK++I+    +L KIA  C+S+ GF++ +S GGGTGSGF+SL++  L  ++SK  K+   ++PSPK++TAVVEPYN++L+  ++++  D   + DNEA+++ C N + + +P Y N+NRL++QI+SS T +LRF  S++ DL  FQTNL+P+P++HFP   ++P+   +R+ H++     +T   F   N  + C+   GK+MACC+ YRG V+P+++N A++ IK + +IQFVDWCP
Sbjct:    1 MREVVSIQIGQCGIQIGNACWELYLLEHGINLDGSLKTKEELTASGSSASVGHDTSANDARTFFTETGNGKQVPRSIFVDLEPTVIDDVRNGCMRELYHPEQLISGKEDAANNYARGRYSIGKEVIDRVTSRLQKIAEQCDSLQGFLIFHSLGGGTGSGFTSLLVERLSTDYSKKCKLDFAVYPSPKVSTAVVEPYNALLTTHSTMDHSDCVFMVDNEAIYDICNNSLGVDRPAYRNLNRLIAQIVSSTTASLRFSGSMNVDLNEFQTNLVPFPRIHFPLVAYAPLMSAERSAHEQHAITTLTNACFESSNMMVKCDPRAGKFMACCMLYRGDVVPKDVNAAVSAIKSKRHIQFVDWCP 359          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: CG7794 (gene:FBgn0038565 transcript:FBtr0083540)

HSP 1 Score: 288.115 bits (736), Expect = 2.307e-89
Identity = 144/351 (41.03%), Postives = 224/351 (63.82%), Query Frame = 2
Query: 1115 EIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-TKGNSDFYKDEFFAGVNIIFQ-EAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKN-TKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            EII +H+GQAG+QI+NA WELFC+EHG+   G  T+   D   D F       F+  +H     PR + +D EPTVIDEIR G YRNL+HPD L++G +D+ +NFARG+  +  ++++  +  + ++A  C ++ GF++  + GGG+GSG  + I+  L E+F K  T +  +++PSP ++  +VEPYN++L+A  S++  D++ + DNEA+++ C N +N+  PTY+N+NR+++Q++SS T + RFG          QTNL+PYP++H+P  N++P+     +    ++T  +T   F   NQ + CN S GKYMA  L YRG + P EIN AL  IK+  + +FVDW P
Sbjct:    6 EIIQIHIGQAGVQIANACWELFCLEHGILANGRLTQSPMD---DSFLT----FFEFTSHQPCVQPRLVMIDTEPTVIDEIRTGSYRNLFHPDTLITGKDDSGSNFARGYNLMASELLDRSMNAIRRVADRCRNLRGFLVFRAIGGGSGSGLGTRIMERLVEDFGKKMTVVEFLVYPSPSISPVIVEPYNALLAAHFSMDCADVSFIVDNEALYDICANTLNVPAPTYTNLNRIIAQVVSSFTASQRFGGGSTVSFQELQTNLVPYPRIHYPLINYAPLVPISHSQFVNMSTAQLTGQCFQMSNQMVRCNPSHGKYMASVLLYRGDIAPNEINTALENIKRNRSFRFVDWSP 349          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba1c (tubulin, alpha 1c [Source:ZFIN;Acc:ZDB-GENE-061114-1])

HSP 1 Score: 361.303 bits (926), Expect = 1.010e-117
Identity = 174/355 (49.01%), Postives = 254/355 (71.55%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba8l (tubulin, alpha 8 like [Source:ZFIN;Acc:ZDB-GENE-030131-9167])

HSP 1 Score: 361.303 bits (926), Expect = 1.778e-117
Identity = 172/351 (49.00%), Postives = 253/351 (72.08%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYK-DEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   GN   +    K D+ F   N  F E  + K VPRA+ VDLEP VIDE+R G YR L+HP+ L+SG EDA+NN+ARG Y+VGK++I+  +E++ K+   C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +P+Y+N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP   +SPI   ++A H++++   IT   F P NQ + C+   GKYMACC+ YRG V+P+++N A+A IK + +IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGNMPSDKTIGKSDDSF---NTFFSETGSGKHVPRAVFVDLEPAVIDEVRSGTYRQLFHPEQLISGKEDAANNYARGHYTVGKEIIDMVLERVRKLTDQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISAEKAYHEQLSVSEITSACFEPSNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIANIKTKRSIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba1c (tubulin, alpha 1c [Source:ZFIN;Acc:ZDB-GENE-061114-1])

HSP 1 Score: 361.303 bits (926), Expect = 2.086e-117
Identity = 174/355 (49.01%), Postives = 254/355 (71.55%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba8l2 (tubulin, alpha 8 like 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1646])

HSP 1 Score: 360.147 bits (923), Expect = 4.868e-117
Identity = 170/352 (48.30%), Postives = 253/352 (71.88%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDF--YKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+Q+ N  WEL+C+EHG+   G    +     + D F       F E    K+VPRAI VDLEPTVIDE+R G YR L+HP+ L+SG EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  +F K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +P+Y+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK + +IQFVDWCP
Sbjct:    1 MRECISVHVGQAGVQMGNTCWELYCLEHGIQPDGQMPSHKPVGGHDDSF----TTFFSETGAGKYVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIIDSVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDFGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNSCFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNVAIAAIKTKRSIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: si:ch73-199e17.1 (si:ch73-199e17.1 [Source:ZFIN;Acc:ZDB-GENE-100921-8])

HSP 1 Score: 360.147 bits (923), Expect = 5.778e-117
Identity = 170/351 (48.43%), Postives = 253/351 (72.08%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYK-DEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG QI NA WEL+C+EHG+   G    +      D+ F   N  F E  + K VPRAI VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K++  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++  +IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISVHVGQAGAQIGNACWELYCLEHGIQPDGQMPSDRSIGGGDDSF---NTFFSETASGKHVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDSVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRKNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1c (tubulin alpha 1c [Source:NCBI gene;Acc:394675])

HSP 1 Score: 362.844 bits (930), Expect = 5.709e-118
Identity = 174/355 (49.01%), Postives = 255/355 (71.83%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +P+Y+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H+++T  +IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVADITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1b (tubulin alpha 4a [Source:NCBI gene;Acc:100038108])

HSP 1 Score: 361.303 bits (926), Expect = 2.299e-117
Identity = 174/355 (49.01%), Postives = 255/355 (71.83%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK + +IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1b (tubulin alpha 4a [Source:NCBI gene;Acc:100038108])

HSP 1 Score: 361.303 bits (926), Expect = 2.299e-117
Identity = 174/355 (49.01%), Postives = 255/355 (71.83%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK + +IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1b (tubulin alpha 4a [Source:NCBI gene;Acc:100038108])

HSP 1 Score: 361.303 bits (926), Expect = 2.299e-117
Identity = 174/355 (49.01%), Postives = 255/355 (71.83%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK + +IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1b (tubulin alpha 4a [Source:NCBI gene;Acc:100038108])

