Exportin-4

Overview
NameExportin-4
Smed IDSMED30034303
Length (bp)4222
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Exportin-4 (SMED30034303) t-SNE clustered cells

Violin plots show distribution of expression levels for Exportin-4 (SMED30034303) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Exportin-4 (SMED30034303) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Exportin-4 (SMED30034303) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034303

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30034303h1SMcG0006896 SmedASXL_016728SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior sideSMED30034303h1SMcG0006896 dd_Smed_v4_10330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30034303h1SMcG0006896 dd_Smed_v4_10330_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Exportin-4 vs. Ensembl Human
Match: XPO4 (exportin 4 [Source:HGNC Symbol;Acc:HGNC:17796])

HSP 1 Score: 73.9442 bits (180), Expect = 2.057e-12
Identity = 121/614 (19.71%), Postives = 250/614 (40.72%), Query Frame = 1
Query: 1645 KLFEHFLQAHLVAPDGFRNITPECDIVVIETXXXXXXXXXXXXXKKAYESGLYAAGFAALQCIRNSLCDLSGLLHNRMLYLENVVFSG-----GNPSFS---------LLEDLHWLLSIIGYTIFNVTDDLISQNRLI----------YTRHVDCSDLRSIYGHSKEQLRSMLARESNKTDACDRIVKQYQSLLINGCSEIERGLENFRYSFDMDLNCCDDIIRLFYLTLRSLAFSIQHCESGQLMADFMWLMNRWMLGYIQLLDDCENPELSDVIVLAVFVRGELGKVCHQKVISICMKMINICIVKWNQDPTVMQSVINLMLNITCSLSIARLLLVSDVWMNEMSRAIVYAAPPYNSMNDVTFSQLITS-VMNVASATSTEEQLNTYLAILDPIGARLTKLFSSPDITKVSESEIMTCLAFIRGMVMTKWPSRLSRITSQWSMD-YRRLFDTLYPWLEKGVEILCKHYLHCTAVIQXXXXXXXXXXXXXXXXXXXXQTTKFYLLNMNIFRLYSTKTFGISSTNNIAKEETITEIKYIFTIASELLSRQVFDEFDLDD---SHDKEK-----VLGYDVIAQLIFQLAPFISSDVLEVPEVGTVFFQCITLVTE 3384
            ++F  ++Q HL APDG RN+T       + + ++    +++EDD+  +   L + G        + +  L+ LL  R+  L   +         +P  S         L ED+HWL+ + GY +    DD   +  LI          ++  VD +    I G   E+  S+     N+TD+  R++                                  I+R+  +  R++   + H  S Q+  D +W + RW   Y+ L+D+    +L D I L             Q +I   ++ +   +  W+ +  +    + L++ +      A L++  + W N +++     +PP N ++      L+ + V+   +   TE +   +  +L P+  R  ++ +  +  ++ + E +          +T     L  I     +D    LF+ L  +L   + ++ + Y +    + L++E  +E++   +  L +S+    Y   + + ++YS    G    +  A+EE   ++  I  + + LLS++  D  D D+    H+  +     V   DV+   +  + P +S D+L+ P +   +++ IT + E
Sbjct:  431 QVFNSYIQCHLAAPDGTRNLTANG----VASREEEEISELQEDDRDQFSDQLASVGMLGRIAAEHCIPLLTSLLEERVTRLHGQLQRHQQQLLASPGSSTVDNKMLDDLYEDIHWLILVTGYLL---ADDTQGETPLIPPEIMEYSIKHSSEVDINTTLQILGSPGEKASSIPGY--NRTDSVIRLLSA--------------------------------ILRVSEVESRAIRADLTHLLSPQMGKDIVWFLKRWAKTYL-LVDE----KLYDQISLPFSTAFGADTEGSQWIIGYLLQKVISNLSVWSSEQDLANDTVQLLVTLVERRERANLVIQCENWWN-LAKQFASRSPPLNFLSSPVQRTLMKALVLGGFAHMDTETKQQYWTEVLQPLQQRFLRVINQENFQQMCQQEEVK-------QEITATLEALCGIAEATQIDNVAILFNFLMDFLTNCIGLM-EVYKNTPETVNLIIEVFVEVAHKQICYLGESKAMNLYEACLTLLQVYSKNNLGRQRIDVTAEEEQYQDLLLIMELLTNLLSKEFIDFSDTDEVFRGHEPGQAANRSVSAADVVLYGVNLILPLMSQDLLKFPTLCNQYYKLITFICE 989          

HSP 2 Score: 53.1434 bits (126), Expect = 4.922e-6
Identity = 30/118 (25.42%), Postives = 59/118 (50.00%), Query Frame = 1
Query:  664 FEKTHLSDIFVMFLNLLNDYLSTMDSIKSEESVLFMKSVLVNLESIFSWNFLNKVLSMKLQILAKNETSRRFAPPSKWSNIITDLSIIEFLFKVHDKVRSNSQLGILSMSCIIQIAGL 1017
            F++  L  IF++ + +L ++ S  +++ ++ S +F +  L     + SWNFL   L      + ++  +    P   W   + D  ++E  F VH K+R +S +   S+ C+ Q+A L
Sbjct:  190 FQEEDLRQIFMLTVEVLQEF-SRRENLNAQMSSVFQR-YLALANQVLSWNFLPPNLGRHYIAMFESSQNVLLKPTESWRETLLDSRVMELFFTVHRKIREDSDMAQDSLQCLAQLASL 305          
BLAST of Exportin-4 vs. Ensembl Human
Match: XPO4 (exportin 4 [Source:HGNC Symbol;Acc:HGNC:17796])

HSP 1 Score: 73.559 bits (179), Expect = 2.457e-12
Identity = 121/614 (19.71%), Postives = 250/614 (40.72%), Query Frame = 1
Query: 1645 KLFEHFLQAHLVAPDGFRNITPECDIVVIETXXXXXXXXXXXXXKKAYESGLYAAGFAALQCIRNSLCDLSGLLHNRMLYLENVVFSG-----GNPSFS---------LLEDLHWLLSIIGYTIFNVTDDLISQNRLI----------YTRHVDCSDLRSIYGHSKEQLRSMLARESNKTDACDRIVKQYQSLLINGCSEIERGLENFRYSFDMDLNCCDDIIRLFYLTLRSLAFSIQHCESGQLMADFMWLMNRWMLGYIQLLDDCENPELSDVIVLAVFVRGELGKVCHQKVISICMKMINICIVKWNQDPTVMQSVINLMLNITCSLSIARLLLVSDVWMNEMSRAIVYAAPPYNSMNDVTFSQLITS-VMNVASATSTEEQLNTYLAILDPIGARLTKLFSSPDITKVSESEIMTCLAFIRGMVMTKWPSRLSRITSQWSMD-YRRLFDTLYPWLEKGVEILCKHYLHCTAVIQXXXXXXXXXXXXXXXXXXXXQTTKFYLLNMNIFRLYSTKTFGISSTNNIAKEETITEIKYIFTIASELLSRQVFDEFDLDD---SHDKEK-----VLGYDVIAQLIFQLAPFISSDVLEVPEVGTVFFQCITLVTE 3384
            ++F  ++Q HL APDG RN+T       + + ++    +++EDD+  +   L + G        + +  L+ LL  R+  L   +         +P  S         L ED+HWL+ + GY +    DD   +  LI          ++  VD +    I G   E+  S+     N+TD+  R++                                  I+R+  +  R++   + H  S Q+  D +W + RW   Y+ L+D+    +L D I L             Q +I   ++ +   +  W+ +  +    + L++ +      A L++  + W N +++     +PP N ++      L+ + V+   +   TE +   +  +L P+  R  ++ +  +  ++ + E +          +T     L  I     +D    LF+ L  +L   + ++ + Y +    + L++E  +E++   +  L +S+    Y   + + ++YS    G    +  A+EE   ++  I  + + LLS++  D  D D+    H+  +     V   DV+   +  + P +S D+L+ P +   +++ IT + E
Sbjct:  431 QVFNSYIQCHLAAPDGTRNLTANG----VASREEEEISELQEDDRDQFSDQLASVGMLGRIAAEHCIPLLTSLLEERVTRLHGQLQRHQQQLLASPGSSTVDNKMLDDLYEDIHWLILVTGYLL---ADDTQGETPLIPPEIMEYSIKHSSEVDINTTLQILGSPGEKASSIPGY--NRTDSVIRLLSA--------------------------------ILRVSEVESRAIRADLTHLLSPQMGKDIVWFLKRWAKTYL-LVDE----KLYDQISLPFSTAFGADTEGSQWIIGYLLQKVISNLSVWSSEQDLANDTVQLLVTLVERRERANLVIQCENWWN-LAKQFASRSPPLNFLSSPVQRTLMKALVLGGFAHMDTETKQQYWTEVLQPLQQRFLRVINQENFQQMCQQEEVK-------QEITATLEALCGIAEATQIDNVAILFNFLMDFLTNCIGLM-EVYKNTPETVNLIIEVFVEVAHKQICYLGESKAMNLYEACLTLLQVYSKNNLGRQRIDVTAEEEQYQDLLLIMELLTNLLSKEFIDFSDTDEVFRGHEPGQAANRSVSAADVVLYGVNLILPLMSQDLLKFPTLCNQYYKLITFICE 989          

