Adenylyl cyclase-associated protein

Overview
NameAdenylyl cyclase-associated protein
Smed IDSMED30034315
Length (bp)1568
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Adenylyl cyclase-associated protein (SMED30034315) t-SNE clustered cells

Violin plots show distribution of expression levels for Adenylyl cyclase-associated protein (SMED30034315) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Adenylyl cyclase-associated protein (SMED30034315) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Adenylyl cyclase-associated protein (SMED30034315) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034315

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30034315SMESG000065082.1 Contig5150GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30034315SMESG000065082.1 Contig5150GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30034315SMESG000032321.1 Contig5150GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30034315SMESG000032321.1 Contig5150GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30034315SMESG000032321.1 dd_Smed_v4_727_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034315SMESG000032321.1 dd_Smed_v4_727_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30034315SMESG000032321.1 dd_Smed_v4_727_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034315SMESG000032321.1 dd_Smed_v6_727_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034315SMESG000032321.1 dd_Smed_v4_727_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Human
Match: CAP2 (cyclase associated actin cytoskeleton regulatory protein 2 [Source:HGNC Symbol;Acc:HGNC:20039])

HSP 1 Score: 388.267 bits (996), Expect = 4.811e-130
Identity = 209/481 (43.45%), Postives = 298/481 (61.95%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQLSES--GDMKSVKSNSSSVA--INEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXXXXX-----------SNDG----SADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAG---------STVPAKTKPEVAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSCA 1435
             +++ LV+RLE   SRLE L   S    G+   V    + VA  +  +  L+ S +  FL+ S  + GDV+T A +V  AF AQ  FL   +   +P ++ +  LLKPIS+ I  I  FRE NR S  FNHLSAVSE IP LGW+ VSP P P+VKEM DA+ FYTNRV+KD+K  ++ HVDW K+++ ++++LQA++K+H+TTGLTWS  G +   ++        P    P P            N+G    S+ +  ALF+++N+G  +T GL+ VTDD KT+KNP+LRA          S  P+ T P    K    QK  P     + L+G KW VEY  ++ D+V+S+T +KQ  YIFKC+ S I +KGK+NSI++DNC K  LVFD ++  ++++N + +Q Q +G +PT++I+KT+G  IYLS+++L  EIVSAKSSEMNI++P +DG+  E  +PEQFKT   G KL+T  A
Sbjct:    2 ANMQGLVERLERAVSRLESLSAESHRPPGNCGEVNGVIAGVAPSVEAFDKLMDSMVAEFLKNSRILAGDVETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRGSNMFNHLSAVSESIPALGWIAVSPKPGPYVKEMNDAATFYTNRVLKDYKHSDLRHVDWVKSYLNIWSELQAYIKEHHTTGLTWSKTGPVASTVSAFSVLSSGPGLPPPPPPLPPPGPPPLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHVTDDQKTYKNPSLRAQGGQTQSPTKSHTPSPTSP----KSYPSQKHAP----VLELEGKKWRVEYQEDRNDLVISETELKQVAYIFKCEKSTIQIKGKVNSIIIDNCKKLGLVFDNVVGIVEVINSQDIQIQVMGRVPTISINKTEGCHIYLSEDALDCEIVSAKSSEMNILIP-QDGDYREFPIPEQFKTAWDGSKLITEPA 473          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Human
Match: CAP1 (cyclase associated actin cytoskeleton regulatory protein 1 [Source:HGNC Symbol;Acc:HGNC:20040])

HSP 1 Score: 382.874 bits (982), Expect = 6.574e-128
Identity = 210/471 (44.59%), Postives = 297/471 (63.06%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVA-----INEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXX-----------XXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGS-TVPAKTKPEVAVKPGHG---QKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTS 1429
             D++NLV+RLE    RLE +   S + DM    ++S S A     +  + +LL+  +  +L+IS +IGGDV+  A +V      +   L   + C +PA++ L  LL PIS+ I  +  FRE NR S+ FNHLSAVSE I  LGWV ++P P P+VKEM DA+ FYTNRV+K++K+ +  HVDW KA+++++T+LQA++K+ +TTGL WS  G + K                PP P PPPP     S    + +  +LF++IN+G  +T  LK V+DDMKTHKNP L+A S  V +  KP  A KP      +++T  +PA + L+G KW VE   N  ++V+ DT +KQ  YI+KC N+ + +KGKINSI +DNC K  LVFD ++  ++I+N K V+ Q +G +PT++I+KTDG   YLSK SL  EIVSAKSSEMN+++P E G+  E  +PEQFKT   G KLVT+
Sbjct:    2 ADMQNLVERLERAVGRLEAV---SHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREKNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSCPPPPPPCPPPPPVSTISCSYESASRSSLFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTT 469          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Human
Match: CAP1 (cyclase associated actin cytoskeleton regulatory protein 1 [Source:HGNC Symbol;Acc:HGNC:20040])

HSP 1 Score: 382.874 bits (982), Expect = 6.574e-128
Identity = 210/471 (44.59%), Postives = 297/471 (63.06%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVA-----INEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXX-----------XXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGS-TVPAKTKPEVAVKPGHG---QKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTS 1429
             D++NLV+RLE    RLE +   S + DM    ++S S A     +  + +LL+  +  +L+IS +IGGDV+  A +V      +   L   + C +PA++ L  LL PIS+ I  +  FRE NR S+ FNHLSAVSE I  LGWV ++P P P+VKEM DA+ FYTNRV+K++K+ +  HVDW KA+++++T+LQA++K+ +TTGL WS  G + K                PP P PPPP     S    + +  +LF++IN+G  +T  LK V+DDMKTHKNP L+A S  V +  KP  A KP      +++T  +PA + L+G KW VE   N  ++V+ DT +KQ  YI+KC N+ + +KGKINSI +DNC K  LVFD ++  ++I+N K V+ Q +G +PT++I+KTDG   YLSK SL  EIVSAKSSEMN+++P E G+  E  +PEQFKT   G KLVT+
Sbjct:    2 ADMQNLVERLERAVGRLEAV---SHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREKNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSCPPPPPPCPPPPPVSTISCSYESASRSSLFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTT 469          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Human
Match: CAP1 (cyclase associated actin cytoskeleton regulatory protein 1 [Source:HGNC Symbol;Acc:HGNC:20040])

HSP 1 Score: 382.874 bits (982), Expect = 6.574e-128
Identity = 210/471 (44.59%), Postives = 297/471 (63.06%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVA-----INEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXX-----------XXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGS-TVPAKTKPEVAVKPGHG---QKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTS 1429
             D++NLV+RLE    RLE +   S + DM    ++S S A     +  + +LL+  +  +L+IS +IGGDV+  A +V      +   L   + C +PA++ L  LL PIS+ I  +  FRE NR S+ FNHLSAVSE I  LGWV ++P P P+VKEM DA+ FYTNRV+K++K+ +  HVDW KA+++++T+LQA++K+ +TTGL WS  G + K                PP P PPPP     S    + +  +LF++IN+G  +T  LK V+DDMKTHKNP L+A S  V +  KP  A KP      +++T  +PA + L+G KW VE   N  ++V+ DT +KQ  YI+KC N+ + +KGKINSI +DNC K  LVFD ++  ++I+N K V+ Q +G +PT++I+KTDG   YLSK SL  EIVSAKSSEMN+++P E G+  E  +PEQFKT   G KLVT+
Sbjct:    2 ADMQNLVERLERAVGRLEAV---SHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREKNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSCPPPPPPCPPPPPVSTISCSYESASRSSLFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTT 469          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Human
Match: CAP1 (cyclase associated actin cytoskeleton regulatory protein 1 [Source:HGNC Symbol;Acc:HGNC:20040])

HSP 1 Score: 381.719 bits (979), Expect = 1.762e-127
Identity = 210/470 (44.68%), Postives = 295/470 (62.77%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYA----NLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXX-----------XXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGS-TVPAKTKPEVAVKPGHG---QKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTS 1429
             D++NLV+RLE    RLE    +S + DM    ++S S     Y     +LL+  +  +L+IS +IGGDV+  A +V      +   L   + C +PA++ L  LL PIS+ I  +  FRE NR S+ FNHLSAVSE I  LGWV ++P P P+VKEM DA+ FYTNRV+K++K+ +  HVDW KA+++++T+LQA++K+ +TTGL WS  G + K                PP P PPPP     S    + +  +LF++IN+G  +T  LK V+DDMKTHKNP L+A S  V +  KP  A KP      +++T  +PA + L+G KW VE   N  ++V+ DT +KQ  YI+KC N+ + +KGKINSI +DNC K  LVFD ++  ++I+N K V+ Q +G +PT++I+KTDG   YLSK SL  EIVSAKSSEMN+++P E G+  E  +PEQFKT   G KLVT+
Sbjct:    2 ADMQNLVERLERAVGRLE---AVSHTSDMHRGYADSPSKGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREKNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSCPPPPPPCPPPPPVSTISCSYESASRSSLFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTT 468          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Celegans
Match: cas-1 (Adenylyl cyclase-associated protein [Source:UniProtKB/TrEMBL;Acc:H2L023])

HSP 1 Score: 345.125 bits (884), Expect = 2.564e-113
Identity = 195/485 (40.21%), Postives = 279/485 (57.53%), Query Frame = 2
Query:   86 ENLVKRLETLTSRLEKL----PQLS----------ESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTW-SGEGSXXXXXXXXXXXXXXXXXXXXXXSN----------------------DGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVV-PKEDGEIIEMALPEQFKTKIVGGKLVT 1426
            E+ +KRLE++TSRLE +    P L+           S    +  S      +  Y + +   L ++ +++D++GGD+      V   F++   +L       +P+    Q +L P+ + +G I NF+++ R++  +NHL++V+E +P LGWV V   P P+VKE  +A+QFY N ++++FKE +  HV+WTKAW AVF ++Q FV++ +TTGL W S  G+ P      P A  P  P  P                          D    +  ALF+ +N+G GVTS LKKVT DM+THKNPNLR  + VPA    +    P          P +   +G +W VEYF N  +IVL     KQT+YI++C+NSVI V GK NSI +D C K+++VFD L++  + VNC+SVQ QTLG LPT++I KTDG Q+YLSK + G EIV++KSSEMNI V   +DG+  E  +PEQFKT  V GKLVT
Sbjct:    5 EDFLKRLESVTSRLEAIAGQKPALAPKPTNLGGPSASAAASAGDSGEVPAHVRAYDDAIEEPLANWSKLTDQLGGDLAAVKPKVLAMFASMRNYLWSAAGKSEPSAEEAQKMLTPVINLLGEINNFKDTKRKTPHWNHLNSVAEALPALGWVTVKKTPAPYVKEFIEAAQFYINPILREFKETDPRHVEWTKAWKAVFEEMQKFVRQVHTTGLVWNSAPGAAPDASASAPSAAAPSAPKAPAGPGGPPPPPPPPPADFFANIAPPPVDADKASRDALFASLNQGEGVTSRLKKVTADMQTHKNPNLRGTAVVPAAGASQGGSSPAKPAAPVRKPPHKELENGKQWIVEYFVNDPNIVLDVADKKQTVYIYRCENSVIKVNGKANSITLDGCKKTSVVFDALVAQCETVNCQSVQIQTLGELPTLSIQKTDGCQVYLSKVAQGCEIVTSKSSEMNISVQTNDDGDYSEFPVPEQFKTTFVNGKLVT 489          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Celegans
Match: cas-1 (Adenylyl cyclase-associated protein [Source:UniProtKB/TrEMBL;Acc:H2L023])

HSP 1 Score: 345.125 bits (884), Expect = 2.564e-113
Identity = 195/485 (40.21%), Postives = 279/485 (57.53%), Query Frame = 2
Query:   86 ENLVKRLETLTSRLEKL----PQLS----------ESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTW-SGEGSXXXXXXXXXXXXXXXXXXXXXXSN----------------------DGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVV-PKEDGEIIEMALPEQFKTKIVGGKLVT 1426
            E+ +KRLE++TSRLE +    P L+           S    +  S      +  Y + +   L ++ +++D++GGD+      V   F++   +L       +P+    Q +L P+ + +G I NF+++ R++  +NHL++V+E +P LGWV V   P P+VKE  +A+QFY N ++++FKE +  HV+WTKAW AVF ++Q FV++ +TTGL W S  G+ P      P A  P  P  P                          D    +  ALF+ +N+G GVTS LKKVT DM+THKNPNLR  + VPA    +    P          P +   +G +W VEYF N  +IVL     KQT+YI++C+NSVI V GK NSI +D C K+++VFD L++  + VNC+SVQ QTLG LPT++I KTDG Q+YLSK + G EIV++KSSEMNI V   +DG+  E  +PEQFKT  V GKLVT
Sbjct:    5 EDFLKRLESVTSRLEAIAGQKPALAPKPTNLGGPSASAAASAGDSGEVPAHVRAYDDAIEEPLANWSKLTDQLGGDLAAVKPKVLAMFASMRNYLWSAAGKSEPSAEEAQKMLTPVINLLGEINNFKDTKRKTPHWNHLNSVAEALPALGWVTVKKTPAPYVKEFIEAAQFYINPILREFKETDPRHVEWTKAWKAVFEEMQKFVRQVHTTGLVWNSAPGAAPDASASAPSAAAPSAPKAPAGPGGPPPPPPPPPADFFANIAPPPVDADKASRDALFASLNQGEGVTSRLKKVTADMQTHKNPNLRGTAVVPAAGASQGGSSPAKPAAPVRKPPHKELENGKQWIVEYFVNDPNIVLDVADKKQTVYIYRCENSVIKVNGKANSITLDGCKKTSVVFDALVAQCETVNCQSVQIQTLGELPTLSIQKTDGCQVYLSKVAQGCEIVTSKSSEMNISVQTNDDGDYSEFPVPEQFKTTFVNGKLVT 489          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Celegans
Match: cas-1 (Adenylyl cyclase-associated protein [Source:UniProtKB/TrEMBL;Acc:H2L023])