HSP 1 Score: 361.303 bits (926), Expect = 2.299e-117
Identity = 174/355 (49.01%), Postives = 255/355 (71.83%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK + +IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1c (tubulin, alpha 1C [Source:MGI Symbol;Acc:MGI:1095409])

HSP 1 Score: 362.844 bits (930), Expect = 4.324e-118
Identity = 175/355 (49.30%), Postives = 254/355 (71.55%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H+++T   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1b (tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:107804])

HSP 1 Score: 361.303 bits (926), Expect = 1.741e-117
Identity = 174/355 (49.01%), Postives = 255/355 (71.83%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK + +IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1a (tubulin, alpha 1A [Source:MGI Symbol;Acc:MGI:98869])

HSP 1 Score: 359.762 bits (922), Expect = 7.318e-117
Identity = 173/355 (48.73%), Postives = 253/355 (71.27%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba4a (tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:1095410])

HSP 1 Score: 358.992 bits (920), Expect = 1.252e-116
Identity = 173/355 (48.73%), Postives = 255/355 (71.83%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+Q+ NA WEL+C+EHG+   G      T G  D   D F       F E    K VPRA+ VDLEPTVIDEIR GPYR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K++  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK + +IQFVDWCP
Sbjct:    1 MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----TTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba3a (tubulin, alpha 3A [Source:MGI Symbol;Acc:MGI:1095406])

HSP 1 Score: 358.221 bits (918), Expect = 2.854e-116
Identity = 170/355 (47.89%), Postives = 253/355 (71.27%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTV+DE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++++  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACC+ YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P08537|TBA_XENLA (Tubulin alpha chain OS=Xenopus laevis OX=8355 GN=tuba PE=2 SV=2)

HSP 1 Score: 364.385 bits (934), Expect = 7.586e-118
Identity = 175/355 (49.30%), Postives = 256/355 (72.11%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H+++T  +IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK + +IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVADITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P68373|TBA1C_MOUSE (Tubulin alpha-1C chain OS=Mus musculus OX=10090 GN=Tuba1c PE=1 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 3.025e-117
Identity = 175/355 (49.30%), Postives = 254/355 (71.55%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H+++T   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P68365|TBA1C_CRIGR (Tubulin alpha-1C chain OS=Cricetulus griseus OX=10029 GN=TUBA1C PE=2 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 3.025e-117
Identity = 175/355 (49.30%), Postives = 254/355 (71.55%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H+++T   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|Q6AYZ1|TBA1C_RAT (Tubulin alpha-1C chain OS=Rattus norvegicus OX=10116 GN=Tuba1c PE=1 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 3.057e-117
Identity = 175/355 (49.30%), Postives = 254/355 (71.55%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H+++T   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|Q9BQE3|TBA1C_HUMAN (Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 3.157e-117
Identity = 175/355 (49.30%), Postives = 254/355 (71.55%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H+++T   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A7M6D9 (Tubulin alpha chain OS=Dugesia ryukyuensis OX=79738 PE=2 SV=1)

HSP 1 Score: 398.667 bits (1023), Expect = 2.062e-127
Identity = 185/350 (52.86%), Postives = 264/350 (75.43%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E+I ++VGQAGIQ++NA WELFCIEHG++  G  + +  F ++    G +  FQE  +  FVPRAI++DLEPTVIDEIR   YR+LWHPD L++  EDA+NNFARG ++VGK +I  F++QL K    C S+ GF+++NSYGGGTGSG S+LI  +L  E+S++ K    I+P+P++ATA+VEPYN++LSA  SIE  D+ +L DNEA FE C  +++I +P Y+N+NRL++QI S++TV++RFGSSL+HDL+  QTNL+PYP++HFP  N++PI D  RA+H+K++   IT +LF   NQ I C++  GKYM+CC+ YRG + PR++N  + EIK+R++I FVDWCP
Sbjct:    1 MREVISINVGQAGIQMANAAWELFCIEHGIEADGKLRDSERFAQN---VGFHTFFQEVPSGNFVPRAINIDLEPTVIDEIRTANYRHLWHPDYLINCCEDAANNFARGHFTVGKNVIERFLDQLRKCVHACQSVQGFIVLNSYGGGTGSGLSALIFEHLDIEYSQSAKFQQCIYPAPQLATAIVEPYNALLSASKSIEHTDVVMLIDNEATFEICTRQLSISRPVYNNLNRLLAQIFSAMTVSIRFGSSLNHDLLQLQTNLVPYPRIHFPAVNYAPILDPHRANHEKLSITEITRELFESSNQLIKCDLRLGKYMSCCIQYRGLITPRQVNLGVYEIKRRTDISFVDWCP 347          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A0N5A2I7 (Tubulin alpha chain OS=Parastrongyloides trichosuri OX=131310 PE=3 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 4.560e-118
Identity = 170/351 (48.43%), Postives = 260/351 (74.07%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGN-SDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E+I +H+GQAG+QI NA WEL+C+EHG+ C      + S    D+ F      F E    ++VPRA+ +DLEPTVIDEIR GPYR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A +C  + GF++ +S+GGGTGSGF+SL++  L  E+ K +K+   ++P+P+++TAVVEPYNS+L+  T++E  D + + DNEA+++ C   ++I +P+YSN+NR++SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A F+P+   ++A H++++   IT  +F PGNQ + C+   GKYMACCL YRG V+P+++N A+A IK + NIQFVDWCP
Sbjct:    1 MREVISVHIGQAGVQIGNACWELYCLEHGIQCDSTMPSDKSQGINDDSF---TTFFAETGNGRYVPRAVMIDLEPTVIDEIRTGPYRQLFHPEQLITGKEDAANNYARGHYTIGKELIDLSLDKIRKVADNCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVEYGKKSKLEFSVYPAPQVSTAVVEPYNSVLTTHTTLEHSDCSFMVDNEAIYDICRRNLSIERPSYSNLNRIISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATFAPVISAEKAYHEQLSVGEITNQVFEPGNQMVKCDPRNGKYMACCLLYRGDVVPKDVNAAIASIKTKRNIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A0K0FUG8 (Tubulin alpha chain OS=Strongyloides venezuelensis OX=75913 PE=3 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 2.533e-117
Identity = 169/352 (48.01%), Postives = 260/352 (73.86%), Query Frame = 2
Query: 1106 QIKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGN-SDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            +++E+I +H+GQAG+QI NA WEL+C+EHG+ C      + S    D+ F      F E    ++VPRA+ +DLEPTVIDEIR G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A +C  + GF++ +S+GGGTGSGF+SL++  L  E+ K +K+   ++P+P+++TAVVEPYNS+L+  T++E  D + + DNEA+++ C   ++I +P+YSN+NR++SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A F+P+   ++A H++++   IT  +F PGNQ + C+   GKYMACCL YRG V+P+++N A+A IK + NIQFVDWCP
Sbjct:    9 KMREVISVHIGQAGVQIGNACWELYCLEHGIQCDSTMPSDKSQGINDDSF---TTFFAETGNGRYVPRAVMIDLEPTVIDEIRTGQYRQLFHPEQLITGKEDAANNYARGHYTIGKELIDLSLDKIRKVADNCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVEYGKKSKLEFSVYPAPQVSTAVVEPYNSVLTTHTTLEHSDCSFMVDNEAIYDICRRNLSIERPSYSNLNRIISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATFAPVISAEKAYHEQLSVAEITNQVFEPGNQMVKCDPRNGKYMACCLLYRGDVVPKDVNAAIASIKTKKNIQFVDWCP 357          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A0N5BAF3 (Tubulin alpha chain OS=Strongyloides papillosus OX=174720 PE=3 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 3.046e-117
Identity = 169/351 (48.15%), Postives = 259/351 (73.79%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGN-SDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E+I +H+GQAG+QI NA WEL+C+EHG+ C      + S    D+ F      F E    ++VPRA+ +DLEPTVIDEIR G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A +C  + GF++ +S+GGGTGSGF+SL++  L  E+ K +K+   ++P+P+++TAVVEPYNS+L+  T++E  D + + DNEA+++ C   ++I +P+YSN+NR++SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A F+P+   ++A H++++   IT  +F PGNQ + C+   GKYMACCL YRG V+P+++N A+A IK + NIQFVDWCP
Sbjct:    1 MREVISVHIGQAGVQIGNACWELYCLEHGIQCDSTMPSDKSQGINDDSF---TTFFAETGNGRYVPRAVMIDLEPTVIDEIRTGQYRQLFHPEQLITGKEDAANNYARGHYTIGKELIDLSLDKIRKVADNCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVEYGKKSKLEFSVYPAPQVSTAVVEPYNSVLTTHTTLEHSDCSFMVDNEAIYDICRRNLSIERPSYSNLNRIISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATFAPVISAEKAYHEQLSVAEITNQVFEPGNQMVKCDPRNGKYMACCLLYRGDVVPKDVNAAIASIKTKKNIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A090MZ67 (Tubulin alpha chain OS=Strongyloides ratti OX=34506 GN=SRAE_2000306100 PE=3 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 3.249e-117
Identity = 170/351 (48.43%), Postives = 259/351 (73.79%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGN-SDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E+I +H+GQAG+QI NA WEL+C+EHG+ C      + S    D+ F      F E    ++VPRA+ +DLEPTVIDEIR G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ KIA +C  + GF++ +S+GGGTGSGF+SL++  L  E+ K +K+   ++P+P+++TAVVEPYNS+L+  T++E  D + + DNEA+++ C   ++I +P+YSN+NR++SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A F+P+   ++A H++++   IT  +F PGNQ + C+   GKYMACCL YRG V+P+++N A+A IK + NIQFVDWCP
Sbjct:    1 MREVISVHIGQAGVQIGNACWELYCLEHGIQCDSTMPSDKSQGINDDSF---TTFFAETGNGRYVPRAVMIDLEPTVIDEIRTGQYRQLFHPEQLITGKEDAANNYARGHYTIGKELIDLSLDKIRKIADNCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVEYGKKSKLEFSVYPAPQVSTAVVEPYNSVLTTHTTLEHSDCSFMVDNEAIYDICRRNLSIERPSYSNLNRIISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATFAPVISAEKAYHEQLSVSEITNQVFEPGNQMVKCDPRNGKYMACCLLYRGDVVPKDVNAAIASIKTKRNIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: si:ch73-199e17.1 (tubulin alpha chain-like [Source:NCBI gene;Acc:103038622])