HSP 2 Score: 53.5286 bits (127), Expect = 3.787e-6
Identity = 30/118 (25.42%), Postives = 59/118 (50.00%), Query Frame = 1
Query:  664 FEKTHLSDIFVMFLNLLNDYLSTMDSIKSEESVLFMKSVLVNLESIFSWNFLNKVLSMKLQILAKNETSRRFAPPSKWSNIITDLSIIEFLFKVHDKVRSNSQLGILSMSCIIQIAGL 1017
            F++  L  IF++ + +L ++ S  +++ ++ S +F +  L     + SWNFL   L      + ++  +    P   W   + D  ++E  F VH K+R +S +   S+ C+ Q+A L
Sbjct:  190 FQEEDLRQIFMLTVEVLQEF-SRRENLNAQMSSVFQR-YLALANQVLSWNFLPPKLGRHYIAMFESSQNVLLKPTESWRETLLDSRVMELFFTVHRKIREDSDMAQDSLQCLAQLASL 305          
BLAST of Exportin-4 vs. Ensembl Celegans
Match: Y69A2AR.16 (pep chromosome:WBcel235:IV:2497801:2530296:1 gene:WBGene00022087.1 transcript:Y69A2AR.16a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y69A2AR.16)

HSP 1 Score: 67.781 bits (164), Expect = 5.348e-11
Identity = 67/302 (22.19%), Postives = 129/302 (42.72%), Query Frame = 1
Query:  112 NDERKKVENLIQKYKKSYSIDAFTHVLNNTTNEMLIYETLAAYGDTVINNWSDFAIETQVNTYSCESTSNNNIKDLKPSPQLNQVVLGLMEWTLANQLRLSHSVWSQAIINLTKMIKKSYSEKINIFLEQFMNKVNGFLRLPQLKSKIIGLDMINGLLEVFSSLKITNQQLKISRNSEIKLRNEFEKTHLSDIFVMFLNLLNDYLSTMDSIKSEESVLFMKSVLVNLESIFSWNFLNKVLSMKLQILAKNETSRRFAPPSKWSNIITDLSIIEFLFKVHDKVRSNSQLGILSMSCIIQIAGL 1017
            ++ R++V    +  KK  SI+    +L  + N  ++++   A G+ V+ +W+   IE                      P   Q+    +   +A  L L   V    + +   +IK+   +  +   E+    ++  L       +  G   I+ L+E FSS    N +  I+ +  ++ ++ FE   L  +  M L  L+   +  D + +  +       L   E+I SWNF +K+     + L+ +++S  F PP  W +++ +       FK+H K+R +  L   SM+C+IQ+A L
Sbjct:   22 SEAREQVTFFFEDLKKKISINECLILLRESKNPFVLFQIGQAIGEIVLRDWA--LIE----------------------PSDVQIAYKTLLEFVATSLSLESYVVGACLKSAAMIIKRGILDGKSGDQEELYQFIHQMLTNESSTVQAAGCLFISALIEQFSS-AWRNSKFSITWDFHLQAKSTFENNGLRRLLEMSLTTLHALSNQEDIVGNAFTSRLCDRFLEVSENILSWNFSSKLYR---RFLSNHQSSTSFRPPISWKDLLENDEFFILFFKLHSKIRHDETLCTKSMNCLIQLASL 295          
BLAST of Exportin-4 vs. Ensembl Celegans
Match: Y69A2AR.16 (pep chromosome:WBcel235:IV:2504327:2530296:1 gene:WBGene00022087.1 transcript:Y69A2AR.16b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y69A2AR.16)

HSP 1 Score: 54.299 bits (129), Expect = 6.585e-7
Identity = 26/75 (34.67%), Postives = 44/75 (58.67%), Query Frame = 1
Query:  793 ESIFSWNFLNKVLSMKLQILAKNETSRRFAPPSKWSNIITDLSIIEFLFKVHDKVRSNSQLGILSMSCIIQIAGL 1017
            E+I SWNF +K+     + L+ +++S  F PP  W +++ +       FK+H K+R +  L   SM+C+IQ+A L
Sbjct:   33 ENILSWNFSSKLYR---RFLSNHQSSTSFRPPISWKDLLENDEFFILFFKLHSKIRHDETLCTKSMNCLIQLASL 104          
BLAST of Exportin-4 vs. Ensembl Zebrafish
Match: xpo4 (exportin 4 [Source:NCBI gene;Acc:324342])