HSP 1 Score: 336.65 bits (862), Expect = 2.812e-103
Identity = 184/437 (42.11%), Postives = 262/437 (59.95%), Query Frame = 2
Query:  197 INEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTW-SGEGSXXXXXXXXXXXXXXXXXXXXXXSN----------------------DGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPE---VAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVP-KEDGEIIEMALPEQFKTKIVGGKLVT 1426
            +  Y + +   L ++ +++D++GGD+      V   F++   +L       +P+    Q +L P+ + +G I NF+++ R++  +NHL++V+E +P LGWV V   P P+VKE  +A+QFY N ++++FKE +  HV+WTKAW AVF ++Q FV++ +TTGL W S  G+ P      P A  P  P  P                          D    +  ALF+ +N+G GVTS LKKVT DM+THKNPNLR  + VPA    +      KP    +  P+K  E   +G +W VEYF N  +IVL     KQT+YI++C+NSVI V GK NSI +D C K+++VFD L++  + VNC+SVQ QTLG LPT++I KTDG Q+YLSK + G EIV++KSSEMNI V   +DG+  E  +PEQFKT  V GKLVT
Sbjct:  817 VRAYDDAIEEPLANWSKLTDQLGGDLAAVKPKVLAMFASMRNYLWSAAGKSEPSAEEAQKMLTPVINLLGEINNFKDTKRKTPHWNHLNSVAEALPALGWVTVKKTPAPYVKEFIEAAQFYINPILREFKETDPRHVEWTKAWKAVFEEMQKFVRQVHTTGLVWNSAPGAAPDASASAPSAAAPSAPKAPAGPGGPPPPPPPPPADFFANIAPPPVDADKASRDALFASLNQGEGVTSRLKKVTADMQTHKNPNLRGTAVVPAAGASQGGSSPAKPAAPVRKPPHKELE---NGKQWIVEYFVNDPNIVLDVADKKQTVYIYRCENSVIKVNGKANSITLDGCKKTSVVFDALVAQCETVNCQSVQIQTLGELPTLSIQKTDGCQVYLSKVAQGCEIVTSKSSEMNISVQTNDDGDYSEFPVPEQFKTTFVNGKLVT 1250          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Celegans
Match: cas-2 (Adenylyl cyclase-associated protein [Source:UniProtKB/TrEMBL;Acc:A0A061ACX4])

HSP 1 Score: 292.738 bits (748), Expect = 1.807e-93
Identity = 181/454 (39.87%), Postives = 259/454 (57.05%), Query Frame = 2
Query:   92 LVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCG-KPADS-ALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGE-GSXXXXXXXXXXXXXXXXXXXXXXSNDGSADTHL--ALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTPNKPAEMRL--DGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDG--EIIEMALPEQFKTKIVGGKLVT 1426
            +V RLE + +R E +  L    + K    +++   IN Y + +   L  F  +S KIGGD+     +    F     FL     CG K AD+     L+  +S  I + ++F+E NR+SEF+NH+  +   +   GWV     P PF+K+  D S FY NR++ + K KN  H +W K+   +   L  +V++H+TTGL W+ + G+ P        AP PPPP  P  S    +      AL   +N G   TS LKKVT +M+THKNP LR  +    +   E  V     +   P K  E  +  DG  W V++    K+ V+  T  K+++YI+KC++S+I +KGK N+I +D C K+++VFDGL++  +I+NC+S+Q QTLG LPTV+I KTDG  IYLS+++L A+IV++KSSEMNI    EDG  E  EMALPEQF TKIVG KLVT
Sbjct:    5 VVSRLENVANRTENI-LLKYDSNKKETPVDATPQIINLYDDAICENLVSFYDLSAKIGGDLNRLGCMTRSLFFTHRYFL--WIACGRKKADNDEFATLVNDLSKEIVAFSDFKEKNRKSEFYNHICGLEAAVGGFGWVAEPKTPAPFIKDAIDTSVFYLNRILMEHKGKNDFHSEWAKSIKELMLSLHEYVRQHHTTGLVWNSDPGATPMCNRKSGGAPTPPPPPPPPISLIAPSKPSGVGALLESLNTGLSATSRLKKVTPEMQTHKNPVLREVNGQMNRKTEERKV----SENKKPEKIHESSIFWDGKIWKVDHQVGNKNAVVEVTDKKESIYIYKCNDSIIKIKGKANAITLDGCRKTSVVFDGLVAQCEIINCQSIQIQTLGELPTVSIQKTDGCHIYLSRDALNAQIVASKSSEMNISAMLEDGDDEYTEMALPEQFMTKIVGKKLVT 451          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Celegans
Match: cas-2 (Adenylyl cyclase-associated protein [Source:UniProtKB/TrEMBL;Acc:A0A061ACX4])

HSP 1 Score: 292.738 bits (748), Expect = 1.807e-93
Identity = 181/454 (39.87%), Postives = 259/454 (57.05%), Query Frame = 2
Query:   92 LVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCG-KPADS-ALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGE-GSXXXXXXXXXXXXXXXXXXXXXXSNDGSADTHL--ALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTPNKPAEMRL--DGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDG--EIIEMALPEQFKTKIVGGKLVT 1426
            +V RLE + +R E +  L    + K    +++   IN Y + +   L  F  +S KIGGD+     +    F     FL     CG K AD+     L+  +S  I + ++F+E NR+SEF+NH+  +   +   GWV     P PF+K+  D S FY NR++ + K KN  H +W K+   +   L  +V++H+TTGL W+ + G+ P        AP PPPP  P  S    +      AL   +N G   TS LKKVT +M+THKNP LR  +    +   E  V     +   P K  E  +  DG  W V++    K+ V+  T  K+++YI+KC++S+I +KGK N+I +D C K+++VFDGL++  +I+NC+S+Q QTLG LPTV+I KTDG  IYLS+++L A+IV++KSSEMNI    EDG  E  EMALPEQF TKIVG KLVT
Sbjct:    5 VVSRLENVANRTENI-LLKYDSNKKETPVDATPQIINLYDDAICENLVSFYDLSAKIGGDLNRLGCMTRSLFFTHRYFL--WIACGRKKADNDEFATLVNDLSKEIVAFSDFKEKNRKSEFYNHICGLEAAVGGFGWVAEPKTPAPFIKDAIDTSVFYLNRILMEHKGKNDFHSEWAKSIKELMLSLHEYVRQHHTTGLVWNSDPGATPMCNRKSGGAPTPPPPPPPPISLIAPSKPSGVGALLESLNTGLSATSRLKKVTPEMQTHKNPVLREVNGQMNRKTEERKV----SENKKPEKIHESSIFWDGKIWKVDHQVGNKNAVVEVTDKKESIYIYKCNDSIIKIKGKANAITLDGCRKTSVVFDGLVAQCEIINCQSIQIQTLGELPTVSIQKTDGCHIYLSRDALNAQIVASKSSEMNISAMLEDGDDEYTEMALPEQFMTKIVGKKLVT 451          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Fly
Match: capt (gene:FBgn0261458 transcript:FBtr0100022)

HSP 1 Score: 388.267 bits (996), Expect = 5.212e-131
Identity = 197/420 (46.90%), Postives = 278/420 (66.19%), Query Frame = 2
Query:  191 VAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXX-----XXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVA-VKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSC 1432
            +++  + ++++  L  +L +S KIGGDV   A LV+ AF +QL+++   T   +PA      LLKP S  I +I +FRE +R S FFNHLSA+SE IP LGWV V   P P+VKEM DA QFYTNRV+K++KEK+V HV+W +AW+   T+LQA++++++TTGL WSG+G+ P      PP P   PP            D + D   ALF++IN+G+ +T GLKKVT DM+THKNP+LR G   P K+  +    K      +   K      DG KW +EY  N   +++ +  +   +Y+FKC+ S +TVKGK+N+IV D+C K +L+FD +++S++ VNC+SVQ Q LG +PTV+IDKTDG Q+YLSK+SLG EIV++KSSEMNI++P + G+  E+ALPEQ+KT I G  L T C
Sbjct:    1 MSVAGFEDIVAGPLSQYLTLSAKIGGDVAQHAELVKSAFGSQLQYVTLATQIAQPAQPKQAELLKPTSTQISAIQDFREKHRSSPFFNHLSAISESIPALGWVCVEKTPGPYVKEMNDAGQFYTNRVLKEWKEKDVTHVEWARAWVQTLTELQAYIRQYHTTGLVWSGKGAAPAGGAPPPPPPGGLPPPPPMLDLSALKLDSAGDDRSALFAQINQGADITKGLKKVTGDMQTHKNPSLRTGP-APFKSPAQSGGSKAVAAPSAAQAKAPVFERDGKKWIIEYQKNNTGLLVENAEMNNVVYVFKCEGSTLTVKGKVNNIVFDSCKKCSLLFDSVVASVEFVNCQSVQMQVLGSVPTVSIDKTDGCQMYLSKDSLGVEIVNSKSSEMNILLPDDSGDYTELALPEQYKTTIAGKTLKTVC 419          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Fly
Match: capt (gene:FBgn0261458 transcript:FBtr0332274)

HSP 1 Score: 388.267 bits (996), Expect = 5.212e-131
Identity = 197/420 (46.90%), Postives = 278/420 (66.19%), Query Frame = 2
Query:  191 VAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXX-----XXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVA-VKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSC 1432
            +++  + ++++  L  +L +S KIGGDV   A LV+ AF +QL+++   T   +PA      LLKP S  I +I +FRE +R S FFNHLSA+SE IP LGWV V   P P+VKEM DA QFYTNRV+K++KEK+V HV+W +AW+   T+LQA++++++TTGL WSG+G+ P      PP P   PP            D + D   ALF++IN+G+ +T GLKKVT DM+THKNP+LR G   P K+  +    K      +   K      DG KW +EY  N   +++ +  +   +Y+FKC+ S +TVKGK+N+IV D+C K +L+FD +++S++ VNC+SVQ Q LG +PTV+IDKTDG Q+YLSK+SLG EIV++KSSEMNI++P + G+  E+ALPEQ+KT I G  L T C
Sbjct:    1 MSVAGFEDIVAGPLSQYLTLSAKIGGDVAQHAELVKSAFGSQLQYVTLATQIAQPAQPKQAELLKPTSTQISAIQDFREKHRSSPFFNHLSAISESIPALGWVCVEKTPGPYVKEMNDAGQFYTNRVLKEWKEKDVTHVEWARAWVQTLTELQAYIRQYHTTGLVWSGKGAAPAGGAPPPPPPGGLPPPPPMLDLSALKLDSAGDDRSALFAQINQGADITKGLKKVTGDMQTHKNPSLRTGP-APFKSPAQSGGSKAVAAPSAAQAKAPVFERDGKKWIIEYQKNNTGLLVENAEMNNVVYVFKCEGSTLTVKGKVNNIVFDSCKKCSLLFDSVVASVEFVNCQSVQMQVLGSVPTVSIDKTDGCQMYLSKDSLGVEIVNSKSSEMNILLPDDSGDYTELALPEQYKTTIAGKTLKTVC 419          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Fly
Match: capt (gene:FBgn0261458 transcript:FBtr0100023)

HSP 1 Score: 390.963 bits (1003), Expect = 1.517e-127
Identity = 210/482 (43.57%), Postives = 299/482 (62.03%), Query Frame = 2
Query:   83 LENLVKRLETLTSRLEKL---PQ---------------------LSESGDMKSVKSNSS--SVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXX-----XXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVA-VKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSC 1432
            LE++ +RLETL  RLE+    PQ                     + E  +      +    ++++  + ++++  L  +L +S KIGGDV   A LV+ AF +QL+++   T   +PA      LLKP S  I +I +FRE +R S FFNHLSA+SE IP LGWV V   P P+VKEM DA QFYTNRV+K++KEK+V HV+W +AW+   T+LQA++++++TTGL WSG+G+ P      PP P   PP            D + D   ALF++IN+G+ +T GLKKVT DM+THKNP+LR G   P K+  +    K      +   K      DG KW +EY  N   +++ +  +   +Y+FKC+ S +TVKGK+N+IV D+C K +L+FD +++S++ VNC+SVQ Q LG +PTV+IDKTDG Q+YLSK+SLG EIV++KSSEMNI++P + G+  E+ALPEQ+KT I G  L T C
Sbjct:  298 LESICERLETLVDRLERTLTAPQPIELPTPTLPPPPAEEEEALPVFEKAETPPPPPSPPSSNMSVAGFEDIVAGPLSQYLTLSAKIGGDVAQHAELVKSAFGSQLQYVTLATQIAQPAQPKQAELLKPTSTQISAIQDFREKHRSSPFFNHLSAISESIPALGWVCVEKTPGPYVKEMNDAGQFYTNRVLKEWKEKDVTHVEWARAWVQTLTELQAYIRQYHTTGLVWSGKGAAPAGGAPPPPPPGGLPPPPPMLDLSALKLDSAGDDRSALFAQINQGADITKGLKKVTGDMQTHKNPSLRTGP-APFKSPAQSGGSKAVAAPSAAQAKAPVFERDGKKWIIEYQKNNTGLLVENAEMNNVVYVFKCEGSTLTVKGKVNNIVFDSCKKCSLLFDSVVASVEFVNCQSVQMQVLGSVPTVSIDKTDGCQMYLSKDSLGVEIVNSKSSEMNILLPDDSGDYTELALPEQYKTTIAGKTLKTVC 778          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Zebrafish
Match: cap1 (CAP, adenylate cyclase-associated protein 1 (yeast) [Source:ZFIN;Acc:ZDB-GENE-030131-6459])

HSP 1 Score: 407.142 bits (1045), Expect = 1.116e-137
Identity = 217/460 (47.17%), Postives = 296/460 (64.35%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWS------GEGSXXXXXXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTPNK--PAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSC 1432
             DL  LV+RLE    RLE +   S SG   +  S +  V +  Y  L+S  L  +  +S KIGGDV   A ++++AF++Q + L   +   KP+D  L  LL P+S AI  +  FRE NR S FFNHLSAVSE +P LGWV ++P P P+VKEMQDA+ FYTNRV+KD+KEK+  HV+W  A++ ++T+LQA++K+H+TTGL+WS             P    P  PPPP  +      D       ALF+ INKGS +T GLK V+DD KTHKNP LR G T P+ + P+    P     ++P +  P  + LDG KW VE     +++V+SDT +KQ +Y FKC+NS + VKGKINSI +DNC K  LVFD ++  ++++NC+ V+ Q +G +PT++I+KTDG  +YLSK+SL  EIVSAKSSEMN++VP +DGE  E+ +PEQFKT   G KLVT+ 
Sbjct:    2 ADLAGLVQRLEVAVGRLESM-SSSGSGGGPAAGSGAVGVYVEAYDGLISGPLAQYFTLSQKIGGDVLKHAEMMKQAFTSQRQLLATASCSQKPSDPVLNALLAPVSKAIQDVQAFREKNRSSPFFNHLSAVSESVPALGWVAMAPKPGPYVKEMQDAAMFYTNRVLKDYKEKDKTHVEWVNAYVTIWTELQAYIKQHHTTGLSWSKTGPVAAAAGGGAPAPPPPGPPPPPMDLNKSSGGDSEPTNRNALFASINKGSDITKGLKHVSDDQKTHKNPGLR-GQTGPSVSGPK-PFTPRPTATASPARSLPPVLELDGKKWKVENQEGAQNLVISDTELKQVVYGFKCNNSTLQVKGKINSITLDNCKKMGLVFDDVVGIVEVINCRDVKIQVIGKVPTISINKTDGCHVYLSKDSLSCEIVSAKSSEMNVLVPNKDGEFTEIPVPEQFKTVWDGSKLVTTA 458          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Zebrafish
Match: cap2 (cyclase associated actin cytoskeleton regulatory protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1758])