HSP 1 Score: 361.303 bits (926), Expect = 1.256e-117
Identity = 171/350 (48.86%), Postives = 252/350 (72.00%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG QI NA WEL+C+EHG+   G+         D+ F   N  F E  T K VPRAI VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+   C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++  +IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISVHVGQAGAQIGNACWELYCLEHGIQPDGHMPSEKIPRGDDSF---NTFFSETGTGKHVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEVIDAVLDRIRKLTDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRKNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPCNQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRTIQFVDWCP 347          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000030346.1 (tubulin alpha-1B chain [Source:NCBI gene;Acc:111195381])

HSP 1 Score: 361.303 bits (926), Expect = 1.768e-117
Identity = 174/355 (49.01%), Postives = 254/355 (71.55%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: tuba8l2 (tubulin alpha chain-like [Source:NCBI gene;Acc:103042625])

HSP 1 Score: 360.147 bits (923), Expect = 4.125e-117
Identity = 171/352 (48.58%), Postives = 255/352 (72.44%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGL--DCQGNTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+Q+ N  WEL+C+EHG+  D Q  ++     + D F       F E    K+VPRAI VDLEPTVIDE+R G YR L+HP+ L+SG EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  +F K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +P+Y+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK + +IQFVDWCP
Sbjct:    1 MRECISVHVGQAGVQMGNTCWELYCLEHGIQPDGQMPSQKPVGGHDDSF----TTFFSETGAGKYVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIIDSVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDFGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNSCFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNVAIAAIKTKRSIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000049713.1 (tubulin alpha-1A chain [Source:NCBI gene;Acc:103046666])

HSP 1 Score: 360.147 bits (923), Expect = 4.841e-117
Identity = 173/355 (48.73%), Postives = 254/355 (71.55%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK + +IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000042562.1 (tubulin alpha chain [Source:NCBI gene;Acc:103038315])

HSP 1 Score: 359.377 bits (921), Expect = 8.275e-117
Identity = 174/355 (49.01%), Postives = 253/355 (71.27%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG Q+ NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRAI VDLEPTVIDEIR G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  +++  K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++  +IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK + +IQFVDWCP
Sbjct:    1 MRECISMHVGQAGAQMGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAIFVDLEPTVIDEIRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRKNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRSIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 358.607 bits (919), Expect = 1.393e-118
Identity = 170/355 (47.89%), Postives = 253/355 (71.27%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTV+DE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++++  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACC+ YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001139.1 (pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 gene:ENSPMAG00000001018.1 transcript:ENSPMAT00000001139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 292.738 bits (748), Expect = 4.153e-93
Identity = 147/354 (41.53%), Postives = 231/354 (65.25%), Query Frame = 2
Query: 1112 KEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYK--DEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDE---IRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++ I +H+GQAG+Q+ NA WEL+C+EHG+   G+   + D     D  F   N  F E  + K VPRAI +DLEP+VI E   +R           M+++G E  S+   RG    G+K+ +  + +    +  C  + GF+L +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYN+IL+  T++E  D + + DNEA+++ C  K++I  P+Y N+NRL++Q++SS+T +LRF  +L+ DL  FQTNL+PYP++HFP   ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG ++P+++N A+A IK R  ++FVDWCP
Sbjct:    3 RDCISIHIGQAGVQMGNACWELYCLEHGIKPDGHLATHPDVTSVVDSSF---NTFFSETGSGKHVPRAIFIDLEPSVIGEPCGLRTLTVGGXLRMSMMLAGREVRSSRIWRGQKGGGRKICSRVLRRNRPQSERCTGLQGFLLFHSFGGGTGSGFTSLLMERLSADYGKKSKLEFCIYPAPQVSTAVVEPYNAILTTHTTLEHSDCSFMVDNEAIYDICRKKLDIDFPSYFNLNRLIAQMVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLTTYAPVISAEKAYHEQLSVAEITNACFEPSNQMVKCDPRNGKYMACCLLYRGDIVPKDVNTAIAIIKSRRAVRFVDWCP 353          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: tubb2 (tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GENE-050522-384])