HSP 1 Score: 74.7146 bits (182), Expect = 7.419e-13
Identity = 123/660 (18.64%), Postives = 275/660 (41.67%), Query Frame = 1
Query: 1645 KLFEHFLQAHLVAPDGFRNITPECDIVVIETXXXXXXXXXXXXXKKAYESGLYAAGFAALQCIRNSLCDLSGLLHNRMLYL-------ENVVFSGGNPSF-------SLLEDLHWLLSIIGYTIFNVTDDLISQNRLI----------YTRHVDCSDLRSIYGHSKEQLRSMLARESNKTDACDRIVKQYQSLLINGCSEIERGLENFRYSFDMDLNCCDDIIRLFYLTLRSLAFSIQHCESGQLMADFMWLMNRWMLGYIQLLDDCENPELSDVIVLAVFVRGELGKVCHQKVISICMKMINICIVKWNQDPTVMQSVINLMLNITCSLSIARLLLVSDVWMNEMSRAIVYAAPPYNSMNDVTFSQLITSVMNVASATSTEEQLNTYLA-ILDPIGARLTKLFSSPDITKVSESEIMT--CLAFIRGMVMTKWPSRLSRITSQWSMDYRRLFDTLYPWLEKGVEILCKHYLHCTAVIQXXXXXXXXXXXXXXXXXXXXQTTKFYLLNMNIFRLYSTKTFGISSTNNIAKEETITEIKYIFTIASELLSRQVFDEFDLDD--------SHDKEKVLGYDVIAQLIFQLAPFISSDVLEVPEVGTVFFQCITLVTEFKASTFLLKMNYEFNTSLLGLLRESILNSNSQISTFSLRSIISLA 3519
            ++F  ++Q HL APDG RN+T       + + ++    +++EDD++ +   L + G        + +  L+GLL +R+  L       +  + +  +P          L ED+HWL+ + GY +    DD   +  LI          ++  VD +    + G   E+  S+     N+TD+  R++                                  ++R   +  R+   S+    S Q+  D +W + RW   Y+ L+D+    ++S  +  A     E      Q ++   ++ +   +  W+ +P +    + L++ +      A +++  + W + +++     +PP + ++      L+ +++    A    +    Y A +L P+  R   L +  +  ++ + E +    +A +  +      +++  + S        LF  L  +L   + ++ + Y +    + L++E  +E++   +  L ++++ K Y + + + ++YS    G    +  A+E+   ++  I  + + LLS++  D  D D+        S     V   DV+   +  + P +S D+L+ P +   +++ IT + E      + ++  E   SL+  L   + + +S+IS   L ++  LA
Sbjct:  430 QVFNSYIQCHLAAPDGTRNLTANG----VASHEEEEINELQEDDRELFSDQLASIGMLGRIAADHCIPLLTGLLEDRVTRLHGQLQRHQQHLMAAADPDTVDRKVLDDLYEDIHWLILVSGYLL---ADDPQGETPLIPSEVMEYSIKHSTEVDINTTLQLLGSPGEKATSIPG--CNRTDSVIRLLSA--------------------------------VLRTSEVESRATRASLTQLLSPQMGKDIVWFLRRWAKTYL-LVDEKLYGQISMPLSTAFGADTEGA----QWIVGYLLEKVINNLSVWSSEPELANDTVELLVTLVEKRERANIVVQCENWWS-LAKQFASRSPPLHMLSSTVQRTLMKALVLGGFAHMDSDTKQQYWAEVLHPLQQRFLNLINQENFAQICQEEAVKQEIVATLEALCGIAEATQIDNVAS--------LFSFLMDFLSSCIGLM-EVYRNSPETVNLIIEVFVEVAHKQICYLGETKSMKLYEVCLTLLQVYSKNNLGRKRLDVAAEEDQYQDLLLIMELLTNLLSKEFIDFSDTDEVFRGQEQSSGAGRAVSAADVVLYGVNIVLPLMSQDLLKFPSLCNQYYKLITFICEIFPEK-IPQLPEELFKSLMCSLELGMTSMSSEISQLCLEALSPLA 1032          
BLAST of Exportin-4 vs. Ensembl Zebrafish
Match: xpo4 (exportin 4 [Source:NCBI gene;Acc:324342])

HSP 1 Score: 74.7146 bits (182), Expect = 7.419e-13
Identity = 123/660 (18.64%), Postives = 275/660 (41.67%), Query Frame = 1
Query: 1645 KLFEHFLQAHLVAPDGFRNITPECDIVVIETXXXXXXXXXXXXXKKAYESGLYAAGFAALQCIRNSLCDLSGLLHNRMLYL-------ENVVFSGGNPSF-------SLLEDLHWLLSIIGYTIFNVTDDLISQNRLI----------YTRHVDCSDLRSIYGHSKEQLRSMLARESNKTDACDRIVKQYQSLLINGCSEIERGLENFRYSFDMDLNCCDDIIRLFYLTLRSLAFSIQHCESGQLMADFMWLMNRWMLGYIQLLDDCENPELSDVIVLAVFVRGELGKVCHQKVISICMKMINICIVKWNQDPTVMQSVINLMLNITCSLSIARLLLVSDVWMNEMSRAIVYAAPPYNSMNDVTFSQLITSVMNVASATSTEEQLNTYLA-ILDPIGARLTKLFSSPDITKVSESEIMT--CLAFIRGMVMTKWPSRLSRITSQWSMDYRRLFDTLYPWLEKGVEILCKHYLHCTAVIQXXXXXXXXXXXXXXXXXXXXQTTKFYLLNMNIFRLYSTKTFGISSTNNIAKEETITEIKYIFTIASELLSRQVFDEFDLDD--------SHDKEKVLGYDVIAQLIFQLAPFISSDVLEVPEVGTVFFQCITLVTEFKASTFLLKMNYEFNTSLLGLLRESILNSNSQISTFSLRSIISLA 3519
            ++F  ++Q HL APDG RN+T       + + ++    +++EDD++ +   L + G        + +  L+GLL +R+  L       +  + +  +P          L ED+HWL+ + GY +    DD   +  LI          ++  VD +    + G   E+  S+     N+TD+  R++                                  ++R   +  R+   S+    S Q+  D +W + RW   Y+ L+D+    ++S  +  A     E      Q ++   ++ +   +  W+ +P +    + L++ +      A +++  + W + +++     +PP + ++      L+ +++    A    +    Y A +L P+  R   L +  +  ++ + E +    +A +  +      +++  + S        LF  L  +L   + ++ + Y +    + L++E  +E++   +  L ++++ K Y + + + ++YS    G    +  A+E+   ++  I  + + LLS++  D  D D+        S     V   DV+   +  + P +S D+L+ P +   +++ IT + E      + ++  E   SL+  L   + + +S+IS   L ++  LA
Sbjct:  430 QVFNSYIQCHLAAPDGTRNLTANG----VASHEEEEINELQEDDRELFSDQLASIGMLGRIAADHCIPLLTGLLEDRVTRLHGQLQRHQQHLMAAADPDTVDRKVLDDLYEDIHWLILVSGYLL---ADDPQGETPLIPSEVMEYSIKHSTEVDINTTLQLLGSPGEKATSIPG--CNRTDSVIRLLSA--------------------------------VLRTSEVESRATRASLTQLLSPQMGKDIVWFLRRWAKTYL-LVDEKLYGQISMPLSTAFGADTEGA----QWIVGYLLEKVINNLSVWSSEPELANDTVELLVTLVEKRERANIVVQCENWWS-LAKQFASRSPPLHMLSSTVQRTLMKALVLGGFAHMDSDTKQQYWAEVLHPLQQRFLNLINQENFAQICQEEAVKQEIVATLEALCGIAEATQIDNVAS--------LFSFLMDFLSSCIGLM-EVYRNSPETVNLIIEVFVEVAHKQICYLGETKSMKLYEVCLTLLQVYSKNNLGRKRLDVAAEEDQYQDLLLIMELLTNLLSKEFIDFSDTDEVFRGQEQSSGAGRAVSAADVVLYGVNIVLPLMSQDLLKFPSLCNQYYKLITFICEIFPEK-IPQLPEELFKSLMCSLELGMTSMSSEISQLCLEALSPLA 1032          
BLAST of Exportin-4 vs. Ensembl Zebrafish
Match: xpo4 (exportin 4 [Source:NCBI gene;Acc:324342])