HSP 1 Score: 380.563 bits (976), Expect = 2.915e-127
Identity = 199/457 (43.54%), Postives = 282/457 (61.71%), Query Frame = 2
Query:   83 LENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEG-------SXXXXXXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTPNK--PAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVT 1426
            LE  V RLE +  +L+  P    +GD+ +V +   S ++  +  LLS  +  ++Q S  IGGDV   A +V  A   Q   LK   T  +PA + L  LL+P+SD I ++ NFRE NR S  FNHLSAVSE IP LGWV V   P P+VKEM DA+ FYTNRV+KDFK+ +  HV+W +++++++T LQ F+++H+ TGL WS  G            +   PP PPP    +     D S+  H ALF+++N+G  +T GLK V D+ KTHKNPNLR+ S    KT  +   K      S P +  P  + L+G KW VEY     ++++ DT ++Q +Y+F C  S + VKGK+NSI++DNC K  LVFD ++  ++I+N + +Q Q +G +PT++I+KT+G  +YLSK+SL  EIVSAKSSEMNI+VP+ + +  E  +PEQFKT   G  LVT
Sbjct:    8 LERAVVRLEAVAVKLQSCPGGLINGDISAVINGGESQSMEAFDRLLSGSVSEYVQSSAAIGGDVAKHAEMVNNALQVQRTLLKMAMTHQEPAKTELADLLRPLSDQIQAVQNFREKNRGSSLFNHLSAVSESIPALGWVAVCQKPGPYVKEMNDAAMFYTNRVLKDFKDTDARHVEWVRSYLSIWTDLQTFIREHHCTGLIWSKTGPKAPPSLLSAPLLPPPPPPPPPMMIDSCSSPADASSVQHAALFAQLNQGEEITKGLKHVCDEQKTHKNPNLRSQS---GKTHHDSPSKTQSSSSSNPARKHPPVLELEGKKWRVEYQDQCAELLIEDTELRQVVYVFSCSGSTLQVKGKVNSIIVDNCKKLGLVFDNVVGIVEIINSRDIQLQVMGKVPTISINKTEGCHVYLSKDSLDCEIVSAKSSEMNILVPEGEDDYREFPVPEQFKTVWDGSSLVT 461          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Zebrafish
Match: cap2 (cyclase associated actin cytoskeleton regulatory protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1758])

HSP 1 Score: 380.563 bits (976), Expect = 2.915e-127
Identity = 199/457 (43.54%), Postives = 282/457 (61.71%), Query Frame = 2
Query:   83 LENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEG-------SXXXXXXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTPNK--PAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVT 1426
            LE  V RLE +  +L+  P    +GD+ +V +   S ++  +  LLS  +  ++Q S  IGGDV   A +V  A   Q   LK   T  +PA + L  LL+P+SD I ++ NFRE NR S  FNHLSAVSE IP LGWV V   P P+VKEM DA+ FYTNRV+KDFK+ +  HV+W +++++++T LQ F+++H+ TGL WS  G            +   PP PPP    +     D S+  H ALF+++N+G  +T GLK V D+ KTHKNPNLR+ S    KT  +   K      S P +  P  + L+G KW VEY     ++++ DT ++Q +Y+F C  S + VKGK+NSI++DNC K  LVFD ++  ++I+N + +Q Q +G +PT++I+KT+G  +YLSK+SL  EIVSAKSSEMNI+VP+ + +  E  +PEQFKT   G  LVT
Sbjct:    8 LERAVVRLEAVAVKLQSCPGGLINGDISAVINGGESQSMEAFDRLLSGSVSEYVQSSAAIGGDVAKHAEMVNNALQVQRTLLKMAMTHQEPAKTELADLLRPLSDQIQAVQNFREKNRGSSLFNHLSAVSESIPALGWVAVCQKPGPYVKEMNDAAMFYTNRVLKDFKDTDARHVEWVRSYLSIWTDLQTFIREHHCTGLIWSKTGPKAPPSLLSAPLLPPPPPPPPPMMIDSCSSPADASSVQHAALFAQLNQGEEITKGLKHVCDEQKTHKNPNLRSQS---GKTHHDSPSKTQSSSSSNPARKHPPVLELEGKKWRVEYQDQCAELLIEDTELRQVVYVFSCSGSTLQVKGKVNSIIVDNCKKLGLVFDNVVGIVEIINSRDIQLQVMGKVPTISINKTEGCHVYLSKDSLDCEIVSAKSSEMNILVPEGEDDYREFPVPEQFKTVWDGSSLVT 461          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Zebrafish
Match: cap1 (CAP, adenylate cyclase-associated protein 1 (yeast) [Source:ZFIN;Acc:ZDB-GENE-030131-6459])

HSP 1 Score: 204.912 bits (520), Expect = 1.182e-62
Identity = 99/205 (48.29%), Postives = 137/205 (66.83%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWS 691
             DL  LV+RLE    RLE +   S SG   +  S +  V +  Y  L+S  L  +  +S KIGGDV   A ++++AF++Q + L   +   KP+D  L  LL P+S AI  +  FRE NR S FFNHLSAVSE +P LGWV ++P P P+VKEMQDA+ FYTNRV+KD+KEK+  HV+W  A++ ++T+LQA++K+H+TTGL+WS
Sbjct:    2 ADLAGLVQRLEVAVGRLESM-SSSGSGGGPAAGSGAVGVYVEAYDGLISGPLAQYFTLSQKIGGDVLKHAEMMKQAFTSQRQLLATASCSQKPSDPVLNALLAPVSKAIQDVQAFREKNRSSPFFNHLSAVSESVPALGWVAMAPKPGPYVKEMQDAAMFYTNRVLKDYKEKDKTHVEWVNAYVTIWTELQAYIKQHHTTGLSWS 205          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Xenopus
Match: tex26 (testis expressed 26 [Source:Xenbase;Acc:XB-GENE-976948])

HSP 1 Score: 366.311 bits (939), Expect = 1.097e-121
Identity = 194/458 (42.36%), Postives = 284/458 (62.01%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRA-GSTVPAKTKPEVAVKP-GHGQKS----TPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSC 1432
             D+  LV RLE   ++LE L     +G    V S  ++V +  Y ++++ ++  F++ S +IGGDV+ QA +       Q   L   +   +PA+  L  +L P+S  I ++ +FRE NR S+ FNHLSA+SE +P LGWV V+P P P+VKEM DA+ FYTNRV+K++K+ +  H DW +A++ ++  LQ ++K+H+TTGL W   G      + + P P  PP      + D  + +   LF+++N+G  +T GLK V+DDMKTHKNP+L+  G  V A  KP  + KP G G  +       +P  + L+G KW VE   N  ++ ++DT +KQ +YIFKC NS + VKGKINSI++DNC K  LVF+  +  ++I+N K V+ Q +G +PT++I+KTDG  +YLS+ SL  EI+SAKSSEMNI+VP   GE  E  +PEQFKT   G KL T+ 
Sbjct:    2 ADIHGLVDRLEKAVAKLEIL----AAGSGGDVSSADTAVYVQAYDDIINGQVAEFMKKSKEIGGDVEKQADMFMSGIQLQRAILVMASQYQQPAEKDLSAILAPLSGKIQAVQDFREKNRGSKLFNHLSALSESVPALGWVAVAPKPGPYVKEMMDAATFYTNRVLKEYKDVDKKHADWVRAYLNIWNDLQTYIKEHHTTGLNWKKTGP---KASGVAPTPAAPPAPKAASAPDDDSVSRSQLFAQLNQGEKITKGLKHVSDDMKTHKNPSLKTQGGPVRAGPKPFTSPKPTGFGAPAAKPVVKKQPPVLELEGKKWKVENQENVSNLEIADTELKQVVYIFKCVNSTLQVKGKINSIIVDNCKKLGLVFEDAVGIVEIINSKDVKVQVMGKVPTISINKTDGCHVYLSQGSLQCEIISAKSSEMNILVPTSGGEFSEFPVPEQFKTVWNGQKLETTV 452          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Xenopus
Match: tex26 (testis expressed 26 [Source:Xenbase;Acc:XB-GENE-976948])

HSP 1 Score: 360.147 bits (923), Expect = 3.997e-119
Identity = 199/473 (42.07%), Postives = 287/473 (60.68%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXX---------------XXXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRA-GSTVPAKTKPEVAVKP-GHGQKS----TPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSC 1432
             D+  LV RLE   ++LE L     +G    V S  ++V +  Y ++++ ++  F++ S +IGGDV+ QA +       Q   L   +   +PA+  L  +L P+S  I ++ +FRE NR S+ FNHLSA+SE +P LGWV V+P P P+VKEM DA+ FYTNRV+K++K+ +  H DW +A++ ++  LQ ++K+H+TTGL W   G                   P    P  PPPPPP  P  + D  + +   LF+++N+G  +T GLK V+DDMKTHKNP+L+  G  V A  KP  + KP G G  +       +P  + L+G KW VE   N  ++ ++DT +KQ +YIFKC NS + VKGKINSI++DNC K  LVF+  +  ++I+N K V+ Q +G +PT++I+KTDG  +YLS+ SL  EI+SAKSSEMNI+VP   GE  E  +PEQFKT   G KL T+ 
Sbjct:    2 ADIHGLVDRLEKAVAKLEIL----AAGSGGDVSSADTAVYVQAYDDIINGQVAEFMKKSKEIGGDVEKQADMFMSGIQLQRAILVMASQYQQPAEKDLSAILAPLSGKIQAVQDFREKNRGSKLFNHLSALSESVPALGWVAVAPKPGPYVKEMMDAATFYTNRVLKEYKDVDKKHADWVRAYLNIWNDLQTYIKEHHTTGLNWKKTGPKASGVAPTPAAPPAPKAGPPPPPPGGPPPPPPPAPASAPDDDSVSRSQLFAQLNQGEKITKGLKHVSDDMKTHKNPSLKTQGGPVRAGPKPFTSPKPTGFGAPAAKPVVKKQPPVLELEGKKWKVENQENVSNLEIADTELKQVVYIFKCVNSTLQVKGKINSIIVDNCKKLGLVFEDAVGIVEIINSKDVKVQVMGKVPTISINKTDGCHVYLSQGSLQCEIISAKSSEMNILVPTSGGEFSEFPVPEQFKTVWNGQKLETTV 470          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Xenopus
Match: tex26 (testis expressed 26 [Source:Xenbase;Acc:XB-GENE-976948])

HSP 1 Score: 355.14 bits (910), Expect = 3.027e-117
Identity = 196/469 (41.79%), Postives = 288/469 (61.41%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTW-----------SGEGSXXXXXXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRA-GSTVPAKTKPEVAVKP-GHGQKS----TPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSC 1432
             D+  LV RLE   ++LE L   S+      +  ++++V +  Y ++++ ++  F++ S +IGGDV+ QA +       Q   L   +   +PA+  L  +L P+S  I ++ +FRE NR S+ FNHLSA+SE +P LGWV V+P P P+VKEM DA+ FYTNRV+K++K+ +  H DW +A++ ++  LQ ++K+H+TTGL W           +       P    P  PPPPPP  P  + D  + +   LF+++N+G  +T GLK V+DDMKTHKNP+L+  G  V A  KP  + KP G G  +       +P  + L+G KW VE   N  ++ ++DT +KQ +YIFKC NS + VKGKINSI++DNC K  LVF+  +  ++I+N K V+ Q +G +PT++I+KTDG  +YLS+ SL  EI+SAKSSEMNI+VP   GE  E  +PEQFKT   G KL T+ 
Sbjct:    2 ADIHGLVDRLEKAVAKLEILAAGSDQ-----LYVSNTAVYVQAYDDIINGQVAEFMKKSKEIGGDVEKQADMFMSGIQLQRAILVMASQYQQPAEKDLSAILAPLSGKIQAVQDFREKNRGSKLFNHLSALSESVPALGWVAVAPKPGPYVKEMMDAATFYTNRVLKEYKDVDKKHADWVRAYLNIWNDLQTYIKEHHTTGLNWKKTVRVAPTPAAPPAPKAGPPPPPPGGPPPPPPPAPASAPDDDSVSRSQLFAQLNQGEKITKGLKHVSDDMKTHKNPSLKTQGGPVRAGPKPFTSPKPTGFGAPAAKPVVKKQPPVLELEGKKWKVENQENVSNLEIADTELKQVVYIFKCVNSTLQVKGKINSIIVDNCKKLGLVFEDAVGIVEIINSKDVKVQVMGKVPTISINKTDGCHVYLSQGSLQCEIISAKSSEMNILVPTSGGEFSEFPVPEQFKTVWNGQKLETTV 465          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Xenopus
Match: CAP2 (cyclase associated actin cytoskeleton regulatory protein 2 [Source:NCBI gene;Acc:100490411])

HSP 1 Score: 352.829 bits (904), Expect = 2.835e-116
Identity = 188/464 (40.52%), Postives = 280/464 (60.34%), Query Frame = 2
Query:   80 DLENLVKRLETLTSRLEKLPQLSES---GDMKSVKSNSSSVA--INEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGE------GSXXXXXXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRA-GSTVPAKTKPEVAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSCA 1435
            +++ L+ RLE    RLE +   S S    +   V   +  V   +  +  L++  L  +++ S  IGGDV+T A +VE AF A+  FL   +   +P  +    +LKPIS+ I  I +FRE NR S+ FNHLS +SE IP LGW+ +SP P P+VKEM DA+ FYTNRV+KD+K  +  HVDW K+++ ++++LQA++K+++TTG++W          +     +       P        + D  +    ALF+++N+G  +T GL+ V+D+ KTHKNP LR+ G +  + TK               + P  + L+G KW VEY    + +V+S+T +KQ  YIFKC  + I +KGK+NSI++DNCTK  LVFD ++  ++++N K ++ Q LG +PT++I+KTDG  +YLS+ S+  EIVSAKSSEMNI+VP  DG+  E  +PEQFKT   G KLVT  A
Sbjct:    3 EMDGLMDRLEKAVIRLESVLSNSFSSSSAENNVVNGINGGVVPFVEAFDALMAGALEEYVKNSKVIGGDVETHAGMVENAFKAERTFLVFASQHQQPPQAEECLILKPISEKILEIQSFREKNRGSQLFNHLSGISESIPALGWIAMSPKPGPYVKEMTDAATFYTNRVLKDYKSTDPRHVDWVKSYLNIWSELQAYIKEYHTTGVSWGNAKPTAVPSNCSFQFSSGCQILKPMDQPRDSKAKDDISQDRSALFAQLNQGEAITKGLRHVSDEQKTHKNPKLRSQGGSSISPTKSHTPSPTTPQSPPHQSYPPLLELEGKKWRVEYQEGVQGLVISETELKQVAYIFKCKKTTIQIKGKLNSIIIDNCTKLGLVFDDVVGIVEVINSKDIEIQVLGKVPTISINKTDGCHVYLSENSIDCEIVSAKSSEMNILVP-HDGDYKEFPVPEQFKTSWDGSKLVTEPA 465          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Xenopus
Match: CAP2 (cyclase associated actin cytoskeleton regulatory protein 2 [Source:NCBI gene;Acc:100490411])