HSP 1 Score: 218.779 bits (556), Expect = 6.067e-65
Identity = 113/336 (33.63%), Postives = 195/336 (58.04%), Query Frame = 2
Query: 1169 WELFCIEHGLDCQGNTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIF------PSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            WE+   EHG+D  G+  G+SD   +     +N+ + EA   K+VPRAI VDLEP  +D +R GP+  ++ PD  + G   A NN+A+G Y+ G ++++  ++ + K A  C+ + GF L +S GGGTGSG  +L+++ ++EE+     I  V++      PSPK++  VVEPYN+ LS    +E+ D     DNEA+++ C+  + +  PTY ++N LVS  +S +T  LRF   L+ DL     N++P+P++HF    F+P+T      ++ +T   +T  +F+  N    C+   G+Y+     +RG +  +E+++ +  ++ +++  FV+W P
Sbjct:    3 WEVISDEHGIDPTGSYHGDSDLQLER----INVYYNEASGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEY-----IIQVLYTVVASGPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIP 329          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: tubg1 (tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-836])

HSP 1 Score: 158.303 bits (399), Expect = 2.571e-42
Identity = 106/360 (29.44%), Postives = 184/360 (51.11%), Query Frame = 2
Query: 1112 KEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPD--MLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSP-KMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPI-TDYKRADHKKITTVNITYDLFNPGNQFINCNISTGK-------YMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            +EII L +GQ G QI    W+  C EHG+   G  +     +  E     ++ F +A  E ++PRA+ +DLEP VI+ I    Y NL++P+   L      A NN+A G +S G+K+  E  + + + A   +S+    L         +        + K+     +     +FP+  +M+  VV+PYNS+L+     ++ D  ++ DN A+     ++++I  P++S IN+LVS I+S+ T TLR+   +++DL+    +LIP P++HF    ++P+ TD   A  +K T +++   L  P N      +STG+       Y+A     +G V P +++++L  I++R    F+ W P
Sbjct:    3 REIITLQLGQCGNQIGFEFWKQLCAEHGISPDGILED----FATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVINSIVNSSYANLYNPENIYLSEHGGGAGNNWASG-HSQGEKIHEEIFDIIDREADGSDSLEKCPLTRRLSATNWNELCKYFCRFPKKLIQTYS-----VFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVM----VSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGP 348          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005307.1 (pep scaffold:Pmarinus_7.0:GL485425:14485:17012:-1 gene:ENSPMAG00000004835.1 transcript:ENSPMAT00000005307.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 128.642 bits (322), Expect = 2.950e-35
Identity = 61/131 (46.56%), Postives = 87/131 (66.41%), Query Frame = 2
Query: 1112 KEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKI 1489
            +E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTV+  +R G YR L+HP+ L++G EDA+NN+ARG Y++GK++++  ++++ K+
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSEKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVVGAVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKL 125          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB3 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p; TUB3 has a paralog, TUB1, that arose from the whole genome duplication [Source:SGD;Acc:S000004593])

HSP 1 Score: 328.561 bits (841), Expect = 7.648e-106
Identity = 160/351 (45.58%), Postives = 245/351 (69.80%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTK-GNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E+I ++VGQAG QI NA WEL+ +EHG+   G+ + G S     E   G +  F E    KFVPRAI VDLEP VIDE+R G ++ L+HP+ L++G EDA+NN+ARG Y+VG+++++E  E++ K+A  C+ + GF+  +S GGGTGSG  SL+L  L  E+ K +K+   ++P+P+++T+VVEPYN++L+  T++E  D   + DNEA+++ C   + I +P++SN+N L++Q++SS+T +LRF  SL+ DL  FQTNL+PYP++HFP  +++PI   KRA H+  +   IT   F PGNQ + C+ + GKYMA CL YRG V+ R++ +A+ ++K +  +Q VDWCP
Sbjct:    1 MREVISINVGQAGCQIGNACWELYSLEHGIKEDGHLEDGLSKPKGGE--EGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRTGRFKELFHPEQLINGKEDAANNYARGHYTVGREIVDEVEERIRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLENLSYEYGKKSKLEFAVYPAPQLSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVISSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKKRATHESNSVSEITNACFEPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDWCP 349          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB1 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; relative distribution to nuclear foci increases upon DNA replication stress; TUB1 has a paralog, TUB3, that arose from the whole genome duplication [Source:SGD;Acc:S000004550])

HSP 1 Score: 327.02 bits (837), Expect = 2.955e-105
Identity = 158/351 (45.01%), Postives = 246/351 (70.09%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTK-GNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E+I ++VGQAG QI NA WEL+ +EHG+   G+ + G S     E   G +  F E    KFVPRAI VDLEP VIDE+R GPY++L+HP+ L+SG EDA+NN+ARG Y+VG++++ + ++++ K+A  C+ + GF+  +S GGGTGSG  SL+L  L  E+ K +K+   ++P+P+++T+VVEPYN++L+  T++E  D   + DNEA+++ C   ++I +P+++N+N L++Q++SS+T +LRF  SL+ DL  FQTNL+PYP++HFP  ++SP+    +A H+  +   IT   F PGNQ + C+   GKYMA CL YRG V+ R++ +A+ ++K +  +Q VDWCP
Sbjct:    1 MREVISINVGQAGCQIGNACWELYSLEHGIKPDGHLEDGLSKPKGGE--EGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRNGPYKDLFHPEQLISGKEDAANNYARGHYTVGREILGDVLDRIRKLADQCDGLQGFLFTHSLGGGTGSGLGSLLLEELSAEYGKKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKRNLDIPRPSFANLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYSPVLSKSKAFHESNSVSEITNACFEPGNQMVKCDPRDGKYMATCLLYRGDVVTRDVQRAVEQVKNKKTVQLVDWCP 349          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB2 (Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules; mutation in human ortholog is associated with congenital fibrosis of the extraocular muscles (CFEOM) with polymicrogyria [Source:SGD;Acc:S000001857])