HSP 1 Score: 74.3294 bits (181), Expect = 9.804e-13
Identity = 123/660 (18.64%), Postives = 275/660 (41.67%), Query Frame = 1
Query: 1645 KLFEHFLQAHLVAPDGFRNITPECDIVVIETXXXXXXXXXXXXXKKAYESGLYAAGFAALQCIRNSLCDLSGLLHNRMLYL-------ENVVFSGGNPSF-------SLLEDLHWLLSIIGYTIFNVTDDLISQNRLI----------YTRHVDCSDLRSIYGHSKEQLRSMLARESNKTDACDRIVKQYQSLLINGCSEIERGLENFRYSFDMDLNCCDDIIRLFYLTLRSLAFSIQHCESGQLMADFMWLMNRWMLGYIQLLDDCENPELSDVIVLAVFVRGELGKVCHQKVISICMKMINICIVKWNQDPTVMQSVINLMLNITCSLSIARLLLVSDVWMNEMSRAIVYAAPPYNSMNDVTFSQLITSVMNVASATSTEEQLNTYLA-ILDPIGARLTKLFSSPDITKVSESEIMT--CLAFIRGMVMTKWPSRLSRITSQWSMDYRRLFDTLYPWLEKGVEILCKHYLHCTAVIQXXXXXXXXXXXXXXXXXXXXQTTKFYLLNMNIFRLYSTKTFGISSTNNIAKEETITEIKYIFTIASELLSRQVFDEFDLDD--------SHDKEKVLGYDVIAQLIFQLAPFISSDVLEVPEVGTVFFQCITLVTEFKASTFLLKMNYEFNTSLLGLLRESILNSNSQISTFSLRSIISLA 3519
            ++F  ++Q HL APDG RN+T       + + ++    +++EDD++ +   L + G        + +  L+GLL +R+  L       +  + +  +P          L ED+HWL+ + GY +    DD   +  LI          ++  VD +    + G   E+  S+     N+TD+  R++                                  ++R   +  R+   S+    S Q+  D +W + RW   Y+ L+D+    ++S  +  A     E      Q ++   ++ +   +  W+ +P +    + L++ +      A +++  + W + +++     +PP + ++      L+ +++    A    +    Y A +L P+  R   L +  +  ++ + E +    +A +  +      +++  + S        LF  L  +L   + ++ + Y +    + L++E  +E++   +  L ++++ K Y + + + ++YS    G    +  A+E+   ++  I  + + LLS++  D  D D+        S     V   DV+   +  + P +S D+L+ P +   +++ IT + E      + ++  E   SL+  L   + + +S+IS   L ++  LA
Sbjct:  428 QVFNSYIQCHLAAPDGTRNLTANG----VASHEEEEINELQEDDRELFSDQLASIGMLGRIAADHCIPLLTGLLEDRVTRLHGQLQRHQQHLMAAADPDTVDRKVLDDLYEDIHWLILVSGYLL---ADDPQGETPLIPSEVMEYSIKHSTEVDINTTLQLLGSPGEKATSIPG--CNRTDSVIRLLSA--------------------------------VLRTSEVESRATRASLTQLLSPQMGKDIVWFLRRWAKTYL-LVDEKLYGQISMPLSTAFGADTEGA----QWIVGYLLEKVINNLSVWSSEPELANDTVELLVTLVEKRERANIVVQCENWWS-LAKQFASRSPPLHMLSSTVQRTLMKALVLGGFAHMDSDTKQQYWAEVLHPLQQRFLNLINQENFAQICQEEAVKQEIVATLEALCGIAEATQIDNVAS--------LFSFLMDFLSSCIGLM-EVYRNSPETVNLIIEVFVEVAHKQICYLGETKSMKLYEVCLTLLQVYSKNNLGRKRLDVAAEEDQYQDLLLIMELLTNLLSKEFIDFSDTDEVFRGQEQSSGAGRAVSAADVVLYGVNIVLPLMSQDLLKFPSLCNQYYKLITFICEIFPEK-IPQLPEELFKSLMCSLELGMTSMSSEISQLCLEALSPLA 1030          
BLAST of Exportin-4 vs. Ensembl Mouse
Match: Xpo4 (exportin 4 [Source:MGI Symbol;Acc:MGI:1888526])

HSP 1 Score: 74.7146 bits (182), Expect = 8.077e-13
Identity = 119/614 (19.38%), Postives = 253/614 (41.21%), Query Frame = 1
Query: 1645 KLFEHFLQAHLVAPDGFRNITPECDIVVIETXXXXXXXXXXXXXKKAYESGLYAAGFAALQCIRNSLCDLSGLLHNRMLYL--------ENVVFSGGNPSFS------LLEDLHWLLSIIGYTIFNVTDDLISQNRLI----------YTRHVDCSDLRSIYGHSKEQLRSMLARESNKTDACDRIVKQYQSLLINGCSEIERGLENFRYSFDMDLNCCDDIIRLFYLTLRSLAFSIQHCESGQLMADFMWLMNRWMLGYIQLLDDCENPELSDVIVLAVFVRGELGKVCHQKVISICMKMINICIVKWNQDPTVMQSVINLMLNITCSLSIARLLLVSDVWMNEMSRAIVYAAPPYNSMNDVTFSQLITS-VMNVASATSTEEQLNTYLAILDPIGARLTKLFSSPDITKVSESEIMTCLAFIRGMVMTKWPSRLSRITSQWSMD-YRRLFDTLYPWLEKGVEILCKHYLHCTAVIQXXXXXXXXXXXXXXXXXXXXQTTKFYLLNMNIFRLYSTKTFGISSTNNIAKEETITEIKYIFTIASELLSRQVFDEFDLDD---SHDKEKVLG-----YDVIAQLIFQLAPFISSDVLEVPEVGTVFFQCITLVTE 3384
            ++F  ++Q HL APDG RN+T       + + ++    +++EDD+  +   L + G        + +  L+ LL  R+  L        +  + S G+ +        L ED+HWL+ + GY +    DD   +  LI          ++  VD +    I G   E+  S+     ++TD+  R++                                  ++R+  +  R++   + H  S Q+  D +W + RW   Y+ L+D+    +L D I L +           Q +I   ++ +   +  W+ +  +    + L++ +      A L++  + W N +++     +PP N ++      L+ + V+   +   TE +   +  +L P+  R  ++ +  +  ++ + E +          +T     L  I     +D    LF+ L  +L   + ++ + Y +    + L++E  +E++   +  L +S+    Y   + + ++YS    G    +  A+EE   ++  I  + + LLS++  D  D D+    H+  +  G      DV+   +  + P +S D+L+ P +   +++ IT + E
Sbjct:  431 QVFNSYIQCHLAAPDGTRNLTANG----VASREEEEISELQEDDRDQFSDQLASVGMLGRIAAEHCMPLLTSLLEERVTRLHGQLQRHQQQFLASPGSSTIDNKMLDDLYEDIHWLILVTGYLL---ADDTQGETPLIPPEIMEYSIKHSSEVDINTTLQILGSPGEKASSIPGY--SRTDSVIRLLSA--------------------------------VLRVSEVESRAIRADLTHLLSPQMGKDIVWFLKRWAKTYL-LVDE----KLYDQISLPLSTAFGADTEGSQWIIGYLLQKVISNLSVWSSEQDLANDTVQLLVTLVERRERANLVIQCENWWN-LAKQFASRSPPLNFLSSPVQRTLMKALVLGGFAHMDTETKQQYWTEVLQPLQQRFLRVINQENFQQMCQQEEVK-------QEITATLEALCGIAEATQIDNVAILFNFLMDFLNNCIGLM-EVYKNTPETVNLIIEVFVEVAHKQICYLGESKAMHLYEACLTLLQVYSKNNLGRQRIDVTAEEEQYQDLLLIMELLTNLLSKEFIDFSDTDEVFRGHEPGQAAGRSVSAADVVLYGVNLILPLMSQDLLKFPTLCNQYYKLITFICE 989          