HSP 1 Score: 350.132 bits (897), Expect = 4.503e-115
Identity = 197/479 (41.13%), Postives = 287/479 (59.92%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQLSES---GDMKSVKSNSSSVA--INEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSG---------------EGSXXXXXXXXXXXXXXXXXXXXXXSNDGSADTHL-----ALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRA-GSTVPAKTKPEVAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSCA 1435
             +++ L+ RLE    RLE +   S S    +   V   +  V   +  +  L++  L  +++ S  IGGDV+T A +VE AF A+  FL   +   +P  +    +LKPIS+ I  I +FRE NR S+ FNHLS +SE IP LGW+ +SP P P+VKEM DA+ FYTNRV+KD+K  +  HVDW K+++ ++++LQA++K+++TTG++W                 + S        PP PPPP P     S D  A   +     ALF+++N+G  +T GL+ V+D+ KTHKNP LR+ G +  + TK               + P  + L+G KW VEY    + +V+S+T +KQ  YIFKC  + I +KGK+NSI++DNCTK  LVFD ++  ++++N K ++ Q LG +PT++I+KTDG  +YLS+ S+  EIVSAKSSEMNI+VP  DG+  E  +PEQFKT   G KLVT  A
Sbjct:    2 AEMDGLMDRLEKAVIRLESVLSNSFSSSSAENNVVNGINGGVVPFVEAFDALMAGALEEYVKNSKVIGGDVETHAGMVENAFKAERTFLVFASQHQQPPQAEECLILKPISEKILEIQSFREKNRGSQLFNHLSGISESIPALGWIAMSPKPGPYVKEMTDAATFYTNRVLKDYKSTDPRHVDWVKSYLNIWSELQAYIKEYHTTGVSWGNAICSVPSTAKGVALLQKSSESSCPPPPPPPPPPCPPPMADSLDSKAKDDISQDRSALFAQLNQGEAITKGLRHVSDEQKTHKNPKLRSQGGSSISPTKSHTPSPTTPQSPPHQSYPPLLELEGKKWRVEYQEGVQGLVISETELKQVAYIFKCKKTTIQIKGKLNSIIIDNCTKLGLVFDDVVGIVEVINSKDIEIQVLGKVPTISINKTDGCHVYLSENSIDCEIVSAKSSEMNILVP-HDGDYKEFPVPEQFKTSWDGSKLVTEPA 479          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Mouse
Match: Cap1 (CAP, adenylate cyclase-associated protein 1 (yeast) [Source:MGI Symbol;Acc:MGI:88262])

HSP 1 Score: 377.096 bits (967), Expect = 8.792e-126
Identity = 209/471 (44.37%), Postives = 300/471 (63.69%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVA----INEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXX------------XXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGS-TVPAKTKPEVAVKPGHG---QKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTS 1429
             D++NLV+RLE    RLE +   S + DM     +S S      +  + +LL++ +  +L++S +IGGDV+  A +V      +   L   + C +PA + L  LL PIS+ I  +  FRE NR S+FFNHLSAVSE I  LGWV ++  P PFVKEM DA+ FYTNRV+K++++ +  HVDW +A+++++T+LQA++K+ +TTGL WS  G + K ++              PP  PPPPP++    +D SA +  ALF++IN+G  +T  LK V+DDMKTHKNP L+A S  V +  KP  A KP      + +T  +PA + L+G KW VE   N  ++V+ DT +KQ  YI+KC N+ + +KGKINSI +DNC K  LVFD ++  ++I+N + V+ Q +G +PT++I+KTDG   YLSK SL  EIVSAKSSEMN+++P E G+  E  +PEQFKT   G KLVT+
Sbjct:    2 ADMQNLVERLERAVGRLEAV---SHTSDMHCGYGDSPSKGAVPYVQAFDSLLANPVAEYLKMSKEIGGDVQKHAEMVHTGLKLERALLATASQCQQPAGNKLSDLLAPISEQIQEVITFREKNRGSKFFNHLSAVSESIQALGWVALAAKPGPFVKEMNDAAMFYTNRVLKEYRDVDKKHVDWVRAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSVGSGPPPPPPGPPPPPISTSSGSDDSA-SRSALFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKPATKKEPALLELEGKKWRVENQENVSNLVIDDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTT 468          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Mouse
Match: Cap1 (CAP, adenylate cyclase-associated protein 1 (yeast) [Source:MGI Symbol;Acc:MGI:88262])

HSP 1 Score: 377.096 bits (967), Expect = 8.792e-126
Identity = 209/471 (44.37%), Postives = 300/471 (63.69%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVA----INEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXX------------XXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGS-TVPAKTKPEVAVKPGHG---QKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTS 1429
             D++NLV+RLE    RLE +   S + DM     +S S      +  + +LL++ +  +L++S +IGGDV+  A +V      +   L   + C +PA + L  LL PIS+ I  +  FRE NR S+FFNHLSAVSE I  LGWV ++  P PFVKEM DA+ FYTNRV+K++++ +  HVDW +A+++++T+LQA++K+ +TTGL WS  G + K ++              PP  PPPPP++    +D SA +  ALF++IN+G  +T  LK V+DDMKTHKNP L+A S  V +  KP  A KP      + +T  +PA + L+G KW VE   N  ++V+ DT +KQ  YI+KC N+ + +KGKINSI +DNC K  LVFD ++  ++I+N + V+ Q +G +PT++I+KTDG   YLSK SL  EIVSAKSSEMN+++P E G+  E  +PEQFKT   G KLVT+
Sbjct:    2 ADMQNLVERLERAVGRLEAV---SHTSDMHCGYGDSPSKGAVPYVQAFDSLLANPVAEYLKMSKEIGGDVQKHAEMVHTGLKLERALLATASQCQQPAGNKLSDLLAPISEQIQEVITFREKNRGSKFFNHLSAVSESIQALGWVALAAKPGPFVKEMNDAAMFYTNRVLKEYRDVDKKHVDWVRAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSVGSGPPPPPPGPPPPPISTSSGSDDSA-SRSALFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKPATKKEPALLELEGKKWRVENQENVSNLVIDDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTT 468          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Mouse
Match: Cap1 (CAP, adenylate cyclase-associated protein 1 (yeast) [Source:MGI Symbol;Acc:MGI:88262])

HSP 1 Score: 377.096 bits (967), Expect = 8.792e-126
Identity = 209/471 (44.37%), Postives = 300/471 (63.69%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVA----INEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXX------------XXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGS-TVPAKTKPEVAVKPGHG---QKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTS 1429
             D++NLV+RLE    RLE +   S + DM     +S S      +  + +LL++ +  +L++S +IGGDV+  A +V      +   L   + C +PA + L  LL PIS+ I  +  FRE NR S+FFNHLSAVSE I  LGWV ++  P PFVKEM DA+ FYTNRV+K++++ +  HVDW +A+++++T+LQA++K+ +TTGL WS  G + K ++              PP  PPPPP++    +D SA +  ALF++IN+G  +T  LK V+DDMKTHKNP L+A S  V +  KP  A KP      + +T  +PA + L+G KW VE   N  ++V+ DT +KQ  YI+KC N+ + +KGKINSI +DNC K  LVFD ++  ++I+N + V+ Q +G +PT++I+KTDG   YLSK SL  EIVSAKSSEMN+++P E G+  E  +PEQFKT   G KLVT+
Sbjct:    2 ADMQNLVERLERAVGRLEAV---SHTSDMHCGYGDSPSKGAVPYVQAFDSLLANPVAEYLKMSKEIGGDVQKHAEMVHTGLKLERALLATASQCQQPAGNKLSDLLAPISEQIQEVITFREKNRGSKFFNHLSAVSESIQALGWVALAAKPGPFVKEMNDAAMFYTNRVLKEYRDVDKKHVDWVRAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSVGSGPPPPPPGPPPPPISTSSGSDDSA-SRSALFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKPATKKEPALLELEGKKWRVENQENVSNLVIDDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTT 468          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Mouse
Match: Cap2 (CAP, adenylate cyclase-associated protein, 2 (yeast) [Source:MGI Symbol;Acc:MGI:1914502])

HSP 1 Score: 373.629 bits (958), Expect = 1.702e-124
Identity = 196/467 (41.97%), Postives = 292/467 (62.53%), Query Frame = 2
Query:   83 LENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXXXXXS---------------NDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTPNKPAE-MRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSCA 1435
            LE  V RLE L++ L+  P+    G++  V    +  ++  +  L++S +  FL+ S  + GDV+T A +V  AF AQ  FL   +   +P ++ +  LLKPIS+ I  I  FRE NR S  FNHLSAVSE I  LGW+ VSP P P+VKEM DA+ FYTNRV+KD+K  ++ HVDW ++++ ++++LQA++++H+TTGLTWS  G +    +        P    P P                 +  + +  ALF+++N+G  +T GL+ VTDD KT+KNP+LRA   + + TK      P   + ++P K    + L+G KW VEY  ++ D+V+S+T +KQ  YIFKCD S + +KGK+NSI +DNC K  LVFD ++  ++++N K +Q Q +G +PT++I+KT+G  +YLS+++L  EIVSAKSSEMN++VP++D +  E  +PEQFKT   G KLVT  A
Sbjct:   11 LERAVIRLEQLSAGLDGPPR--GCGEVNGVNGGVAP-SVEAFDKLINSMVAEFLKNSRVLAGDVETHAEMVHGAFQAQRAFLLMVSQYQQPQENEVAVLLKPISEKIQEIQTFRERNRGSNMFNHLSAVSESIAALGWIAVSPKPGPYVKEMNDAATFYTNRVLKDYKHSDLRHVDWVRSYLNIWSELQAYIREHHTTGLTWSKTGPVASTASAFSILSSGPGLPPPPPPPPPPGPPPPFENEDKKEEPSPSRSALFAQLNQGEAITKGLRHVTDDKKTYKNPSLRAQGQIRSPTKTHTP-SPTSPKSNSPQKHTPVLELEGKKWRVEYQEDRNDLVISETELKQVAYIFKCDKSTLQIKGKVNSITVDNCKKFGLVFDHVVGIVEVINSKDIQIQVMGRVPTISINKTEGCHLYLSEDALDCEIVSAKSSEMNVLVPQDD-DYREFPIPEQFKTIWDGSKLVTEPA 472          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Mouse
Match: Cap2 (CAP, adenylate cyclase-associated protein, 2 (yeast) [Source:MGI Symbol;Acc:MGI:1914502])

HSP 1 Score: 364.385 bits (934), Expect = 1.541e-121
Identity = 183/415 (44.10%), Postives = 266/415 (64.10%), Query Frame = 2
Query:  239 FLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXXXXXS---------------NDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTPNKPAE-MRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSCA 1435
            FL+ S  + GDV+T A +V  AF AQ  FL   +   +P ++ +  LLKPIS+ I  I  FRE NR S  FNHLSAVSE I  LGW+ VSP P P+VKEM DA+ FYTNRV+KD+K  ++ HVDW ++++ ++++LQA++++H+TTGLTWS  G +    +        P    P P                 +  + +  ALF+++N+G  +T GL+ VTDD KT+KNP+LRA   + + TK      P   + ++P K    + L+G KW VEY  ++ D+V+S+T +KQ  YIFKCD S + +KGK+NSI +DNC K  LVFD ++  ++++N K +Q Q +G +PT++I+KT+G  +YLS+++L  EIVSAKSSEMN++VP++D +  E  +PEQFKT   G KLVT  A
Sbjct:    5 FLKNSRVLAGDVETHAEMVHGAFQAQRAFLLMVSQYQQPQENEVAVLLKPISEKIQEIQTFRERNRGSNMFNHLSAVSESIAALGWIAVSPKPGPYVKEMNDAATFYTNRVLKDYKHSDLRHVDWVRSYLNIWSELQAYIREHHTTGLTWSKTGPVASTASAFSILSSGPGLPPPPPPPPPPGPPPPFENEDKKEEPSPSRSALFAQLNQGEAITKGLRHVTDDKKTYKNPSLRAQGQIRSPTKTHTP-SPTSPKSNSPQKHTPVLELEGKKWRVEYQEDRNDLVISETELKQVAYIFKCDKSTLQIKGKVNSITVDNCKKFGLVFDHVVGIVEVINSKDIQIQVMGRVPTISINKTEGCHLYLSEDALDCEIVSAKSSEMNVLVPQDD-DYREFPIPEQFKTIWDGSKLVTEPA 417          
BLAST of Adenylyl cyclase-associated protein vs. UniProt/SwissProt
Match: sp|P40123|CAP2_HUMAN (Adenylyl cyclase-associated protein 2 OS=Homo sapiens OX=9606 GN=CAP2 PE=1 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 2.310e-129
Identity = 209/481 (43.45%), Postives = 298/481 (61.95%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQLSES--GDMKSVKSNSSSVA--INEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXXXXX-----------SNDG----SADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAG---------STVPAKTKPEVAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSCA 1435
             +++ LV+RLE   SRLE L   S    G+   V    + VA  +  +  L+ S +  FL+ S  + GDV+T A +V  AF AQ  FL   +   +P ++ +  LLKPIS+ I  I  FRE NR S  FNHLSAVSE IP LGW+ VSP P P+VKEM DA+ FYTNRV+KD+K  ++ HVDW K+++ ++++LQA++K+H+TTGLTWS  G +   ++        P    P P            N+G    S+ +  ALF+++N+G  +T GL+ VTDD KT+KNP+LRA          S  P+ T P    K    QK  P     + L+G KW VEY  ++ D+V+S+T +KQ  YIFKC+ S I +KGK+NSI++DNC K  LVFD ++  ++++N + +Q Q +G +PT++I+KT+G  IYLS+++L  EIVSAKSSEMNI++P +DG+  E  +PEQFKT   G KL+T  A
Sbjct:    2 ANMQGLVERLERAVSRLESLSAESHRPPGNCGEVNGVIAGVAPSVEAFDKLMDSMVAEFLKNSRILAGDVETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRGSNMFNHLSAVSESIPALGWIAVSPKPGPYVKEMNDAATFYTNRVLKDYKHSDLRHVDWVKSYLNIWSELQAYIKEHHTTGLTWSKTGPVASTVSAFSVLSSGPGLPPPPPPLPPPGPPPLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHVTDDQKTYKNPSLRAQGGQTQSPTKSHTPSPTSP----KSYPSQKHAP----VLELEGKKWRVEYQEDRNDLVISETELKQVAYIFKCEKSTIQIKGKVNSIIIDNCKKLGLVFDNVVGIVEVINSQDIQIQVMGRVPTISINKTEGCHIYLSEDALDCEIVSAKSSEMNILIP-QDGDYREFPIPEQFKTAWDGSKLITEPA 473          
BLAST of Adenylyl cyclase-associated protein vs. UniProt/SwissProt
Match: sp|Q5R5X8|CAP2_PONAB (Adenylyl cyclase-associated protein 2 OS=Pongo abelii OX=9601 GN=CAP2 PE=2 SV=1)