HSP 1 Score: 234.572 bits (597), Expect = 5.254e-70
Identity = 121/350 (34.57%), Postives = 200/350 (57.14%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++EII +  GQ G QI  A WE  C EHGLD  G   G+ D  K+     +N+ F EA + K+VPR+I+VDLEP  ID +R     NL+ PD  + G   A N +A+G Y+ G ++++  ++ + + A  C+S+ GF + +S GGGTGSG  +L+++ ++EEF         + PSPK +  VVEPYN+ LS    +E  D     DNEA+++ C   + + QP+Y ++N LVS ++S +T +LR+   L+ DL     NL+P+P++HF    ++P+T       + +T   +T  +F+  N     +   G+Y+     +RG V  +E+   + +++ +++  FV+W P
Sbjct:    1 MREIIHISTGQCGNQIGAAFWETICGEHGLDFNGTYHGHDDIQKER----LNVYFNEASSGKWVPRSINVDLEPGTIDAVRNSAIGNLFRPDNYIFGQSSAGNVWAKGHYTEGAELVDSVMDVIRREAEGCDSLQGFQITHSLGGGTGSGMGTLLISKIREEFPDRMMATFSVLPSPKTSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICQRTLKLNQPSYGDLNNLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTAIGSQSFRSLTVPELTQQMFDAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNSDYFVEWIP 346          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB4 (Gamma-tubulin; involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004202])

HSP 1 Score: 129.413 bits (324), Expect = 2.323e-32
Identity = 105/356 (29.49%), Postives = 181/356 (50.84%), Query Frame = 2
Query: 1115 EIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTK-GNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHP--DMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFE---SCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPIT-DYKRAD--HKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWC 2155
            EII L  GQ G  +    W     EH +   G ++  +S   +D+        F+E    KF PRAI +D EP+VI ++    +R  + P    + S    A N++A G Y +G +  ++ + ++ K     ++  GF L++S  GGTGSG  S +L  L + + K       +FP+ + +  VV+ YN+IL+    IED D  +++DN ++       +   NI      + N+L+S I+SS+T ++RF S +   +    + LIP P++HF   +F+P T DY   D  HK  ++ ++  DL +P N  ++  ++   Y        G V PR+I++A+ ++++R  I+F  W 
Sbjct:    4 EIITLQAGQCGNHVGKFLWSQLAKEHAIGTDGLSQLPDSSTERDD---DTKPFFRENSRNKFTPRAIMMDSEPSVIADVE-NTFRGFFDPRNTWVASDGASAGNSWANG-YDIGTRNQDDILNKIDKEIDSTDNFEGFQLLHSVAGGTGSGLGSNLLEALCDRYPKKILTTYSVFPA-RSSEVVVQSYNTILALRRLIEDSDATVVFDNASLLNISGKVFRNPNI---DLQHTNQLISTIISSVTNSIRFPSYMYSSMSSIYSTLIPSPELHFLSPSFTPFTSDYIHDDIAHKGHSSYDVMLDLLDPSNSLVSTAMNNPTYFNVYNTIIGNVEPRQISRAMTKLQQR--IKFPSWS 348          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO40779 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S698])

HSP 1 Score: 362.844 bits (930), Expect = 1.379e-118
Identity = 175/355 (49.30%), Postives = 254/355 (71.55%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y+VGK+ I+  +++L K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P +++AVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQ++SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A+++P+   ++A H+++T  +IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DAF----NTFFAETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEQIDIVLDRLRKLADGCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPHISSAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQLVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPMASYAPVVSAEKAYHEQLTVADITNSCFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIATIKTKKTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO44804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUT1])

HSP 1 Score: 361.688 bits (927), Expect = 4.990e-118
Identity = 174/355 (49.01%), Postives = 253/355 (71.27%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTV+DE+R G YR L+HP+ L++G EDA+NN+ARG Y+VGK++++  ++++ K+A  C  + GF++ +S+GGGTGSGFSSL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H+++T   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO38067 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY3])

HSP 1 Score: 361.303 bits (926), Expect = 5.497e-118
Identity = 174/355 (49.01%), Postives = 253/355 (71.27%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTV+DE+R G YR L+HP+ L++G EDA+NN+ARG Y+VGK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGFSSL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO38091 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY0])

HSP 1 Score: 361.303 bits (926), Expect = 6.054e-118
Identity = 174/355 (49.01%), Postives = 253/355 (71.27%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTV+DE+R G YR L+HP+ L++G EDA+NN+ARG Y+VGK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGFSSL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO40780 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S699])

HSP 1 Score: 360.918 bits (925), Expect = 8.808e-118
Identity = 173/355 (48.73%), Postives = 252/355 (70.99%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+Q+ NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+  DLEPTV+DE+R G YR L+HP+ L++G EDA+NN+ARG Y+VGK+MI+  ++++ K+A  C  + GF++ +S+GGGTGSGFSSL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H+++T   IT   F P NQ + C+   GKYMACCL +RG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFADLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEMIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITTSCFEPANQMVKCDPRHGKYMACCLLFRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000000055.2 (tubulin alpha-1C chain [Source:NCBI gene;Acc:101166777])

HSP 1 Score: 364.77 bits (935), Expect = 6.686e-119
Identity = 173/352 (49.15%), Postives = 255/352 (72.44%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN--TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+Q+ N  WEL+C+EHG+   G+  +   S  Y D F       F E    K+VPRAI VDLEPTVIDEIR GPYR L+HP+ ++SG EDA+NN+ARG Y+VGK+ I+  ++++ K++  C  + GF++ +S+GGGTGSGF+SL++  L  +F K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +P+Y+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H+++T   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A++ IK + +IQFVDWCP
Sbjct:    1 MRECISVHVGQAGVQMGNTCWELYCLEHGIQPDGHMPSAKPSGGYDDSF----TTFFSETGNSKYVPRAIFVDLEPTVIDEIRTGPYRQLFHPEQMISGKEDAANNYARGHYTVGKEHIDNVLDRIRKLSDQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDFGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNSCFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNVAISNIKTKRSIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000003572.2 (tubulin alpha chain [Source:NCBI gene;Acc:101171518])

HSP 1 Score: 360.918 bits (925), Expect = 2.021e-117
Identity = 174/355 (49.01%), Postives = 253/355 (71.27%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG Q+ NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRAI VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y+VGK++I+  +++  K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   ++P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+ QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++  +IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK R +IQFVDWCP
Sbjct:    1 MRECISMHVGQAGAQMGNACWELYCLEHGIQPDGRMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIASIKTRRSIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000033163.1 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 360.533 bits (924), Expect = 3.489e-117
Identity = 173/355 (48.73%), Postives = 255/355 (71.83%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYN+IL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK + +IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNAILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000020578.2 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 360.533 bits (924), Expect = 3.489e-117
Identity = 173/355 (48.73%), Postives = 255/355 (71.83%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTVIDE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYN+IL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++P+   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK + +IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNAILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCP 348          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000020148.2 (protein O-fucosyltransferase 2 [Source:NCBI gene;Acc:100125468])