HSP 2 Score: 53.9138 bits (128), Expect = 1.823e-6
Identity = 30/118 (25.42%), Postives = 59/118 (50.00%), Query Frame = 1
Query:  664 FEKTHLSDIFVMFLNLLNDYLSTMDSIKSEESVLFMKSVLVNLESIFSWNFLNKVLSMKLQILAKNETSRRFAPPSKWSNIITDLSIIEFLFKVHDKVRSNSQLGILSMSCIIQIAGL 1017
            F++  L  IF++ + +L ++ S  +++ ++ S +F +  L     + SWNFL   L      + ++  +    P   W   + D  ++E  F VH K+R +S +   S+ C+ Q+A L
Sbjct:  190 FQEEDLRQIFMLTVGVLQEF-SRRENLSAQMSSVFQR-YLALANQVLSWNFLPPKLGRHYIAMFESSQNVLLKPTESWREALLDSRVMELFFTVHRKIREDSDMAQDSLQCLAQLASL 305          
BLAST of Exportin-4 vs. Ensembl Mouse
Match: Xpo4 (exportin 4 [Source:MGI Symbol;Acc:MGI:1888526])

HSP 1 Score: 74.7146 bits (182), Expect = 8.355e-13
Identity = 119/614 (19.38%), Postives = 253/614 (41.21%), Query Frame = 1
Query: 1645 KLFEHFLQAHLVAPDGFRNITPECDIVVIETXXXXXXXXXXXXXKKAYESGLYAAGFAALQCIRNSLCDLSGLLHNRMLYL--------ENVVFSGGNPSFS------LLEDLHWLLSIIGYTIFNVTDDLISQNRLI----------YTRHVDCSDLRSIYGHSKEQLRSMLARESNKTDACDRIVKQYQSLLINGCSEIERGLENFRYSFDMDLNCCDDIIRLFYLTLRSLAFSIQHCESGQLMADFMWLMNRWMLGYIQLLDDCENPELSDVIVLAVFVRGELGKVCHQKVISICMKMINICIVKWNQDPTVMQSVINLMLNITCSLSIARLLLVSDVWMNEMSRAIVYAAPPYNSMNDVTFSQLITS-VMNVASATSTEEQLNTYLAILDPIGARLTKLFSSPDITKVSESEIMTCLAFIRGMVMTKWPSRLSRITSQWSMD-YRRLFDTLYPWLEKGVEILCKHYLHCTAVIQXXXXXXXXXXXXXXXXXXXXQTTKFYLLNMNIFRLYSTKTFGISSTNNIAKEETITEIKYIFTIASELLSRQVFDEFDLDD---SHDKEKVLG-----YDVIAQLIFQLAPFISSDVLEVPEVGTVFFQCITLVTE 3384
            ++F  ++Q HL APDG RN+T       + + ++    +++EDD+  +   L + G        + +  L+ LL  R+  L        +  + S G+ +        L ED+HWL+ + GY +    DD   +  LI          ++  VD +    I G   E+  S+     ++TD+  R++                                  ++R+  +  R++   + H  S Q+  D +W + RW   Y+ L+D+    +L D I L +           Q +I   ++ +   +  W+ +  +    + L++ +      A L++  + W N +++     +PP N ++      L+ + V+   +   TE +   +  +L P+  R  ++ +  +  ++ + E +          +T     L  I     +D    LF+ L  +L   + ++ + Y +    + L++E  +E++   +  L +S+    Y   + + ++YS    G    +  A+EE   ++  I  + + LLS++  D  D D+    H+  +  G      DV+   +  + P +S D+L+ P +   +++ IT + E
Sbjct:  431 QVFNSYIQCHLAAPDGTRNLTANG----VASREEEEISELQEDDRDQFSDQLASVGMLGRIAAEHCMPLLTSLLEERVTRLHGQLQRHQQQFLASPGSSTIDNKMLDDLYEDIHWLILVTGYLL---ADDTQGETPLIPPEIMEYSIKHSSEVDINTTLQILGSPGEKASSIPGY--SRTDSVIRLLSA--------------------------------VLRVSEVESRAIRADLTHLLSPQMGKDIVWFLKRWAKTYL-LVDE----KLYDQISLPLSTAFGADTEGSQWIIGYLLQKVISNLSVWSSEQDLANDTVQLLVTLVERRERANLVIQCENWWN-LAKQFASRSPPLNFLSSPVQRTLMKALVLGGFAHMDTETKQQYWTEVLQPLQQRFLRVINQENFQQMCQQEEVK-------QEITATLEALCGIAEATQIDNVAILFNFLMDFLNNCIGLM-EVYKNTPETVNLIIEVFVEVAHKQICYLGESKAMHLYEACLTLLQVYSKNNLGRQRIDVTAEEEQYQDLLLIMELLTNLLSKEFIDFSDTDEVFRGHEPGQAAGRSVSAADVVLYGVNLILPLMSQDLLKFPTLCNQYYKLITFICE 989          