HSP 1 Score: 386.726 bits (992), Expect = 9.969e-129
Identity = 208/481 (43.24%), Postives = 297/481 (61.75%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQLSES--GDMKSVKSNSSSVA--INEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXXXXX-----------SNDG----SADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAG---------STVPAKTKPEVAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSCA 1435
             +++ LV+RLE   SRLE L   S    G+   V      VA  +  +  L+ S +  FL+ S  + GDV+T A +V  AF AQ  FL   +   +P ++ +  LLKPIS+ I  I  FRE NR S  FNHLSAVSE IP LGW+ VSP P P+VKEM DA+ FYTNRV+KD+K  ++ HVDW K+++ ++++LQA++K+H+TTGLTWS  G +   ++        P    P P            N+G    S+ +  ALF+++N+G  +T GL+ VTDD KT+KNP+LRA          S  P+ T P    K    QK  P     + L+G KW VEY  ++ D+V+S+T +KQ  YIFKC+ S + +KGK+NSI++DNC K  LVFD ++  ++++N + +Q Q +G +PT++I+KT+G  IYLS+++L  EIVSAKSSEMNI++P +DG+  E  +PEQFKT   G KL+T  A
Sbjct:    2 ANMQGLVERLERAVSRLESLSAESHRPPGNCGEVNGVIGGVAPSVEAFDKLMDSMVAEFLKNSRILAGDVETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRGSNMFNHLSAVSESIPALGWIAVSPKPGPYVKEMNDAATFYTNRVLKDYKHSDLRHVDWVKSYLNIWSELQAYIKEHHTTGLTWSKTGPVASTVSAFSVLSSGPGLPPPPPPPPPPGPPPLLENEGKKEESSPSRSALFAQLNQGEAITKGLRHVTDDQKTYKNPSLRAQGGQTRSPTKSHTPSPTSP----KSYPSQKHAP----VLELEGKKWRVEYQEDRNDLVISETELKQVAYIFKCEKSTLQIKGKVNSIIIDNCKKLGLVFDNVVGIVEVINSQDIQIQVMGRVPTISINKTEGCHIYLSEDALDCEIVSAKSSEMNILIP-QDGDYREFPIPEQFKTAWDGSKLITEPA 473          
BLAST of Adenylyl cyclase-associated protein vs. UniProt/SwissProt
Match: sp|Q3SYV4|CAP1_BOVIN (Adenylyl cyclase-associated protein 1 OS=Bos taurus OX=9913 GN=CAP1 PE=2 SV=3)

HSP 1 Score: 384.8 bits (987), Expect = 5.713e-128
Identity = 209/466 (44.85%), Postives = 297/466 (63.73%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQLSES--GDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXX------------XXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGS-TVPAKTKPEVAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTS 1429
             D+ NLV+RLE +  RLE +   S++  G   S     ++  +  + +LL+  +  +L+IS +IGGDV+  A +V      +   L   + C +PA + L  LL PIS+ I  +  FRE NR S+ FNHLSAVSE I  LGWV ++P P P+VKEM DA+ FYTNRV+K++K+ +  HVDW KA+++++T+LQA++K+ +TTGL WS  G + K ++              PP  PPPPP+     +D SA +  ALF++IN+G  +T  LK V+DDMKTHKNP L+A S  + +  KP  A KP   +     +PA + L+G KW VE   N  ++++ DT +KQ  YIFKC NS + +KGKINSI +DNC K  LVFD ++  ++I+N K V+ Q +G +PT++I+KTDG  +YLSK SL  EIVSAKSSEMN+++P E G+  E  +PEQFKT   G KLVT+
Sbjct:    2 ADMRNLVERLERVVGRLEAVSHASDTHCGYGDSAAKAGTTPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAGNKLSDLLAPISEQIQEVVTFREKNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSRTGPVAKELSGLPSGPSAGSGPPPPPPGPPPPPVPTSSGSDDSA-SRSALFAQINQGESITHALKHVSDDMKTHKNPALKAQSGLIRSGPKPFSASKPDPPKPVAKKEPALLELEGKKWRVENQENVSNLMIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTT 466          
BLAST of Adenylyl cyclase-associated protein vs. UniProt/SwissProt
Match: sp|P52481|CAP2_RAT (Adenylyl cyclase-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Cap2 PE=1 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 3.086e-127
Identity = 201/474 (42.41%), Postives = 298/474 (62.87%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQ-LSE----SGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXXXXX-----------SNDGSAD----THLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTPNKPAE-MRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSCA 1435
             D+  L++RLE   SRLE+L   L E     G++ S+     + ++  +  L++S +  FL+ S  + GDV+T A +V  AF AQ  FL   +   +P ++ +  LLKPIS+ I  I  FRE NR S+ FNHLSAVSE I  LGW+ VSP P P+VKEM DA+ FYTNRV++D+K  ++ HVDW ++++ ++++LQA++K+H+TTGLTWS  G +    +        P    P P            N+G  +    +  ALF+++N+G  +T GL+ VTDD K +KNP+LRA   + + TK      P   + ++P K A  + L+G KW VEY  ++ D+V+S+T +KQ  YIFKCD S + +KGK+NSI +DNC K  LVFD ++  ++++N K +Q Q +G +PT++I+KT+G  +YLSK++L  EIVSAKSSEMN++VP+ D +  E  +PEQFKT   G KL+T  A
Sbjct:    2 ADMLGLMQRLEFAVSRLERLSSGLHEPPGGCGEVNSLSRGIVAPSVEAFDKLINSMVAEFLKNSRVLAGDVETHAEMVHGAFQAQRAFLLMVSQHQQPQENEVAVLLKPISEKIQEIQTFRERNRGSDMFNHLSAVSESIAALGWIAVSPKPGPYVKEMNDAATFYTNRVLRDYKHSDLRHVDWVRSYLKIWSELQAYIKEHHTTGLTWSKTGPVASTASAFSILSSGPGLPPPPPPPPPPGPPPPFENEGGKEEPSPSRSALFAQLNQGEAITKGLRHVTDDKKIYKNPSLRAQGQIRSPTKTRTP-SPTSSKSNSPQKHAPVLELEGKKWRVEYQEDRNDLVISETELKQVAYIFKCDKSTLQIKGKVNSITVDNCKKFGLVFDHVVGIVEVINSKDIQIQVMGRVPTISINKTEGCHLYLSKDALDCEIVSAKSSEMNVLVPQGD-DYREFPIPEQFKTIWDGSKLITEPA 473          
BLAST of Adenylyl cyclase-associated protein vs. UniProt/SwissProt
Match: sp|Q01518|CAP1_HUMAN (Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5)

HSP 1 Score: 382.874 bits (982), Expect = 3.157e-127
Identity = 210/471 (44.59%), Postives = 297/471 (63.06%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVA-----INEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXX-----------XXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGS-TVPAKTKPEVAVKPGHG---QKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTS 1429
             D++NLV+RLE    RLE +   S + DM    ++S S A     +  + +LL+  +  +L+IS +IGGDV+  A +V      +   L   + C +PA++ L  LL PIS+ I  +  FRE NR S+ FNHLSAVSE I  LGWV ++P P P+VKEM DA+ FYTNRV+K++K+ +  HVDW KA+++++T+LQA++K+ +TTGL WS  G + K                PP P PPPP     S    + +  +LF++IN+G  +T  LK V+DDMKTHKNP L+A S  V +  KP  A KP      +++T  +PA + L+G KW VE   N  ++V+ DT +KQ  YI+KC N+ + +KGKINSI +DNC K  LVFD ++  ++I+N K V+ Q +G +PT++I+KTDG   YLSK SL  EIVSAKSSEMN+++P E G+  E  +PEQFKT   G KLVT+
Sbjct:    2 ADMQNLVERLERAVGRLEAV---SHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREKNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSCPPPPPPCPPPPPVSTISCSYESASRSSLFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTT 469          
BLAST of Adenylyl cyclase-associated protein vs. TrEMBL
Match: T1FYH6 (Adenylyl cyclase-associated protein OS=Helobdella robusta OX=6412 GN=20213874 PE=3 SV=1)

HSP 1 Score: 446.432 bits (1147), Expect = 1.564e-149
Identity = 230/472 (48.73%), Postives = 308/472 (65.25%), Query Frame = 2
Query:   83 LENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXXX---------------XXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVP--AKTKPEVAVKPGHGQK-------STPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVT 1426
            +E+LV RLE +TSRLE +     SG   ++K+  S+  +  Y  +++S L  FL++S K+ GDV TQA LV+ A SAQ +FL   + C +PA + L  LLK +SD I +I + +E +R S+FFNHLS V++ IP LGWV VSPAP P+VKEM D+  FY+NR++KD++ K+  HV+W KAWM +   LQ +V+KH+TTGLTW+ +G            P P     P                 SNDG  D    LFSE+NKG  +T  LKKV+DDMKTHKNP LR G+  P  A  KP  A KPG  QK       ++  KP ++ L+G KW VE++ N  +I++++T +KQT+YIFKC+NS IT+KGK+N+I MDNC K  LVFD  ISSLD VNC+SV+AQ L  +PT+N+DKTDG  I+LSK+SL ++IVSAKSSEMN++VP    E  E  +PEQF+T   G KLVT
Sbjct:    1 MESLVTRLEAVTSRLENI----ASGGGTAMKAGDSAPFVQAYDAVVNSYLEKFLELSKKLDGDVSTQANLVKDALSAQHDFLVLASHCKEPAQAELPGLLKKLSDNISAIQDLKEKHRTSQFFNHLSTVADSIPALGWVSVSPAPAPYVKEMIDSGLFYSNRLLKDYRNKDDNHVEWVKAWMGLLCDLQVYVRKHHTTGLTWNKQGVDVSSYKGASSQPSPAGGPPPPPGPPPPPAPIAPSSTSSNDGDDDNRAQLFSELNKGEDITKSLKKVSDDMKTHKNPALRLGAPQPFKASAKPTPAAKPGANQKPSHHAPAASAKKPPKLELEGKKWIVEHYVNNNNIIIAETEMKQTVYIFKCENSTITIKGKVNAITMDNCKKCGLVFDESISSLDFVNCQSVKAQVLCKVPTINVDKTDGCMIFLSKDSLDSQIVSAKSSEMNVLVPDPQNEFREFPIPEQFRTYWNGSKLVT 468          
BLAST of Adenylyl cyclase-associated protein vs. TrEMBL
Match: A0A212F1V6 (Adenylyl cyclase-associated protein OS=Danaus plexippus plexippus OX=278856 GN=KGM_215799 PE=3 SV=1)

HSP 1 Score: 436.032 bits (1120), Expect = 8.648e-145
Identity = 226/455 (49.67%), Postives = 306/455 (67.25%), Query Frame = 2
Query:   74 SCDLENLVKRLETLTSRLEKLPQL-------SESGDMKSVKSN---SSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGST---VPAKTKPEVAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKT 1399
            + DLE+L++RLE +TSRLE+LP L         S    +V+ +   + +++IN Y  L+   L  +LQ+S+++GGD+ T A LV +AF  QL +++  TT  KP+ +    LL P S  I SI  FRE NR S+FFNHLSA+SE IP LGWV VSP P P+VKEM DA QFYTNRV+K++KEK+  HVDW +AW+ + + LQA+VK+++TTGL WSG+G  P P     P PPP  P       + +AD   ALF+EINKG  +TS L+KVT DM+THKNP LR G      PA   P V   P  G  S P+KP     DG KW +EY  + +++V+ +  +   +Y+F+C +S +TV+GKIN +V+D+CTK A+VFD L+SS++ VNC+SVQ Q LG +PT++IDKTDG QIYLS+ESL  EIVS+KSSEMN++VP   G+  E  +PEQFKT
Sbjct:   59 AADLESLIERLERVTSRLERLPVLLSTTLTPPSSPTPLTVQIDLIETDNMSINGYQELMQGPLQSYLQLSNQLGGDIATHANLVNEAFQEQLRYIQLATTRSKPSQAEDVQLLGPTSAKISSIQQFREKNRASKFFNHLSAISESIPALGWVAVSPTPAPYVKEMNDAGQFYTNRVLKEWKEKDKTHVDWCRAWIQLLSDLQAYVKQYHTTGLVWSGKGGAPPPPPGGMPPPPPALPEVDFA--NLAADDRSALFAEINKGEAITSSLRKVTSDMQTHKNPQLRQGPAPFKAPASKAP-VKALPTPGAGSLPDKPPVFARDGKKWVIEYQKSNQNLVVENADMNNVVYMFRCRDSALTVRGKINGVVLDSCTKCAVVFDNLVSSVEFVNCQSVQMQVLGKVPTISIDKTDGCQIYLSQESLDVEIVSSKSSEMNVLVPTASGDYSEYPIPEQFKT 510          
BLAST of Adenylyl cyclase-associated protein vs. TrEMBL
Match: A0A2C9JF04 (Adenylyl cyclase-associated protein OS=Biomphalaria glabrata OX=6526 GN=106055578 PE=3 SV=1)

HSP 1 Score: 424.091 bits (1089), Expect = 8.948e-141
Identity = 226/474 (47.68%), Postives = 311/474 (65.61%), Query Frame = 2
Query:   80 DLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXX------------------XXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAK----TKPEVAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSCA 1435
            ++++++ RLE +T+RLE L   S +       S++ S  +  +  ++S  L  +L +S+ +GGDVKTQA LV+ AF AQ  FL   +   +P  +A   LL+P +  + ++  FRE+NRRSE FNHLSA+SE I  LGWV V+PAP PFVKE+ DA  FYTNRV+KD+KEK+  HV+W ++W+A  T+LQ ++K+++TTGL+W+  G   K ++    A PPPPP                       S+    D   ALF+++NKG  VT GLKKVTDDMKTHKNP LR G   P K     KP+ + KPG      P KP  + L   KW VEY  + K+I+L +T IKQT+YI+KC+ SVI VKGK+NSI++D+C K+A+VFD L+SS++ VNC+S+QAQ  G +PT++IDKTDG  +YLS  SL  EIV+AKSSEMNI+VP+ DG+  E ALPEQFKTK  G  +VT+ +
Sbjct:    5 EVQSVLSRLEAVTTRLESLASRSPTSAQGDTSSDAVSPFVLAFDEIISGPLAKYLSLSNTVGGDVKTQANLVKSAFEAQRAFLVVASKSKQPDQNAFMQLLQPSASKLQAVQEFRENNRRSELFNHLSAISESIASLGWVTVTPAPGPFVKELSDAGTFYTNRVLKDYKEKDPNHVEWCRSWIATLTELQNYIKQYHTTGLSWNPRGGDAKSVSASSAATPPPPPAGGGPPPPPPPPGPPPPPDMSSSSSKKDDDAKAALFAQLNKGEDVTKGLKKVTDDMKTHKNPTLRQGP-APFKPTPGAKPQTSPKPGAKNAVAPVKPPLIELQDKKWVVEYHKDNKNIILDNTEIKQTVYIYKCEGSVIQVKGKVNSIILDSCKKTAVVFDDLVSSVEFVNCQSMQAQVTGRVPTLSIDKTDGCLVYLSPTSLDVEIVTAKSSEMNILVPQGDGDYKEFALPEQFKTKYDGKTMVTTIS 477          
BLAST of Adenylyl cyclase-associated protein vs. TrEMBL
Match: D6W6L7 (Adenylyl cyclase-associated protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC001635 PE=3 SV=2)