HSP 1 Score: 360.918 bits (925), Expect = 5.538e-117
Identity = 171/352 (48.58%), Postives = 255/352 (72.44%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGL--DCQGNTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+Q+ N  WEL+C+EHG+  D Q  T+     + D F       F E   +K+VPRAI VDLEPTVIDE+R G YR L+HP+ L+SG EDA+NN+ARG Y++G+++I+  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   I+P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +P+Y+N+NRL+SQI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A ++PI   ++A H++++   IT   F P NQ + C+   GKYMACCL YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:   33 MRECISVHVGQAGVQMGNTCWELYCLEHGIQPDGQMLTQKPIGGHDDSF----TTFFSETGAKKYVPRAIFVDLEPTVIDEVRSGTYRQLFHPEQLISGKEDAANNYARGHYTIGREIIDSVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPIISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRTIQFVDWCP 380          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000005035.1 (SMESG000005035.1)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 349/350 (99.71%), Postives = 350/350 (100.00%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            +KEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINSYGGGTGSGFSSLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP
Sbjct:    1 MKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINSYGGGTGSGFSSLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 350          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000005035.1 (SMESG000005035.1)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 349/349 (100.00%), Postives = 349/349 (100.00%), Query Frame = 2
Query: 1112 KEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            KEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINSYGGGTGSGFSSLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP
Sbjct:    3 KEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINSYGGGTGSGFSSLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 351          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000057127.1 (SMESG000057127.1)

HSP 1 Score: 413.305 bits (1061), Expect = 8.440e-137
Identity = 193/350 (55.14%), Postives = 266/350 (76.00%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E++ ++VGQAGIQ++NA WELFCIEHG++C G  K     Y  + F   +  FQE  +  +VPRAI+VDLEPTVIDEIR   YRNLWHPD L++  EDA+NNFARG Y++GK +I +F+E+L K A  C+S+ GF+++NSYGGGTGSG S+LI   L  EFSK  K    I+P+P++ATA+VEPYNS+L+A   +E+ D+ +L DNEA ++ C+ K+NI +P Y+NINRL++QI S++TV++RFG+SLD+DLV  QTNLIPYP++HFP  N+SPI D  RA H+ +T   IT +LF+PGNQ I C++  GKYM+CC+ YRG + PR++N A+ +IK+R+ I FVDWCP
Sbjct:    1 MREVVCINVGQAGIQMANASWELFCIEHGIECNGKLK-----YDAQDFTSFHTFFQEVPSGNYVPRAINVDLEPTVIDEIRTASYRNLWHPDYLINCCEDAANNFARGHYTIGKSVIEKFMERLRKCAMACDSVQGFIVLNSYGGGTGSGLSALIFENLSVEFSKTAKFQQAIYPAPQLATAIVEPYNSLLTASKCMENTDVVMLIDNEATYDICFKKLNISRPGYNNINRLIAQIFSAMTVSIRFGASLDNDLVQLQTNLIPYPRIHFPTVNYSPIIDSHRAAHEGLTISEITRELFDPGNQLIRCDLRLGKYMSCCIQYRGLITPRQVNIAVYDIKRRTEINFVDWCP 345          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000071756.1 (SMESG000071756.1)

HSP 1 Score: 406.757 bits (1044), Expect = 2.135e-134
Identity = 192/349 (55.01%), Postives = 262/349 (75.07%), Query Frame = 2
Query: 1112 KEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGNTKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            KEII +++GQAG+Q+SNA WELFCIEHGLD  G  +   +    +  + +   F E +  ++VPRAI+VDLEPTVIDEIR G YR LWHP+ L++  EDASNNFARG Y+VGK +      QL K+ RDC+ +HGF+L+NS GGGTGSG +SLIL+ +  EF+K+ K+ SVI+P+P++AT++VEPYN++L    +I+  DL  L DNEAM+E C++K+ +  P Y+++NR+VSQ+ SSLTV++RFGSSLDHDL H QTNL+PYP++HFPFAN++P+      DH  +TT  IT +LF   NQ + C+++ GKYMACC+ YRG V+PR +N AL EIKKR +I+FV+WCP
Sbjct:    3 KEIICINIGQAGVQMSNACWELFCIEHGLDTGGFPRTKHELKDVDSTSDIAAFFHETNIGRYVPRAINVDLEPTVIDEIRSGVYRTLWHPNCLITSNEDASNNFARGRYTVGKTIAKRLFTQLIKMVRDCHQLHGFILMNSLGGGTGSGLTSLILDKISIEFAKHPKVSSVIYPAPQLATSIVEPYNAVLGTSATIDQSDLVFLCDNEAMYEICHDKLKLSLPQYTHLNRVVSQLFSSLTVSIRFGSSLDHDLSHLQTNLVPYPRIHFPFANYAPLFHQDFNDHDTLTTSQITRELFEETNQLVKCDVTVGKYMACCVQYRGLVVPRTVNVALLEIKKRQDIKFVEWCP 351          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000009951.1 (SMESG000009951.1)