HSP 2 Score: 53.5286 bits (127), Expect = 2.471e-6
Identity = 30/118 (25.42%), Postives = 59/118 (50.00%), Query Frame = 1
Query:  664 FEKTHLSDIFVMFLNLLNDYLSTMDSIKSEESVLFMKSVLVNLESIFSWNFLNKVLSMKLQILAKNETSRRFAPPSKWSNIITDLSIIEFLFKVHDKVRSNSQLGILSMSCIIQIAGL 1017
            F++  L  IF++ + +L ++ S  +++ ++ S +F +  L     + SWNFL   L      + ++  +    P   W   + D  ++E  F VH K+R +S +   S+ C+ Q+A L
Sbjct:  190 FQEEDLRQIFMLTVGVLQEF-SRRENLSAQMSSVFQR-YLALANQVLSWNFLPPNLGRHYIAMFESSQNVLLKPTESWREALLDSRVMELFFTVHRKIREDSDMAQDSLQCLAQLASL 305          
BLAST of Exportin-4 vs. UniProt/SwissProt
Match: sp|Q9ESJ0|XPO4_MOUSE (Exportin-4 OS=Mus musculus OX=10090 GN=Xpo4 PE=1 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 5.650e-12
Identity = 119/614 (19.38%), Postives = 253/614 (41.21%), Query Frame = 1
Query: 1645 KLFEHFLQAHLVAPDGFRNITPECDIVVIETXXXXXXXXXXXXXKKAYESGLYAAGFAALQCIRNSLCDLSGLLHNRMLYL--------ENVVFSGGNPSFS------LLEDLHWLLSIIGYTIFNVTDDLISQNRLI----------YTRHVDCSDLRSIYGHSKEQLRSMLARESNKTDACDRIVKQYQSLLINGCSEIERGLENFRYSFDMDLNCCDDIIRLFYLTLRSLAFSIQHCESGQLMADFMWLMNRWMLGYIQLLDDCENPELSDVIVLAVFVRGELGKVCHQKVISICMKMINICIVKWNQDPTVMQSVINLMLNITCSLSIARLLLVSDVWMNEMSRAIVYAAPPYNSMNDVTFSQLITS-VMNVASATSTEEQLNTYLAILDPIGARLTKLFSSPDITKVSESEIMTCLAFIRGMVMTKWPSRLSRITSQWSMD-YRRLFDTLYPWLEKGVEILCKHYLHCTAVIQXXXXXXXXXXXXXXXXXXXXQTTKFYLLNMNIFRLYSTKTFGISSTNNIAKEETITEIKYIFTIASELLSRQVFDEFDLDD---SHDKEKVLG-----YDVIAQLIFQLAPFISSDVLEVPEVGTVFFQCITLVTE 3384
            ++F  ++Q HL APDG RN+T       + + ++    +++EDD+  +   L + G        + +  L+ LL  R+  L        +  + S G+ +        L ED+HWL+ + GY +    DD   +  LI          ++  VD +    I G   E+  S+     ++TD+  R++                                  ++R+  +  R++   + H  S Q+  D +W + RW   Y+ L+D+    +L D I L +           Q +I   ++ +   +  W+ +  +    + L++ +      A L++  + W N +++     +PP N ++      L+ + V+   +   TE +   +  +L P+  R  ++ +  +  ++ + E +          +T     L  I     +D    LF+ L  +L   + ++ + Y +    + L++E  +E++   +  L +S+    Y   + + ++YS    G    +  A+EE   ++  I  + + LLS++  D  D D+    H+  +  G      DV+   +  + P +S D+L+ P +   +++ IT + E
Sbjct:  431 QVFNSYIQCHLAAPDGTRNLTANG----VASREEEEISELQEDDRDQFSDQLASVGMLGRIAAEHCMPLLTSLLEERVTRLHGQLQRHQQQFLASPGSSTIDNKMLDDLYEDIHWLILVTGYLL---ADDTQGETPLIPPEIMEYSIKHSSEVDINTTLQILGSPGEKASSIPGY--SRTDSVIRLLSA--------------------------------VLRVSEVESRAIRADLTHLLSPQMGKDIVWFLKRWAKTYL-LVDE----KLYDQISLPLSTAFGADTEGSQWIIGYLLQKVISNLSVWSSEQDLANDTVQLLVTLVERRERANLVIQCENWWN-LAKQFASRSPPLNFLSSPVQRTLMKALVLGGFAHMDTETKQQYWTEVLQPLQQRFLRVINQENFQQMCQQEEVK-------QEITATLEALCGIAEATQIDNVAILFNFLMDFLNNCIGLM-EVYKNTPETVNLIIEVFVEVAHKQICYLGESKAMHLYEACLTLLQVYSKNNLGRQRIDVTAEEEQYQDLLLIMELLTNLLSKEFIDFSDTDEVFRGHEPGQAAGRSVSAADVVLYGVNLILPLMSQDLLKFPTLCNQYYKLITFICE 989          
BLAST of Exportin-4 vs. UniProt/SwissProt
Match: sp|Q9C0E2|XPO4_HUMAN (Exportin-4 OS=Homo sapiens OX=9606 GN=XPO4 PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 9.879e-12
Identity = 121/614 (19.71%), Postives = 250/614 (40.72%), Query Frame = 1
Query: 1645 KLFEHFLQAHLVAPDGFRNITPECDIVVIETXXXXXXXXXXXXXKKAYESGLYAAGFAALQCIRNSLCDLSGLLHNRMLYLENVVFSG-----GNPSFS---------LLEDLHWLLSIIGYTIFNVTDDLISQNRLI----------YTRHVDCSDLRSIYGHSKEQLRSMLARESNKTDACDRIVKQYQSLLINGCSEIERGLENFRYSFDMDLNCCDDIIRLFYLTLRSLAFSIQHCESGQLMADFMWLMNRWMLGYIQLLDDCENPELSDVIVLAVFVRGELGKVCHQKVISICMKMINICIVKWNQDPTVMQSVINLMLNITCSLSIARLLLVSDVWMNEMSRAIVYAAPPYNSMNDVTFSQLITS-VMNVASATSTEEQLNTYLAILDPIGARLTKLFSSPDITKVSESEIMTCLAFIRGMVMTKWPSRLSRITSQWSMD-YRRLFDTLYPWLEKGVEILCKHYLHCTAVIQXXXXXXXXXXXXXXXXXXXXQTTKFYLLNMNIFRLYSTKTFGISSTNNIAKEETITEIKYIFTIASELLSRQVFDEFDLDD---SHDKEK-----VLGYDVIAQLIFQLAPFISSDVLEVPEVGTVFFQCITLVTE 3384
            ++F  ++Q HL APDG RN+T       + + ++    +++EDD+  +   L + G        + +  L+ LL  R+  L   +         +P  S         L ED+HWL+ + GY +    DD   +  LI          ++  VD +    I G   E+  S+     N+TD+  R++                                  I+R+  +  R++   + H  S Q+  D +W + RW   Y+ L+D+    +L D I L             Q +I   ++ +   +  W+ +  +    + L++ +      A L++  + W N +++     +PP N ++      L+ + V+   +   TE +   +  +L P+  R  ++ +  +  ++ + E +          +T     L  I     +D    LF+ L  +L   + ++ + Y +    + L++E  +E++   +  L +S+    Y   + + ++YS    G    +  A+EE   ++  I  + + LLS++  D  D D+    H+  +     V   DV+   +  + P +S D+L+ P +   +++ IT + E
Sbjct:  431 QVFNSYIQCHLAAPDGTRNLTANG----VASREEEEISELQEDDRDQFSDQLASVGMLGRIAAEHCIPLLTSLLEERVTRLHGQLQRHQQQLLASPGSSTVDNKMLDDLYEDIHWLILVTGYLL---ADDTQGETPLIPPEIMEYSIKHSSEVDINTTLQILGSPGEKASSIPGY--NRTDSVIRLLSA--------------------------------ILRVSEVESRAIRADLTHLLSPQMGKDIVWFLKRWAKTYL-LVDE----KLYDQISLPFSTAFGADTEGSQWIIGYLLQKVISNLSVWSSEQDLANDTVQLLVTLVERRERANLVIQCENWWN-LAKQFASRSPPLNFLSSPVQRTLMKALVLGGFAHMDTETKQQYWTEVLQPLQQRFLRVINQENFQQMCQQEEVK-------QEITATLEALCGIAEATQIDNVAILFNFLMDFLTNCIGLM-EVYKNTPETVNLIIEVFVEVAHKQICYLGESKAMNLYEACLTLLQVYSKNNLGRQRIDVTAEEEQYQDLLLIMELLTNLLSKEFIDFSDTDEVFRGHEPGQAANRSVSAADVVLYGVNLILPLMSQDLLKFPTLCNQYYKLITFICE 989          