HSP 1 Score: 427.943 bits (1099), Expect = 2.048e-140
Identity = 217/456 (47.59%), Postives = 301/456 (66.01%), Query Frame = 2
Query:   71 MSCDLENLVKRLETLTSRLEK--LPQLSESGDMKSVKS-NSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTP----NKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGK 1417
            +  DLE+L+ RLET+T+RLEK  LP + +  ++K + S    ++++  +++++   L  +LQIS +IGGDV   + LV  AF  QL++L   +   +P+ + +  LLKP SD I +I +FRE +R S+FFNHLSA+SE IP LGWV VSPAP P+VKEM DA QFYTNRV+KD+KEK+  HVDW KAW+     LQAFVK+ +TTGL W+G+GS   P       PPPP          G      ALF++IN+G  +T  LKKVT DM+THKNP LR G   P KT       P  G +  P    +KP     DG KW +EY     ++V+ +  +   +Y+FKC +S + VKGK+NSI +D+C K+++VFD L+S+++ +NC+SVQ Q LG +PT++IDKTDG Q+YLS ESL  EIVS+KSSEMN++VPK +G+  E  +PEQ+KT +V GK
Sbjct:  163 LRSDLEDLIFRLETVTTRLEKVCLP-IEQLLNLKKISSPEEPNMSVQGFSDIIQGPLTQYLQISQQIGGDVGQHSQLVHNAFQMQLQYLVLASQSKQPSQNEIISLLKPTSDQISAIQDFREKHRTSQFFNHLSAISESIPALGWVTVSPAPAPYVKEMNDAGQFYTNRVLKDWKEKDKRHVDWVKAWIQTLVDLQAFVKQQHTTGLVWAGKGSAAPPPPPPGCPPPPPVLDFAAAEVAGGDADRSALFAQINQGENITRSLKKVTADMQTHKNPTLREGP-APFKT-------PARGAQGAPAPVVDKPPSFARDGKKWLIEYQKGNHNLVVENVEMNNVVYLFKCTDSTVVVKGKLNSITLDSCKKTSIVFDSLVSAMEFINCQSVQMQVLGKVPTISIDKTDGCQMYLSPESLDVEIVSSKSSEMNVLVPKGNGDYTEYPIPEQYKTTVVPGK 609          
BLAST of Adenylyl cyclase-associated protein vs. TrEMBL
Match: A0A2M4A5W1 (Adenylyl cyclase-associated protein OS=Anopheles triannulatus OX=58253 PE=3 SV=1)

HSP 1 Score: 421.009 bits (1081), Expect = 2.218e-140
Identity = 212/426 (49.77%), Postives = 287/426 (67.37%), Query Frame = 2
Query:  188 SVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGE-------GSXXXXXXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTK-PEVAVKPGHGQKSTP--NKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPK-EDGEIIEMALPEQFKTKIVGGKLVTSC 1432
            ++ I+ Y +++   L  FLQ+S+KIGG+V T A  V++AF AQ EFLK      +P+++ LQ +LKP SD I +I  FRE NR S FFNHLS++SE IP LGWV V+PAP P+VKEM DA QFYTNRV+KD+KEK+V HV+W + W+   T+LQ F+K+H+TTGL WSG+       GS   P        PPP P+     +D   D   ALF++IN+G+ +T GLKKVT DM+THKNP+LR+G   PA  K P   V  G    S P  +KP     DG KW +EY  N  D+++ +  +   +Y+F+C+ S + +KGKINS+VMD+C K +LVFD ++SS + VNC+SVQ Q LG +PT++IDKTDG Q+YLS +SL  EIVS+KSSEMN+++PK   G+ +E  +PEQFKT + G  L T C
Sbjct:    2 AMTIDAYQDIMQGPLASFLQLSNKIGGEVATHAQFVKEAFDAQFEFLKTVAVSSQPSNADLQSMLKPTSDKIAAIQAFREKNRTSPFFNHLSSISESIPALGWVCVAPAPAPYVKEMNDAGQFYTNRVLKDWKEKDVTHVEWARVWIQTLTELQQFIKQHHTTGLVWSGKNKPTVLGGSGAPPPPPPIGGLPPPLPIADLKLSDQD-DDRSALFAQINQGADITKGLKKVTSDMQTHKNPSLRSG---PAPYKAPPTTVTNGTRLASAPAVSKPPTFTRDGKKWLIEYQKNNTDLLVENAEMNNVVYMFRCEGSTLQIKGKINSVVMDSCKKCSLVFDTMVSSAEFVNCQSVQMQVLGKVPTISIDKTDGCQMYLSSDSLDVEIVSSKSSEMNVMIPKGTSGDYVEQPIPEQFKTVVKGTNLSTIC 423          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Cavefish
Match: cap1 (CAP, adenylate cyclase-associated protein 1 (yeast) [Source:ZFIN;Acc:ZDB-GENE-030131-6459])

HSP 1 Score: 401.749 bits (1031), Expect = 2.295e-134
Identity = 207/465 (44.52%), Postives = 293/465 (63.01%), Query Frame = 2
Query:   80 DLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEG-------------SXXXXXXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTPNK--PAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTS 1429
            +L +LV+RLE    RLE +     +G   +     S+  +  +  L+S  +  ++ +S KIGGD +  A ++++ F+ Q + L   +   KP+D+ L  LL P+S  I  + +FRE NR S  FNHLSAVSE +P LGWV +SP P P+VKEMQDA+ FYTNRV+KD+KEK+  HVDW KA+++++T+LQ ++K+H+TTGL W+  G                 P     P PPP          D ++    ALF+ +NKGS +T GLK V+DD KTHKNPNLR+ +  P  T P+    P     + P +  P  + LDG KW VE     + +V+SDT +KQ +Y FKC+NS + VKGKINSI +DNC K  LVFD ++  ++++NCK V+ Q +G +PT++I+KTDG  +YLSK+SL  EIVSAKSSEMN++VP +DG+  E+ +PEQFKT   G KLVT+
Sbjct:   95 ELASLVQRLEVAVGRLEAVSGSGGAGGSAAGTGAVSAY-VEAFDALISGPVAEYIGLSQKIGGDAQKHAEMMKQGFTCQRQLLVTASCSQKPSDATLTSLLAPVSKVIQQVQSFREQNRSSPHFNHLSAVSESVPALGWVAMSPKPGPYVKEMQDAAMFYTNRVLKDYKEKDKTHVDWVKAYLSIWTELQTYIKQHHTTGLVWNKTGPVASASGAPSAPSGGAPPPPPPGPPPPPMDLNQSAGGGDTASTNRNALFASLNKGSDITKGLKHVSDDQKTHKNPNLRSQAG-PVHTGPKPFTAPRPTATTAPARKLPPVLELDGKKWKVENQEGAQGLVISDTELKQVVYAFKCNNSTLQVKGKINSITIDNCKKMGLVFDDVVGIIEVINCKDVKVQVMGKVPTISINKTDGCHVYLSKDSLSCEIVSAKSSEMNVLVPGKDGDYTEIPVPEQFKTVWDGSKLVTT 557          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Cavefish
Match: cap2 (cyclase associated actin cytoskeleton regulatory protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1758])

HSP 1 Score: 392.119 bits (1006), Expect = 1.055e-130
Identity = 212/467 (45.40%), Postives = 291/467 (62.31%), Query Frame = 2
Query:   83 LENLVKRLETLTSRLEKLP---QLSESGDMKSVKS--NSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXXXXXSN----------DGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLR----AGSTVPAKTKPEVAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVT 1426
            +E LV+RLE    RLE +    Q    G +  V +  N  S  ++ +  LL   L  +L+ S  IGGDV   A +V+ A   Q  F+K  +T  +PA + L  LL+PIS+ I  I NFRE NR S+ FNHLSAVSE IP LGWV VS  P P+VKEM DA+ FYTNRV+KD+K+ +  HV+W ++++ ++T+LQ ++K+H+TTGL WS  G +  P   +     P PP  P P            D SA    ALF+++N+G  +T+ LK V+D  KTHKNPNLR    A  T P K K   +  P   +K +P     + L+G KW VEY     D+V+ +T +KQ +YIF C+NS I +KGK+NSI++DNC K  LVF+ ++  L+++N + +Q Q LG +PT++I+KT+G  +YLSKESL  EIVSAKSSEMNI+VP+ED +  E  +PEQFKT   G KLVT
Sbjct:   87 MEALVERLEQAVIRLEAVSSKLQGCSGGLINGVINGINGESQCMDAFDRLLKGSLSEYLKNSRTIGGDVAQHAEMVQNALQVQRTFIKMASTHQEPAQAELADLLRPISEKIEEIQNFREKNRGSQLFNHLSAVSESIPALGWVAVSQKPGPYVKEMNDAAMFYTNRVLKDYKDTDPCHVEWVRSYLNIWTELQTYIKQHHTTGLVWSKTGPVAPPSLFVAKPAGPCPPPPPPPPPPIFTDEEPKPDNSAAQRSALFAQLNQGEAITNRLKHVSDQQKTHKNPNLRSQGEAQKTSPTKGKASSSSAPTPAKKHSP----VLELEGKKWRVEYQEQTHDLVIEETELKQVVYIFSCNNSTIQIKGKVNSIIVDNCKKLGLVFENVVGILEVINSRDIQLQVLGKVPTMSINKTEGCHVYLSKESLDCEIVSAKSSEMNILVPQEDDDYREFPVPEQFKTVWDGSKLVT 549          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Cavefish
Match: cap2 (cyclase associated actin cytoskeleton regulatory protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1758])

HSP 1 Score: 387.882 bits (995), Expect = 1.569e-129
Identity = 201/440 (45.68%), Postives = 278/440 (63.18%), Query Frame = 2
Query:  149 ESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXXXXXSN----------DGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLR----AGSTVPAKTKPEVAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVT 1426
            E G+   + +   S  ++ +  LL   L  +L+ S  IGGDV   A +V+ A   Q  F+K  +T  +PA + L  LL+PIS+ I  I NFRE NR S+ FNHLSAVSE IP LGWV VS  P P+VKEM DA+ FYTNRV+KD+K+ +  HV+W ++++ ++T+LQ ++K+H+TTGL WS  G +  P   +     P PP  P P            D SA    ALF+++N+G  +T+ LK V+D  KTHKNPNLR    A  T P K K   +  P   +K +P     + L+G KW VEY     D+V+ +T +KQ +YIF C+NS I +KGK+NSI++DNC K  LVF+ ++  L+++N + +Q Q LG +PT++I+KT+G  +YLSKESL  EIVSAKSSEMNI+VP+ED +  E  +PEQFKT   G KLVT
Sbjct:   72 EPGNKPRIPAEGESQCMDAFDRLLKGSLSEYLKNSRTIGGDVAQHAEMVQNALQVQRTFIKMASTHQEPAQAELADLLRPISEKIEEIQNFREKNRGSQLFNHLSAVSESIPALGWVAVSQKPGPYVKEMNDAAMFYTNRVLKDYKDTDPCHVEWVRSYLNIWTELQTYIKQHHTTGLVWSKTGPVAPPSLFVAKPAGPCPPPPPPPPPPIFTDEEPKPDNSAAQRSALFAQLNQGEAITNRLKHVSDQQKTHKNPNLRSQGEAQKTSPTKGKASSSSAPTPAKKHSPV----LELEGKKWRVEYQEQTHDLVIEETELKQVVYIFSCNNSTIQIKGKVNSIIVDNCKKLGLVFENVVGILEVINSRDIQLQVLGKVPTMSINKTEGCHVYLSKESLDCEIVSAKSSEMNILVPQEDDDYREFPVPEQFKTVWDGSKLVT 507          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Sea Lamprey
Match: cap2 (cyclase associated actin cytoskeleton regulatory protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1758])

HSP 1 Score: 357.836 bits (917), Expect = 2.925e-119
Identity = 193/465 (41.51%), Postives = 285/465 (61.29%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEK-LPQLS--ESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTW---------SGEGSXXXXXXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSCA 1435
             DL  LV+RLE +  RLE   P  +   SGD  +         +  + +LL+  +  +L+ S  IGG+V++ A +V+ A  AQ  FL   +   +P++     LLKPIS+ +  +   RE NR S  FNHLSAVSE IP LGWV + P P  +VKEM DA+ FYTNRV+K++++ +  HV+W KA++ ++ +LQA++++++TTG+ W         +  G+L  P    PP  PPPP +      D +     ALF+EIN+G G+   LK V+D  KTHKNP LRA  +V     P+ +  P     +   +   + L+G KW VEY  N + +++ DT +KQ +Y+F+C NS++ +KGKINSI++DNC +  LVF+ ++  ++++N KSVQ Q  G +PT++I+KTDG Q++LS +SL  EIVSAKSSEMNI+VP  D +  E  +PEQFKT   G KLVT  +
Sbjct:    2 ADLNQLVERLEIVAQRLEAAFPGGTGGPSGDAINGIEEEVPPCVEAFDSLLAGPVAQYLRYSRDIGGEVESHAEMVKTALHAQRSFLVTASRSQQPSEDKTAELLKPISEKVQEVQGLRERNRGSVLFNHLSAVSESIPALGWVTMVPTPSSYVKEMNDAAMFYTNRVLKEYRDSDKRHVEWVKAFLGIWKELQAYIREYHTTGVEWKDSNPNAEEATSGALSTPPPPPPPPGPPPPLVPSLARQDSATGHRSALFAEINQGEGIARALKHVSDKEKTHKNPGLRAQGSVSRGDSPQSS--PHKALAARKQQQPVLELEGKKWRVEYQENAEGLLIEDTELKQVVYVFQCVNSMLQIKGKINSIIIDNCKRLGLVFENVVGIVEVINSKSVQLQVEGKVPTISINKTDGCQVFLSPQSLDCEIVSAKSSEMNILVPDHD-DYREFPVPEQFKTVWNGHKLVTEAS 463          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001135.1 (pep scaffold:Pmarinus_7.0:GL479310:1028:18636:1 gene:ENSPMAG00000001009.1 transcript:ENSPMAT00000001135.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 273.092 bits (697), Expect = 8.924e-88
Identity = 148/344 (43.02%), Postives = 204/344 (59.30%), Query Frame = 2
Query:  506 SPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXX----------------XXXSNDGSAD---THLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKT-----KPEVAVKPGHGQKSTP-------------NKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVT 1426
            SP P P+VKE+ DA  FYTNRV+KD+K+ +  HV+W +A+  ++TQLQA++K+H+TTG++W+  GS             P P  +                    + G+ D   +   LF++IN+G  + SGLK V+DD KTHKNP LR  +   A       KP    KPG                     +P  + LDG KW VEY  N  ++VL DT +KQ  YIF+C+NS + +KGKINSI +D+C K  LVFD ++  ++++NCKSVQ Q LG +PT++++KTDG QIYLSK+SL  EIVSAKSSEMN+++P  D +  E  +PEQFKT   G KL T
Sbjct:    3 SPKPGPYVKELNDAGTFYTNRVLKDYKDSDKNHVNWARAYSNIWTQLQAYIKEHHTTGVSWNKSGSQATAAALPSCPSAPRPVASGPPPPPPPGPPPPPGLTTAPSGGAGDAASSRSELFAQINQGEHIASGLKHVSDDQKTHKNPTLRTQAPAAAAPSHSGPKPFTTPKPGAAGAGRAAVAGASPAGAAAKKRPPVLELDGKKWRVEYHDNASNLVLKDTELKQVAYIFQCNNSTVNIKGKINSITVDSCKKLGLVFDDVVGIVELINCKSVQVQVLGKVPTISVNKTDGCQIYLSKDSLSCEIVSAKSSEMNVLIP-HDKDFKEFPIPEQFKTVWNGKKLET 345          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Yeast
Match: SRV2 (CAP (cyclase-associated protein); N-terminus binds adenylate cyclase and facilitates activation by RAS; N-terminus forms novel hexameric star-shaped shuriken structures that directly catalyze cofilin-mediated severing of actin filaments; C-terminus binds and recycles cofilin bound, ADP-actin monomers, facilitating regulation of actin dynamics and cell morphogenesis; N- and C-termini can function as physically separate proteins; mCAP1 is the mouse homolog [Source:SGD;Acc:S000005082])