HSP 1 Score: 359.762 bits (922), Expect = 5.172e-117
Identity = 171/355 (48.17%), Postives = 253/355 (71.27%), Query Frame = 2
Query: 1109 IKEIIFLHVGQAGIQISNAQWELFCIEHGLDCQGN-----TKGNSDFYKDEFFAGVNIIFQEAHTEKFVPRAISVDLEPTVIDEIRLGPYRNLWHPDMLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINXXXXXXXXXXXXLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILSAVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTVTLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVNITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSNIQFVDWCP 2158
            ++E I +HVGQAG+QI NA WEL+C+EHG+   G      T G  D   D F    N  F E    K VPRA+ VDLEPTV+DE+R G YR L+HP+ L++G EDA+NN+ARG Y++GK++++  ++++ K+A  C  + GF++ +S+GGGTGSGF+SL++  L  ++ K +K+   ++P+P+++TAVVEPYNSIL+  T++E  D A + DNEA+++ C   ++I +PTY+N+NRLV QI+SS+T +LRF  +L+ DL  FQTNL+PYP++HFP A F+P+   ++A H++++   IT   F P NQ + C+   GKYMACC+ YRG V+P+++N A+A IK +  IQFVDWCP
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGD---DSF----NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSVYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLVGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATFAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCP 348          
The following BLAST results are available for this feature:
BLAST of Tubulin alpha chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBA1C6.574e-11849.30tubulin alpha 1c [Source:HGNC Symbol;Acc:HGNC:2076... [more]
TUBA1B2.536e-11749.01tubulin alpha 1b [Source:HGNC Symbol;Acc:HGNC:1880... [more]
TUBA1A1.066e-11648.73tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:2076... [more]
TUBA1A1.066e-11648.73tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:2076... [more]
TUBA3C1.255e-11647.89tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tba-63.825e-11547.28Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
tba-91.649e-11446.15Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
mec-127.811e-11447.01Tubulin alpha-3 chain Detyrosinated tubulin alpha-... [more]
tba-22.304e-11346.00Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
tba-22.304e-11346.00Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alphaTub84B3.295e-11647.61gene:FBgn0003884 transcript:FBtr0081639[more]
alphaTub85E4.172e-11647.61gene:FBgn0003886 transcript:FBtr0082087[more]
alphaTub84D1.808e-11447.04gene:FBgn0003885 transcript:FBtr0081538[more]
alphaTub67C2.538e-10543.73gene:FBgn0087040 transcript:FBtr0076393[more]
CG77942.307e-8941.03gene:FBgn0038565 transcript:FBtr0083540[more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tuba1c1.010e-11749.01tubulin, alpha 1c [Source:ZFIN;Acc:ZDB-GENE-061114... [more]
tuba8l1.778e-11749.00tubulin, alpha 8 like [Source:ZFIN;Acc:ZDB-GENE-03... [more]
tuba1c2.086e-11749.01tubulin, alpha 1c [Source:ZFIN;Acc:ZDB-GENE-061114... [more]
tuba8l24.868e-11748.30tubulin, alpha 8 like 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
si:ch73-199e17.15.778e-11748.43si:ch73-199e17.1 [Source:ZFIN;Acc:ZDB-GENE-100921-... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tuba1c5.709e-11849.01tubulin alpha 1c [Source:NCBI gene;Acc:394675][more]
tuba1b2.299e-11749.01tubulin alpha 4a [Source:NCBI gene;Acc:100038108][more]
tuba1b2.299e-11749.01tubulin alpha 4a [Source:NCBI gene;Acc:100038108][more]
tuba1b2.299e-11749.01tubulin alpha 4a [Source:NCBI gene;Acc:100038108][more]
tuba1b2.299e-11749.01tubulin alpha 4a [Source:NCBI gene;Acc:100038108][more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tuba1c4.324e-11849.30tubulin, alpha 1C [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba1b1.741e-11749.01tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:10780... [more]
Tuba1a7.318e-11748.73tubulin, alpha 1A [Source:MGI Symbol;Acc:MGI:98869... [more]
Tuba4a1.252e-11648.73tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba3a2.854e-11647.89tubulin, alpha 3A [Source:MGI Symbol;Acc:MGI:10954... [more]
back to top
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P08537|TBA_XENLA7.586e-11849.30Tubulin alpha chain OS=Xenopus laevis OX=8355 GN=t... [more]
sp|P68373|TBA1C_MOUSE3.025e-11749.30Tubulin alpha-1C chain OS=Mus musculus OX=10090 GN... [more]
sp|P68365|TBA1C_CRIGR3.025e-11749.30Tubulin alpha-1C chain OS=Cricetulus griseus OX=10... [more]
sp|Q6AYZ1|TBA1C_RAT3.057e-11749.30Tubulin alpha-1C chain OS=Rattus norvegicus OX=101... [more]
sp|Q9BQE3|TBA1C_HUMAN3.157e-11749.30Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=... [more]
back to top
BLAST of Tubulin alpha chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A7M6D92.062e-12752.86Tubulin alpha chain OS=Dugesia ryukyuensis OX=7973... [more]
A0A0N5A2I74.560e-11848.43Tubulin alpha chain OS=Parastrongyloides trichosur... [more]
A0A0K0FUG82.533e-11748.01Tubulin alpha chain OS=Strongyloides venezuelensis... [more]
A0A0N5BAF33.046e-11748.15Tubulin alpha chain OS=Strongyloides papillosus OX... [more]
A0A090MZ673.249e-11748.43Tubulin alpha chain OS=Strongyloides ratti OX=3450... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-199e17.11.256e-11748.86tubulin alpha chain-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000030346.11.768e-11749.01tubulin alpha-1B chain [Source:NCBI gene;Acc:11119... [more]
tuba8l24.125e-11748.58tubulin alpha chain-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000049713.14.841e-11748.73tubulin alpha-1A chain [Source:NCBI gene;Acc:10304... [more]
ENSAMXT00000042562.18.275e-11749.01tubulin alpha chain [Source:NCBI gene;Acc:10303831... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBA3C1.393e-11847.89tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
ENSPMAT00000001139.14.153e-9341.53pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 g... [more]
tubb26.067e-6533.63tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GE... [more]
tubg12.571e-4229.44tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
ENSPMAT00000005307.12.950e-3546.56pep scaffold:Pmarinus_7.0:GL485425:14485:17012:-1 ... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
TUB37.648e-10645.58Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB12.955e-10545.01Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB25.254e-7034.57Beta-tubulin; associates with alpha-tubulin (Tub1p... [more]
TUB42.323e-3229.49Gamma-tubulin; involved in nucleating microtubules... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO407791.379e-11849.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448044.990e-11849.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380675.497e-11849.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380916.054e-11849.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407808.808e-11848.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000000055.26.686e-11949.15tubulin alpha-1C chain [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000003572.22.021e-11749.01tubulin alpha chain [Source:NCBI gene;Acc:10117151... [more]
ENSORLT00000033163.13.489e-11748.73tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
ENSORLT00000020578.23.489e-11748.73tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
ENSORLT00000020148.25.538e-11748.58protein O-fucosyltransferase 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Tubulin alpha chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005035.10.000e+099.71SMESG000005035.1[more]
SMESG000005035.10.000e+0100.00SMESG000005035.1[more]
SMESG000057127.18.440e-13755.14SMESG000057127.1[more]
SMESG000071756.12.135e-13455.01SMESG000071756.1[more]
SMESG000009951.15.172e-11748.17SMESG000009951.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034324 ID=SMED30034324|Name=Tubulin alpha chain|organism=Schmidtea mediterranea sexual|type=transcript|length=2158bp
ATTTAGTGACACTAATGATTTATAAATTTAAATATAATTATGTACTATGA
GATTATATAAAAATTTTAAATAATATTTACGTTAACTAAATGTTTTTAAC
TAAATTTATGTTTTTACATAAATAAATTATTCAAATTTAATACTCTAGAA
AGAACTCCAGACCCCTAATTAACTTGAATAAATAAGTAAAATTTAAGTTA
AATTATCTGAAATGCCAAGTAGCAGACCTTAAGGTTCAATTCGAAATTCT
GGATTCTGTTGAACTTAGGCGTATTATAGTTAAAATTAATTTTAATGAGG
ATATTGGGGAATTGAAATTAGTATCGAGATGTATGATACATGATTTTGAG
TTAAAACAAACTACCTGTTCCTGGAATATGGTGAATGTGACTAATAGTAT
GCCAGTGTGTTGAATATGTGGAATGATTATATATATATATCTATTTCTTT
TATTTATGATTTCAGGAATGACAGATAGAAAAACCAGTCTAAAGAAAATT
ATAGTTCCCAAGCGGAAGTTGGCACTTTTTAAACGATTCATGAGGACTCA
AGGTTACTTAATTATGACATTAAAAGACAATAAATGGCTGGTCCATCGCT
ACGATCTCGAAACACTGGAAATGATACAACAGGAAATTCAACGTCAATAT
ATCGACGCCGTGAATCACCTTATACATGTTGAAGAATTAATTGCAAGTGG
GGTAATCCCGGACTACGACATCTACCCCGACACAAATCCAGTGGATCAGA
AATTGAATCCCGATGATCCGTCCAAATCCTCCGATACGATCCAGTAGGTA
GATCTAATCGGAATTTAATATTGTAGCATGACAAAATTAGTGTATTTTTC
ATCTGAAATATTAATTCGTCTTATATTATTTTCTATTTTGGAGGCATGTG
AATGATAAGTGAGAATGGTTGTAGAGAGGATGAGAGCGTGACCGGGGAAA
TAGGAGTGAAATGCCCTTCCACAGTTCAAACTAATTATATATACTTGAAT
CACAATAAATTCTCTGAACTATTAATATCAGCTGTAATTCAATGGAACAA
TCAATCACAAGCTGACCTATCCTAGAGACAAATTCCAGTGAAGGATGGAG
CGCATCAAATTAAAGAAATCATATTTTTGCATGTCGGCCAAGCCGGAATA
CAAATTAGTAATGCACAATGGGAATTATTCTGTATCGAACACGGTTTAGA
CTGTCAAGGAAATACGAAAGGGAATTCTGATTTTTATAAAGACGAATTCT
TTGCCGGAGTGAATATTATATTTCAAGAAGCTCATACAGAAAAGTTTGTT
CCAAGAGCTATAAGTGTAGATCTTGAGCCGACTGTTATAGATGAAATACG
TTTGGGACCCTATAGAAATTTATGGCATCCAGATATGTTAATGAGCGGTT
TGGAAGATGCTTCGAATAATTTTGCTAGGGGGTTTTATTCTGTCGGTAAA
AAAATGATTAACGAGTTTATTGAACAGCTGACGAAAATTGCCCGTGATTG
TAATAGTATTCATGGTTTTGTTTTAATCAATAGTTATGGCGGTGGCACTG
GATCTGGATTTTCAAGTTTAATTTTAAATTATCTGAAAGAAGAATTTTCA
AAGAACACAAAAATTGGAAGTGTTATTTTTCCATCTCCTAAAATGGCTAC
AGCTGTTGTTGAACCATATAATTCAATTTTATCGGCAGTTACTTCCATTG
AAGATATAGATCTTGCCTTACTTTACGACAATGAAGCTATGTTTGAAAGC
TGTTATAATAAGATAAATATTTTCCAACCAACATACTCGAATATAAATAG
ATTGGTATCTCAGATTTTGAGTTCATTAACAGTTACTCTTAGATTCGGAT
CATCTCTCGATCATGATTTAGTACACTTTCAAACTAATCTAATTCCCTAT
CCAAAAATGCATTTTCCATTCGCAAACTTCTCACCGATAACTGATTATAA
ACGAGCAGATCATAAGAAAATCACAACAGTTAATATAACTTATGACCTTT
TCAATCCAGGAAATCAGTTTATTAACTGTAATATTAGCACTGGCAAGTAT
ATGGCATGTTGCCTACACTATCGCGGAGCAGTGCTTCCTAGAGAGATAAA
CCAAGCTCTTGCAGAAATTAAAAAACGGTCAAATATACAATTTGTAGATT
GGTGTCCT
back to top