BLAST of Exportin-4 vs. UniProt/SwissProt
Match: sp|Q802D3|XPO4_DANRE (Exportin-4 OS=Danio rerio OX=7955 GN=xpo4 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.614e-11
Identity = 128/660 (19.39%), Postives = 279/660 (42.27%), Query Frame = 1
Query: 1645 KLFEHFLQAHLVAPDGFRNITPECDIVVIETXXXXXXXXXXXXXKKAYESGLYAAGFAALQCIRNSLCDLSGLLHNRMLYL-------ENVVFSGGNPSF-------SLLEDLHWLLSIIGYTIFNVTDD---LISQNRLIYT-RH---VDCSDLRSIYGHSKEQLRSMLARESNKTDACDRIVKQYQSLLINGCSEIERGLENFRYSFDMDLNCCDDIIRLFYLTLRSLAFSIQHCESGQLMADFMWLMNRWMLGYIQLLDDCENPELSDVIVLAVFVRGELGKVCHQKVISICMKMINICIVKWNQDPTVMQSVINLMLNITCSLSIARLLLVSDVWMNEMSRAIVYAAPPYNSMNDVTFSQLITSVMNVASATSTEEQLNTYLA-ILDPIGARLTKLFSSPDITKVSES-----EIMTCLAFIRGMVMTKWPSRLSRITSQWSMDYRRLFDTLYPWLEKGVEILCKHYLHCTAVIQXXXXXXXXXXXXXXXXXXXXQTTKFYLLNMNIFRLYSTKTFGISSTNNIAKEETITEIKYIFTIASELLSRQVFDEFDLDD--------SHDKEKVLGYDVIAQLIFQLAPFISSDVLEVPEVGTVFFQCITLVTEFKASTFLLKMNYEFNTSLLGLLRESILNSNSQISTFSLRSIISLA 3519
            ++F  ++Q HL APDG RN+T       + + ++    +++EDD++ +   L + G        + +  L+GLL +R+  L       +  + +  +P          L ED+HWL+ + GY + +V      LI    + Y+ +H   VD +    + G   E+  S+     N+TD+  R++       +   SE+E                            R+   S+    S Q+  D +W + RW   Y+ L+D+    ++S  +  A     E      Q ++   ++ +   +  W+ +P +    + L++ +      A +++  + W + +++     +PP + ++      L+ +++    A    +    Y A +L P+  R   L +  +  ++ +      EI+  L  + G+      +++  + S        LF  L  +L   + ++ + Y +    + L++E  +E++   +  L ++++ K Y + + + ++YS    G    +  A+E+   ++  I  + + LLS++  D  D D+        S     V   DV+   +  + P +S D+L+ P +   +++ IT + E      + ++  E   SL+  L   + + +S+IS   L ++  LA
Sbjct:  430 QVFNSYIQCHLAAPDGTRNLTANG----VASHEEEEINELQEDDRELFSDQLASIGMLGRIAADHCIPLLTGLLEDRVTRLHGQLQRHQQHLMAAADPDTVDRKVLDDLYEDIHWLILVSGYLLADVPQGETPLIPSEVMEYSIKHSTEVDINTTLQLLGSPGEKATSIPG--CNRTDSVIRLLSA-----VLRTSEVES---------------------------RATRASLTQLLSPQMGKDIVWFLRRWAKTYL-LVDEKLYGQISMPLSTAFGADTEGA----QWIVGYLLEKVINNLSVWSSEPELANDTVELLVTLVEKRERANIVVQCENWWS-LAKQFASRSPPLHMLSSTVQRTLMKALVLGGFAHMDSDTKQQYWAEVLHPLQQRFLNLINQENFAQICQEVAVKQEIVATLEALCGIAEA---TQIDNVAS--------LFSFLMDFLSSCIGLM-EVYRNSPETVNLIIEVFVEVAHKQICYLGETKSMKLYEVCLTLLQVYSKNNLGRKRLDVAAEEDQYQDLLLIMELLTNLLSKEFIDFSDTDEVLRGQEQSSGAGRAVSAADVVLYGVNIVLPLMSQDLLKFPSLCNQYYKLITFICEIFPEK-IPQLPEELFKSLMCSLELGMTSMSSEISQLCLEALSPLA 1032          
BLAST of Exportin-4 vs. UniProt/SwissProt
Match: sp|Q5ZMR9|XPO4_CHICK (Exportin-4 OS=Gallus gallus OX=9031 GN=XPO4 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.947e-10
Identity = 118/611 (19.31%), Postives = 252/611 (41.24%), Query Frame = 1
Query: 1645 KLFEHFLQAHLVAPDGFRNITPECDIVVIETXXXXXXXXXXXXXKKAYESGLYAAGFAALQCIRNSLCDLSGLLHNRMLYLENVVFSG-----GNPSFS---------LLEDLHWLLSIIGYTIFNVTDD---LISQNRLIYT-RH---VDCSDLRSIYGHSKEQLRSMLARESNKTDACDRIVKQYQSLLINGCSEIERGLENFRYSFDMDLNCCDDIIRLFYLTLRSLAFSIQHCESGQLMADFMWLMNRWMLGYIQLLDDCENPELSDVIVLAVFVRGELGKVCHQKVISICMKMINICIVKWNQDPTVMQSVINLMLNITCSLSIARLLLVSDVWMNEMSRAIVYAAPPYNSMNDVTFSQLITS-VMNVASATSTEEQLNTYLAILDPIGARLTKLFSSPDITKVSESEIMTCLAFIRGMVMTKWPSRLSRITSQWSMD-YRRLFDTLYPWLEKGVEILCKHYLHCTAVIQXXXXXXXXXXXXXXXXXXXXQTTKFYLLNMNIFRLYSTKTFGISSTNNIAKEETITEIKYIFTIASELLSRQVFDEFDLDD---SHDKEK-----VLGYDVIAQLIFQLAPFISSDVLEVPEVGTVFFQCITLVTE 3384
            ++F  ++Q HL APDG RN+T       + + ++    +++EDD+  +   L + G        + +  L+ LL +R+  L   +         +P+           L ED+HWL+ + GY + N T     LI    + Y+ +H   VD +    I G   E+  S+     N+TD+  R++                                  I+R+  +  R++  ++ H  S Q+  D +W + RW   Y+ L D+    +L D I L             Q ++   ++ +   +  W+ +  +    + L++ +      A L++  + W N +++     +PP + ++      L+ + V+   +   TE +   +  +L P+  R   + +  +  ++ + E +          +T     L  I     +D    LF+ L  +L   + ++ + Y +    + L++E  +E++   +  L +++    Y   + + ++YS    G    +  A+E+   ++  I  + + LLS++  D  D D+    H+  +     V   DV+   +  + P +S D+L+ P +   +++ IT + E
Sbjct:  434 QVFNSYIQCHLAAPDGTRNLTANG----VASREEEEISELQEDDRDQFCDQLASVGMLGRIAAEHCIPLLTSLLEDRVTRLHGQLQRHQQQLLASPASGSIDNKVLDDLYEDIHWLILVTGYLLANDTQGETPLIPPEVMEYSIKHSTEVDINTTLQILGSPGEKASSIPGY--NRTDSVIRLLSA--------------------------------ILRVSEVESRAIRANLTHLLSPQMGKDIVWFLKRWAKTYL-LADE----KLYDQISLPFSTAFGADTEGSQWIVGYLLEKVISNLAVWSSEQDLANDTVQLLVTLVERRERANLVIQCENWWN-LAKQFARRSPPLHYLSSSVQRTLMKALVLGGFAHMDTEMKQQYWTEVLQPLQQRFLNVINQENFQQICQEEEVK-------QEITATLEALCGIAEATQIDNVAILFNFLMDFLNNCIGLM-EVYKNTPETVNLIIEVFVEVAHKQICYLGEAKAMNLYEACLTLLQVYSKNNLGRQRIDVTAEEDQYQDLLLIMELLTNLLSKEFIDFSDTDEVFRGHEPGQATNRTVSAADVVLYGVNLVLPLMSQDLLKFPSLCNQYYKLITFICE 992          
BLAST of Exportin-4 vs. UniProt/SwissProt
Match: sp|Q499Y0|XPO4_XENLA (Exportin-4 OS=Xenopus laevis OX=8355 GN=xpo4 PE=2 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 5.381e-6
Identity = 61/305 (20.00%), Postives = 134/305 (43.93%), Query Frame = 1