HSP 1 Score: 241.506 bits (615), Expect = 1.026e-73
Identity = 152/507 (29.98%), Postives = 250/507 (49.31%), Query Frame = 2
Query:   80 DLENLVKRLETLTSRLEKLP---------QLSESGDMKSVKSNSSSVAINE------------------YANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSA--LQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXXXXX----------------------SNDGSADTHLA-------LFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAK-TKPEVAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVP-KEDGEIIEMALPEQFKTKIVGGKL 1420
            +L  L+KRLE  T+RLE +          +L  S + K   S + +   NE                  + + +   +   +++S KI   V     L++  F +QL FL+      KP  S+      L+PI++ I  +   +ESNR+S++F +LSA+SEG P+  WV V   P   V + +DA+QF+TNR++K+++E +   V+W K ++A F  L+A++K+++TTG++W  +G                                             SND  A +  A       +F+E+N+G  +T GLKKV    +THKNP LR  STV +  +K     +P         +P    L GNKW +E + N+ + ++ D +  ++++I KC   ++ +KGK+N+I +      ++V D  IS +D++       Q    LP ++IDK+DG  IYLSKESL  EI ++ S+ +N+ +P  ED + +E  +PEQ K     GK 
Sbjct:   12 NLVKLLKRLEEATARLEDVTIYQEGYIQNKLEASKNNKPSDSGADANTTNEPSAENAPEVEQDPKCITAFQSYIGENIDPLVELSGKIDTVVLDALQLLKGGFQSQLTFLRAAVRSRKPDYSSQTFADSLRPINENIIKLGQLKESNRQSKYFAYLSALSEGAPLFSWVAVD-TPVSMVTDFKDAAQFWTNRILKEYRESDPNAVEWVKKFLASFDNLKAYIKEYHTTGVSWKKDGMDFADAMAQSTKNTGATSSPSPASATAAPAPPPPPPAPPASVFEISNDTPATSSDANKGGIGAVFAELNQGENITKGLKKVDKSQQTHKNPELRQSSTVSSTGSKSGPPPRPKKPSTLKTKRPPRKELVGNKWFIENYENETESLVIDANKDESIFIGKCSQVLVQIKGKVNAISLSETESCSVVLDSSISGMDVIKSNKFGIQVNHSLPQISIDKSDGGNIYLSKESLNTEIYTSCSTAINVNLPIGEDDDYVEFPIPEQMKHSFADGKF 517          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Nematostella
Match: EDO46368 (Adenylyl cyclase-associated protein [Source:UniProtKB/TrEMBL;Acc:A7RQH5])

HSP 1 Score: 376.711 bits (966), Expect = 2.133e-126
Identity = 218/466 (46.78%), Postives = 293/466 (62.88%), Query Frame = 2
Query:   71 MSCDLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEG------------SXXXXXXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINK-GSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTS 1429
            M+ +L+ LV RLE +TSRLE +   S SG     ++N   V+   Y   LS  +   L+IS +IGGDV +QA LV++AF AQ +FL   +    P+ + LQ LL   S AI ++  FRE NRRS +FNHLS+ SEGIP LGWV V      FV EM  +++FY NRV+KDFKEK+  HV+W K+  A+F  L+ ++ + + +GLTW+  G            + P      PP PPP        + DG   T  ALFSEINK G+ + SGL+KVTDD KTHKNPNLRA S V  K KP +A KP     +   KP    L G KW VE+    K++ + + S+ Q +YI+ C +SV+ +KGKINSI +DNC K A+VFD  I++++ VNC+SVQ Q  G +PTV+IDKTDG Q+YLSK+SL +EIV+AKSSEMNI+V + DG+ +E  LPEQ+K+   G   VT+
Sbjct:    1 MAGNLDPLVVRLEAVTSRLEAMASKSGSGGSGGTEANEEIVSF--YDKFLSESVAKCLKISSEIGGDVGSQAKLVDQAFKAQRDFLVLVSKHQCPSANVLQTLLTKTSQAISAVQEFREKNRRSNYFNHLSSWSEGIPALGWVTVVKG-ANFVNEMNGSAEFYLNRVLKDFKEKDAKHVEWVKSVKAIFVALKEYINEFHKSGLTWNQSGPPAPTSVPSGPRAPPGGPGAPPPPPPPAVVPPSAVTTDGKPAT-AALFSEINKAGTNIASGLRKVTDDQKTHKNPNLRASSVVKDKPKPTIAKKP----VAVTKKPPVFELQGKKWMVEHQEGNKNLTI-EGSMSQVVYIYSCKDSVVIIKGKINSITLDNCKKCAVVFDDAIATVEFVNCQSVQCQVNGKVPTVSIDKTDGCQVYLSKDSLQSEIVTAKSSEMNILVQQADGDYVENPLPEQYKSVWDGKAFVTT 457          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Nematostella
Match: EDO42879 (Adenylyl cyclase-associated protein [Source:UniProtKB/TrEMBL;Acc:A7S004])

HSP 1 Score: 158.303 bits (399), Expect = 4.121e-45
Identity = 82/203 (40.39%), Postives = 120/203 (59.11%), Query Frame = 2
Query:   80 DLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTW 688
            + E LV++LE+ T R+E   +L   GD     +   S ++  +  +L+ +L  F Q+  +IGGDVK QAAL+++AF+AQ EFL   +  G+     +   LK  SD I  +  F  S+R S+ FNHLS VSEG+  L WV     P  FVKE  DA+QFYTNRV+KDFK+K   H +W +  +    QL+ +V+ H++  L+W
Sbjct:   40 EFEKLVQQLESATVRIES--RLKTPGDA----NGDGSPSVQGFDQVLNDKLAKFFQLCYEIGGDVKDQAALMKEAFTAQREFLVWVSGRGRQPQDVMSTKLKSTSDKISEVQAFCNSHRGSKQFNHLSGVSEGVAALAWVAAPGKPSSFVKEKCDAAQFYTNRVLKDFKDKEPKHAEWARGLIGALKQLEEYVRDHHSVTLSW 236          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Medaka
Match: cap1 (cyclase associated actin cytoskeleton regulatory protein 1 [Source:NCBI gene;Acc:101166064])

HSP 1 Score: 406.757 bits (1044), Expect = 1.585e-137
Identity = 213/473 (45.03%), Postives = 299/473 (63.21%), Query Frame = 2
Query:   77 CDLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXXXXXSNDGS-------------ADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTPNK--------PAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSC 1432
             +L +LV+RLE    RLE +               + S  +  +  ++S  L  +L +S +IGGDV+  A ++++AF++Q + L   +   KP+D+ L  L++P+S AI  +  FRE NR S  FNHLSAVSE +P LGWV ++P P P+VKEMQDA+ FYTNRV+KD+KEK+ +HVDW KA+++++T+LQ ++K+H+TTGLTWS  G +       PP   P PP    P                  ADT  ALF+ INKG+ +T GLK V+D+ KTHKNP LR G+T P ++ P    KP +G  S P          P  + L+G KW VE     +++V+SDT +KQ +Y FKC+NS + VKGKINSI MDNC K  LVF+  +  ++++NCK V+ Q  G +PT++I+KTDG  +YLSK+SL  E+VSAKSSEMN++VP +DGE  E+ +PEQFKT   G KLVT+ 
Sbjct:    2 AELASLVQRLELAVGRLEAM-SGPGGSSTGGSAGGAVSAYVEAFDGIVSGPLAQYLSLSQQIGGDVQKHAEMMKQAFASQRQLLITASNSQKPSDNVLATLMQPVSKAIQQVQAFREQNRTSPLFNHLSAVSESVPALGWVAMAPKPGPYVKEMQDAAMFYTNRVLKDYKEKDKMHVDWVKAYVSIWTELQNYIKEHHTTGLTWSKTGPVASSSAAPPPGGCPAPPPPGPPPPPPPADLSGSSSGGGGGADTRNALFASINKGADITKGLKHVSDNEKTHKNPGLR-GNTGPVRSGP----KP-YGSTSQPAASSAPVRKLPPVLELEGKKWKVENQEGAQNLVISDTELKQVVYAFKCNNSTLQVKGKINSITMDNCKKMGLVFEDAVGIVEVINCKDVKIQVTGKVPTISINKTDGCHVYLSKDSLSCELVSAKSSEMNVLVPNKDGEFTELPVPEQFKTVWDGQKLVTTA 467          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Medaka
Match: cap2 (cyclase associated actin cytoskeleton regulatory protein 2 [Source:NCBI gene;Acc:101163913])

HSP 1 Score: 386.726 bits (992), Expect = 1.013e-129
Identity = 208/467 (44.54%), Postives = 296/467 (63.38%), Query Frame = 2
Query:   83 LENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSV-----AINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXXXXXS-------------NDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTPNKPAEM-RLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVT 1426
            +E+L++RLE   +RLE    +S S    +  +N + V     A++ +  LL   +  +L+ S  IG +V+  A +V+ A   +  FLK   T  +PA + LQ LLKPISD I  I NFRE NR S  FNHLSAVSE IP LGWV VS  P P+VKEM DA+ FYTNRV+KD+KE +  HVDW  +++ ++T++Q+F+K+H+TTGL WS  G +         +P PPPP  P P               DG+A  H  LF+++N+G G+T GLK V D+ KTHKNPNL+  ++      P     P +   +T +K + +  L+G KW VE+F  K D+V+ +T +KQ +Y+F C+N+ + VKGKINSI++DNC K  LVF+  +  ++I+N  +VQ Q LG +PT++I+KT+G Q+YLSKE+L  +IVSAKSSEMNI++P+ + +  E  +PEQFKT   G KLVT
Sbjct:    1 MEDLIQRLEQAVTRLE---HVSTSMQDSNTMTNGTCVNGLDQAVSHFDVLLGGPVSDYLKYSRAIGREVEKHAEMVKTALQTERTFLKMAATHQEPAKTELQDLLKPISDHIQEIQNFREQNRGSCLFNHLSAVSESIPALGWVAVSQKPGPYVKEMNDAAIFYTNRVLKDYKEIDKRHVDWVHSYLLIWTEMQSFIKQHHTTGLVWSKTGPIAPTSILDFTSPCPPPPPPPPPGPPPVLSDDDGKPHGDGAAAQHSELFAQLNQGVGITKGLKHVKDEQKTHKNPNLKGQASPTTSNTP----SPANPSTATIHKRSPLLELEGKKWRVEHFEQKHDLVIEETELKQVVYVFSCNNTTLQVKGKINSIIVDNCKKLGLVFENAVGIVEIINSNAVQLQVLGTVPTISINKTEGCQVYLSKEALNCDIVSAKSSEMNILIPEGEDDYREFPVPEQFKTVWDGSKLVT 460          
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Medaka
Match: cap2 (cyclase associated actin cytoskeleton regulatory protein 2 [Source:NCBI gene;Acc:101163913])

HSP 1 Score: 357.066 bits (915), Expect = 1.342e-118
Identity = 201/464 (43.32%), Postives = 285/464 (61.42%), Query Frame = 2
Query:   83 LENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPAD--SALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXXXXXS-------------NDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTPNKPAEM-RLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVT 1426
            +E+L++RLE   +RLE    +S S    +  +N + V      N L   + HF  +   +GG V               ++LK +   G+  +  + LQ LLKPISD I  I NFRE NR S  FNHLSAVSE IP LGWV VS  P P+VKEM DA+ FYTNRV+KD+KE +  HVDW  +++ ++T++Q+F+K+H+TTGL WS  G +         +P PPPP  P P               DG+A  H  LF+++N+G G+T GLK V D+ KTHKNPNL+  ++      P     P +   +T +K + +  L+G KW VE+F  K D+V+ +T +KQ +Y+F C+N+ + VKGKINSI++DNC K  LVF+  +  ++I+N  +VQ Q LG +PT++I+KT+G Q+YLSKE+L  +IVSAKSSEMNI++P+ + +  E  +PEQFKT   G KLVT
Sbjct:    1 MEDLIQRLEQAVTRLE---HVSTSMQDSNTMTNGTCV------NGLDQAVSHFDVL---LGGPVS--------------DYLKYSRAIGREVEKHTELQDLLKPISDHIQEIQNFREQNRGSCLFNHLSAVSESIPALGWVAVSQKPGPYVKEMNDAAIFYTNRVLKDYKEIDKRHVDWVHSYLLIWTEMQSFIKQHHTTGLVWSKTGPIAPTSILDFTSPCPPPPPPPPPGPPPVLSDDDGKPHGDGAAAQHSELFAQLNQGVGITKGLKHVKDEQKTHKNPNLKGQASPTTSNTP----SPANPSTATIHKRSPLLELEGKKWRVEHFEQKHDLVIEETELKQVVYVFSCNNTTLQVKGKINSIIVDNCKKLGLVFENAVGIVEIINSNAVQLQVLGTVPTISINKTEGCQVYLSKEALNCDIVSAKSSEMNILIPEGEDDYREFPVPEQFKTVWDGSKLVT 434          
BLAST of Adenylyl cyclase-associated protein vs. Planmine SMEST
Match: SMESG000032321.1 (SMESG000032321.1)