protein sequence of SMED30034324-orf-1

>SMED30034324-orf-1 ID=SMED30034324-orf-1|Name=SMED30034324-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=125bp
MIIYIYLFLLFMISGMTDRKTSLKKIIVPKRKLALFKRFMRTQGYLIMTL
KDNKWLVHRYDLETLEMIQQEIQRQYIDAVNHLIHVEELIASGVIPDYDI
YPDTNPVDQKLNPDDPSKSSDTIQ*
back to top

protein sequence of SMED30034324-orf-2

>SMED30034324-orf-2 ID=SMED30034324-orf-2|Name=SMED30034324-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=258bp
MLMSGLEDASNNFARGFYSVGKKMINEFIEQLTKIARDCNSIHGFVLINS
YGGGTGSGFSSLILNYLKEEFSKNTKIGSVIFPSPKMATAVVEPYNSILS
AVTSIEDIDLALLYDNEAMFESCYNKINIFQPTYSNINRLVSQILSSLTV
TLRFGSSLDHDLVHFQTNLIPYPKMHFPFANFSPITDYKRADHKKITTVN
ITYDLFNPGNQFINCNISTGKYMACCLHYRGAVLPREINQALAEIKKRSN
IQFVDWCP
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR037103Tubulin/FtsZ_C_sf
IPR036525Tubulin/FtsZ_GTPase_sf
IPR000217Tubulin
IPR002452Alpha_tubulin
IPR003008Tubulin_FtsZ_GTPase
IPR018316Tubulin/FtsZ_2-layer-sand-dom
IPR017975Tubulin_CS
IPR008280Tub_FtsZ_C
Vocabulary: molecular function
TermDefinition
GO:0005200structural constituent of cytoskeleton
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
GO:0007010cytoskeleton organization
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
GO:0005737cytoplasm
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000217TubulinPRINTSPR01161TUBULINcoord: 63..84
score: 23.71
coord: 18..42
score: 22.4
coord: 88..101
score: 63.14
coord: 44..62
score: 61.35
coord: 5..16
score: 59.16
coord: 102..122
score: 30.07
IPR000217TubulinPANTHERPTHR11588TUBULINcoord: 2..257
IPR002452Alpha tubulinPRINTSPR01162ALPHATUBULINcoord: 231..252
score: 43.01
coord: 184..199
score: 21.22
coord: 58..70
score: 38.59
coord: 124..136
score: 35.62
coord: 71..82
score: 23.32
IPR003008Tubulin/FtsZ, GTPase domainSMARTSM00864Tubulin_4coord: 1..156
e-value: 3.4E-12
score: 56.5
IPR003008Tubulin/FtsZ, GTPase domainPFAMPF00091Tubulincoord: 3..123
e-value: 3.1E-31
score: 109.1
IPR037103Tubulin/FtsZ, C-terminal domain superfamilyGENE3DG3DSA:3.30.1330.20coord: 179..257
e-value: 3.1E-25
score: 90.2
IPR018316Tubulin/FtsZ, 2-layer sandwich domainPFAMPF03953Tubulin_Ccoord: 173..257
e-value: 9.7E-24
score: 83.9
IPR036525Tubulin/FtsZ, GTPase domain superfamilyGENE3DG3DSA:3.40.50.1440coord: 1..178
e-value: 8.8E-57
score: 194.5
IPR036525Tubulin/FtsZ, GTPase domain superfamilySUPERFAMILYSSF52490Tubulin nucleotide-binding domain-likecoord: 4..154
NoneNo IPR availablePANTHERPTHR11588:SF304AT04270P-RELATEDcoord: 2..257
IPR017975Tubulin, conserved sitePROSITEPS00227TUBULINcoord: 52..58
IPR008280Tubulin/FtsZ, C-terminalSUPERFAMILYSSF55307Tubulin C-terminal domain-likecoord: 158..257