HSP 1 Score: 813.913 bits (2101), Expect = 0.000e+0
Identity = 430/455 (94.51%), Postives = 435/455 (95.60%), Query Frame = 2
Query:   71 MSCDLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSCA 1435
            MSCDLENLVKRLET+TSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQ      S+   ++ NFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVI DFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSLPKPMTCLPPAPPP  P     SNDGSADTHL LFS+INKGSGVT GLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSCA
Sbjct:    1 MSCDLENLVKRLETITSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLLSSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSALQHY----SNLFLTLLNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIIDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSLPKPMTCLPPAPPPMAPKP---SNDGSADTHLVLFSDINKGSGVTRGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKLVTSCA 448          
BLAST of Adenylyl cyclase-associated protein vs. Planmine SMEST
Match: SMESG000000386.1 (SMESG000000386.1)

HSP 1 Score: 62.3882 bits (150), Expect = 4.665e-10
Identity = 67/348 (19.25%), Postives = 143/348 (41.09%), Query Frame = 2
Query:  467 VSEGIPVLGWVGVSPAPCPFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHYTTGLTWSGEGSXXXXXXXXXXXXXXXXXXXXXXSNDGSADTHLALFSEINKGSGV-TSGLKKVTDDMKTHKNPNLRAGSTVPAKTK-------------------PEVAVKPGHGQKSTPNKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGKINSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGAQIYLSKESLGAEIV-SAKSSEMNIVVPKEDGEIIEMALPEQF------KTKIVGGKLVTS 1429
            +++ I + GW+ V   P  FV+ + D       R++ D   + + + +W K+W     +    V K++   L W   G +P  +                  N    +T L L  + +KG  V T+  + ++ +  T+   +LR+G    AK K                   P   + P   +     K        N W +E   ++ DI +   S   ++ +  C N  + + G   S+ ++NC+   LVFD +  S  +++  +++ Q  G +  V++      ++++   S+    + ++ S+++ + V K +G  +E+    +F      +TK    +++T+
Sbjct:  254 IADSIVIFGWICVFERPGLFVQNILDGILINITRLLSD--NRWIKYANWLKSWAVFLKKFSLIVIKNFQASLIWGINGPVPMNILKCLIE-----------CNYSVNETELTL-QKRSKGVIVKTTTAENISCETMTNLMSDLRSGCQ-KAKLKSVRSETIEFSEHMEMGNGLPTTELIPKIHETKETLKTVNYIFTRNMWIIEGSKDEPDIEVHCKSKDDSISMVNCCNCSVQINGMAKSVKLENCSSINLVFDEITESFLVIHSTNIECQVFGRISKVDLKSVVKCRLFIPIISMKTLTIGTSVSTDVELYVCKSEGIGLELDDYNKFVVEPNAQTKFSDNQMITT 586          
The following BLAST results are available for this feature:
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAP24.811e-13043.45cyclase associated actin cytoskeleton regulatory p... [more]
CAP16.574e-12844.59cyclase associated actin cytoskeleton regulatory p... [more]
CAP16.574e-12844.59cyclase associated actin cytoskeleton regulatory p... [more]
CAP16.574e-12844.59cyclase associated actin cytoskeleton regulatory p... [more]
CAP11.762e-12744.68cyclase associated actin cytoskeleton regulatory p... [more]
back to top
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cas-12.564e-11340.21Adenylyl cyclase-associated protein [Source:UniPr... [more]
cas-12.564e-11340.21Adenylyl cyclase-associated protein [Source:UniPr... [more]
cas-12.812e-10342.11Adenylyl cyclase-associated protein [Source:UniPr... [more]
cas-21.807e-9339.87Adenylyl cyclase-associated protein [Source:UniPr... [more]
cas-21.807e-9339.87Adenylyl cyclase-associated protein [Source:UniPr... [more]
back to top
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
capt5.212e-13146.90gene:FBgn0261458 transcript:FBtr0100022[more]
capt5.212e-13146.90gene:FBgn0261458 transcript:FBtr0332274[more]
capt1.517e-12743.57gene:FBgn0261458 transcript:FBtr0100023[more]
back to top
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cap11.116e-13747.17CAP, adenylate cyclase-associated protein 1 (yeast... [more]
cap22.915e-12743.54cyclase associated actin cytoskeleton regulatory p... [more]
cap22.915e-12743.54cyclase associated actin cytoskeleton regulatory p... [more]
cap11.182e-6248.29CAP, adenylate cyclase-associated protein 1 (yeast... [more]
back to top
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tex261.097e-12142.36testis expressed 26 [Source:Xenbase;Acc:XB-GENE-97... [more]
tex263.997e-11942.07testis expressed 26 [Source:Xenbase;Acc:XB-GENE-97... [more]
tex263.027e-11741.79testis expressed 26 [Source:Xenbase;Acc:XB-GENE-97... [more]
CAP22.835e-11640.52cyclase associated actin cytoskeleton regulatory p... [more]
CAP24.503e-11541.13cyclase associated actin cytoskeleton regulatory p... [more]
back to top
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cap18.792e-12644.37CAP, adenylate cyclase-associated protein 1 (yeast... [more]
Cap18.792e-12644.37CAP, adenylate cyclase-associated protein 1 (yeast... [more]
Cap18.792e-12644.37CAP, adenylate cyclase-associated protein 1 (yeast... [more]
Cap21.702e-12441.97CAP, adenylate cyclase-associated protein, 2 (yeas... [more]
Cap21.541e-12144.10CAP, adenylate cyclase-associated protein, 2 (yeas... [more]
back to top
BLAST of Adenylyl cyclase-associated protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P40123|CAP2_HUMAN2.310e-12943.45Adenylyl cyclase-associated protein 2 OS=Homo sapi... [more]
sp|Q5R5X8|CAP2_PONAB9.969e-12943.24Adenylyl cyclase-associated protein 2 OS=Pongo abe... [more]
sp|Q3SYV4|CAP1_BOVIN5.713e-12844.85Adenylyl cyclase-associated protein 1 OS=Bos tauru... [more]
sp|P52481|CAP2_RAT3.086e-12742.41Adenylyl cyclase-associated protein 2 OS=Rattus no... [more]
sp|Q01518|CAP1_HUMAN3.157e-12744.59Adenylyl cyclase-associated protein 1 OS=Homo sapi... [more]
back to top
BLAST of Adenylyl cyclase-associated protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1FYH61.564e-14948.73Adenylyl cyclase-associated protein OS=Helobdella ... [more]
A0A212F1V68.648e-14549.67Adenylyl cyclase-associated protein OS=Danaus plex... [more]
A0A2C9JF048.948e-14147.68Adenylyl cyclase-associated protein OS=Biomphalari... [more]
D6W6L72.048e-14047.59Adenylyl cyclase-associated protein OS=Tribolium c... [more]
A0A2M4A5W12.218e-14049.77Adenylyl cyclase-associated protein OS=Anopheles t... [more]
back to top
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cap12.295e-13444.52CAP, adenylate cyclase-associated protein 1 (yeast... [more]
cap21.055e-13045.40cyclase associated actin cytoskeleton regulatory p... [more]
cap21.569e-12945.68cyclase associated actin cytoskeleton regulatory p... [more]
back to top
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cap22.925e-11941.51cyclase associated actin cytoskeleton regulatory p... [more]
ENSPMAT00000001135.18.924e-8843.02pep scaffold:Pmarinus_7.0:GL479310:1028:18636:1 ge... [more]
back to top
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SRV21.026e-7329.98CAP (cyclase-associated protein); N-terminus binds... [more]
back to top
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO463682.133e-12646.78Adenylyl cyclase-associated protein [Source:UniPr... [more]
EDO428794.121e-4540.39Adenylyl cyclase-associated protein [Source:UniPr... [more]
back to top
BLAST of Adenylyl cyclase-associated protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cap11.585e-13745.03cyclase associated actin cytoskeleton regulatory p... [more]
cap21.013e-12944.54cyclase associated actin cytoskeleton regulatory p... [more]
cap21.342e-11843.32cyclase associated actin cytoskeleton regulatory p... [more]
back to top
BLAST of Adenylyl cyclase-associated protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000032321.10.000e+094.51SMESG000032321.1[more]
SMESG000000386.14.665e-1019.25SMESG000000386.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034315 ID=SMED30034315|Name=Adenylyl cyclase-associated protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1568bp
TATTTCAGGAAAAGAAATAAAGAACATATTCTAATATAATTTATTATAGA
TTTTGTAAAGCGCATAGTATATGTCCTGTGATTTAGAGAATTTAGTTAAA
AGATTAGAAACTCTTACGAGCCGATTAGAAAAACTACCCCAATTATCAGA
AAGTGGTGATATGAAATCTGTTAAATCTAATTCAAGTAGCGTTGCTATTA
ACGAGTACGCAAATTTGTTAAGTAGTGAGTTGCATCATTTTCTGCAAATC
AGTGACAAAATTGGCGGAGATGTTAAAACTCAGGCTGCGCTTGTAGAAAA
AGCATTTTCCGCTCAATTGGAATTTTTGAAAAAAACTACGACATGTGGTA
AACCCGCGGATTCAGCATTGCAACCATTACTCAAACCTATTTCTGACGCT
ATTGGTAGTATTACAAATTTTCGAGAATCCAATCGTCGCAGCGAATTTTT
TAATCATTTAAGTGCTGTGAGTGAAGGTATTCCGGTTTTAGGTTGGGTTG
GAGTAAGTCCTGCACCTTGCCCATTTGTCAAAGAAATGCAAGATGCCAGC
CAATTCTATACTAATAGAGTTATTAAAGATTTCAAAGAAAAAAATGTAAT
TCATGTTGATTGGACTAAAGCCTGGATGGCTGTGTTCACACAATTGCAAG
CGTTTGTAAAGAAGCATTATACAACCGGATTGACTTGGAGTGGTGAGGGT
TCTCTACCAAAACCAATGACATGTTTACCTCCTGCACCGCCACCGCCGCC
ACCAATGACTCCCAAACCATCAAACGATGGATCTGCCGATACACATTTGG
CTTTATTCTCAGAAATCAATAAAGGATCCGGTGTGACTAGTGGACTCAAG
AAAGTAACTGATGACATGAAAACCCACAAAAATCCAAATCTAAGAGCCGG
CTCTACTGTTCCGGCAAAGACTAAACCTGAAGTGGCTGTCAAACCGGGAC
ATGGACAAAAATCAACTCCAAACAAACCCGCAGAAATGAGATTGGATGGA
AATAAATGGACAGTGGAATATTTCCACAATAAAAAGGATATCGTGTTGTC
CGACACCTCAATCAAGCAGACATTATACATTTTCAAATGTGACAACAGCG
TTATTACCGTTAAAGGAAAGATCAATTCAATAGTTATGGACAATTGCACA
AAATCTGCTCTCGTATTTGATGGGCTTATATCTTCATTGGATATCGTCAA
TTGTAAGAGCGTACAAGCACAGACCCTCGGCGTTCTTCCAACTGTGAACA
TCGATAAAACTGACGGCGCTCAAATTTATTTAAGCAAAGAATCACTTGGT
GCGGAAATTGTGTCAGCTAAATCATCGGAAATGAACATCGTCGTACCTAA
GGAGGATGGAGAAATAATAGAAATGGCTCTCCCGGAACAATTCAAAACTA
AAATTGTTGGAGGAAAGTTGGTCACTTCGTGTGCCGAAGATTTTTAGGAA
ATTTTTTTCGCGGAATTTTTTTTATTTCAATAATAATTTAGCATGGCTTA
GCAATTATTAATTGTGATTTTTTAATGCTTTGATTTATAATAAACTTGTT
TTTTTGTTTAAAAAAAAA
back to top

protein sequence of SMED30034315-orf-1

>SMED30034315-orf-1 ID=SMED30034315-orf-1|Name=SMED30034315-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=459bp
MSCDLENLVKRLETLTSRLEKLPQLSESGDMKSVKSNSSSVAINEYANLL
SSELHHFLQISDKIGGDVKTQAALVEKAFSAQLEFLKKTTTCGKPADSAL
QPLLKPISDAIGSITNFRESNRRSEFFNHLSAVSEGIPVLGWVGVSPAPC
PFVKEMQDASQFYTNRVIKDFKEKNVIHVDWTKAWMAVFTQLQAFVKKHY
TTGLTWSGEGSLPKPMTCLPPAPPPPPPMTPKPSNDGSADTHLALFSEIN
KGSGVTSGLKKVTDDMKTHKNPNLRAGSTVPAKTKPEVAVKPGHGQKSTP
NKPAEMRLDGNKWTVEYFHNKKDIVLSDTSIKQTLYIFKCDNSVITVKGK
INSIVMDNCTKSALVFDGLISSLDIVNCKSVQAQTLGVLPTVNIDKTDGA
QIYLSKESLGAEIVSAKSSEMNIVVPKEDGEIIEMALPEQFKTKIVGGKL
VTSCAEDF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001756somitogenesis
GO:0008078mesodermal cell migration
GO:0007010cytoskeleton organization
GO:0000902cell morphogenesis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036222CAP_N_sf
IPR001837Adenylate_cyclase-assoc_CAP
IPR036223CAP_C_sf
IPR006599CARP_motif
IPR013992Adenylate_cyclase-assoc_CAP_N
IPR016098CAP/MinC_C
IPR013912Adenylate_cyclase-assoc_CAP_C
IPR018106CAP_CS_N
IPR017901C-CAP_CF_C-like
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006599CARP motifSMARTSM00673carpcoord: 182..219
e-value: 7.1E-7
score: 38.8
coord: 220..257
e-value: 1.0E-6
score: 38.3
IPR013992Adenylate cyclase-associated CAP, N-terminalPFAMPF01213CAP_Ncoord: 1..124
e-value: 1.8E-43
score: 149.2
IPR016098Cyclase-associated protein CAP/septum formation inhibitor MinC, C-terminalGENE3DG3DSA:2.160.20.70coord: 145..299
e-value: 3.4E-63
score: 213.7
IPR036222Adenylate cyclase-associated CAP, N-terminal domain superfamilyGENE3DG3DSA:1.25.40.330coord: 1..56
e-value: 2.4E-19
score: 71.7
IPR036222Adenylate cyclase-associated CAP, N-terminal domain superfamilySUPERFAMILYSSF101278N-terminal domain of adenylylcyclase associated protein, CAPcoord: 1..70
IPR013912Adenylate cyclase-associated CAP, C-terminalPFAMPF08603CAP_Ccoord: 144..298
e-value: 4.7E-63
score: 211.5
IPR001837Adenylate cyclase-associated CAPPANTHERPTHR10652ADENYLYL CYCLASE-ASSOCIATED PROTEINcoord: 1..298
IPR017901C-CAP/cofactor C-like domainPROSITEPS51329C_CAP_COFACTOR_Ccoord: 142..281
score: 42.398
IPR036223Adenylate cyclase-associated CAP, C-terminal superfamilySUPERFAMILYSSF69340C-terminal domain of adenylylcyclase associated proteincoord: 145..297