Query:  109 DNDERKKVENLIQKYKKSYSIDAFT-HVLNNTTNEMLIYETLAAYGDTVINNWSDFAIETQVNTYSCESTSNNNIKDLKPSPQLNQVVLGLMEWTLANQLRLSHSVWSQAIINLTKMIKKSYSEKINIFLEQFMNKVNGFLRLPQLKSKIIGLDMINGLL-EVFSSLKITNQQLKISRNSEIKLRNEFEKTHLSDIFVMFLNLLNDYLSTMDSIKSEESVLFMKSVLVNLESIFSWNFLNKVLSMKLQILAKNETSRRFAPPSKWSNIITDLSIIEFLFKVHDKVRSNSQLGILSMSCIIQIAGL 1017
            +N++R+  E++   ++KS S  A   H+L  +  + ++++   A  + V+  W              E +S  +++              L+ + L  +  L   V  Q ++ +  ++K+   +K +I  +   ++V+  +       + +   ++  LL E  SS K +N  L +  +   K    F+   L  IF++ + +L ++ S  +++ ++ S +F +  L     + SWNFL   L      + ++  +    P   W   + +  ++E  F VH K+R +S +   S+ C+ Q+A L
Sbjct:   29 NNEQRQHAEHVFLSFRKSKSPFAVCKHILETSKVDYVLFQAATAIMEAVVREW-----------ILLEKSSIESLRTF------------LLTYVL-QRPNLQKYVREQILLAVAVIVKRGSLDK-SIDCKSIFHEVSQLISSCNPTMQTLACSILTALLIEFSSSSKTSNIGLSMEFHGSCK--RVFQDEDLRRIFMLTIEVLQEF-SRRENLNAQMSSVFQR-YLALANQVLSWNFLPPNLGRHYIAMFESSQNVMLKPTESWRETLLNSRVMELFFTVHRKIREDSDMAQDSLQCLAQLASL 304          
BLAST of Exportin-4 vs. TrEMBL
Match: A0A368H3M3 (Uncharacterized protein OS=Ancylostoma caninum OX=29170 GN=ANCCAN_02755 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 7.931e-17
Identity = 69/301 (22.92%), Postives = 141/301 (46.84%), Query Frame = 1
Query:  115 DERKKVENLIQKYKKSYSIDAFTHVLNNTTNEMLIYETLAAYGDTVINNWSDFAIETQVNTYSCESTSNNNIKDLKPSPQLNQVVLGLMEWTLANQLRLSHSVWSQAIINLTKMIKKSYSEKINIFLEQFMNKVNGFLRLPQLKSKIIGLDMINGLLEVFSSLKITNQQLKISRNSEIKLRNEFEKTHLSDIFVMFLNLLNDYLSTMDSIKSEESVLFMKSVLVNLESIFSWNFLNKVLSMKLQILAKNETSRRFAPPSKWSNIITDLSIIEFLFKVHDKVRSNSQLGILSMSCIIQIAGL 1017
            + R++ E L    K+  +I+    V+ NT N+ ++++     G+ V+ +W   + E  V+TY                         L+E+ +A +  LSH   ++ + ++  ++K+   +      E+    ++  L     + + IG ++I+ + + FSS    N +  I+ +  ++ ++EFE T L  +  M L  L+   S  D +  E +       L   E+  SWNF +K+     ++ +  +T+  F PP+ W  ++ +       F+VH K+R++  L + S+SC++Q+AGL
Sbjct:   23 ESRREAEQLFHNIKQELTIETAGQVIRNTKNQCVLFQIAQMTGEIVLRDWVLLSKEQIVHTYKM-----------------------LLEF-VAQREDLSHYARTEFLRSVAMILKRGILDGKTGDQEELFQLIHNLLVNQHHRLQAIGGELISAITQQFSS-SWRNTKFSITWDFHVRAKSEFEDTGLRRLLEMSLKTLHALASQSDILPDEFARRICDKFLEVAETTLSWNFASKIFR---RVFSLCQTTNSFRPPASWKELLENDEFFTLFFQVHAKIRTDETLALRSLSCLVQLAGL 295          
BLAST of Exportin-4 vs. TrEMBL
Match: A0A016VXP4 (Uncharacterized protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0003.g1251 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.068e-16
Identity = 69/301 (22.92%), Postives = 141/301 (46.84%), Query Frame = 1
Query:  115 DERKKVENLIQKYKKSYSIDAFTHVLNNTTNEMLIYETLAAYGDTVINNWSDFAIETQVNTYSCESTSNNNIKDLKPSPQLNQVVLGLMEWTLANQLRLSHSVWSQAIINLTKMIKKSYSEKINIFLEQFMNKVNGFLRLPQLKSKIIGLDMINGLLEVFSSLKITNQQLKISRNSEIKLRNEFEKTHLSDIFVMFLNLLNDYLSTMDSIKSEESVLFMKSVLVNLESIFSWNFLNKVLSMKLQILAKNETSRRFAPPSKWSNIITDLSIIEFLFKVHDKVRSNSQLGILSMSCIIQIAGL 1017
            + R++ E L    K+  +I+    V+ NT N+ ++++     G+ V+ +W   + E  V+TY                         L+E+ +A +  LSH   ++ + ++  ++K+   +      E+    ++  L     + + IG ++I+ + + FSS    N +  I+ +  ++ ++EFE T L  +  M L  L+   S  D +  E +       L   E+  SWNF +K+     ++ +  +T+  F PP+ W  ++ +       F+VH K+R++  L + S+SC++Q+AGL
Sbjct:   23 ESRREAEQLFHNIKQELTIETAGQVIRNTKNQCVLFQIAQMTGEIVLRDWVLLSKEQIVHTYKM-----------------------LLEF-VAQREDLSHYARTEFLRSVAMILKRGILDGKTGDQEELFQLIHNLLVNQHHRLQAIGGELISAITQQFSS-SWRNTKFSITWDFHVRAKSEFEDTGLRRLLEMSLKTLHALASQSDILPDEFARRICDKFLEVAETTLSWNFASKIFR---RVFSLCQTTNSFRPPASWKELLENDEFFTLFFQVHAKIRTDETLSLRSLSCLVQLAGL 295          
BLAST of Exportin-4 vs. TrEMBL
Match: A0A2A6CMJ2 (Regulator of chromosome condensation repeat containing protein OS=Pristionchus pacificus OX=54126 GN=PRIPAC_31820 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 9.722e-16
Identity = 71/301 (23.59%), Postives = 141/301 (46.84%), Query Frame = 1
Query:  115 DERKKVENLIQKYKKSYSIDAFTHVLNNTTNEMLIYETLAAYGDTVINNWSDFAIETQVNTYSCESTSNNNIKDLKPSPQLNQVVLGLMEWTLANQLRLSHSVWSQAIINLTKMIKKSYSEKINIFLEQFMNKVNGFLRLPQLKSKIIGLDMINGLLEVFSSLKITNQQLKISRNSEIKLRNEFEKTHLSDIFVMFLNLLNDYLSTMDSIKSEESVLFMKSVLVNLESIFSWNFLNKVLSMKLQILAKNETSRRFAPPSKWSNIITDLSIIEFLFKVHDKVRSNSQLGILSMSCIIQIAGL 1017
            D+RK  E +  + +   +I+    ++ ++++  ++++   A G+ V+  WS                       L  + ++  V   L+E+T A +  L   V ++ + +   +IK+   +K     E     + G L  P+ + + IG  +I+ L E FSS    N +  I+ +  +  + +FEKT L  +  M ++ L + +   D + +     F +  L   ES FSWNF  ++     ++ + N+ S  F PP  WS+++++ +     FK+H K RS+  L + S+ C++Q+A L
Sbjct:  291 DDRKAAEAIFTELRGVLTIEHAKTIMASSSHPFVLHQVGQAIGEFVLREWS-----------------------LLDASEVEAVYRMLIEFT-ATKENLPVYVVAEFLKSTAMIIKRGSLDKKTGDPEVLYETIRGLLAHPEARMQSIGCQLISSLCEQFSS-SWRNSKFSITWDFHLAAKTDFEKTGLRRLLEMAVSNLYNLVERSDILSNAFEKRFCEKFLEVAESAFSWNFSARIFR---KLFSMNQNSTSFRPPKSWSDLLSNEAFFLVFFKLHAKCRSDENLSVHSLGCLVQLASL 563          
BLAST of Exportin-4 vs. TrEMBL
Match: H3FYU1 (Regulator of chromosome condensation repeat containing protein OS=Pristionchus pacificus OX=54126 GN=WBGene00117040 PE=4 SV=2)

HSP 1 Score: 95.5153 bits (236), Expect = 9.722e-16
Identity = 71/301 (23.59%), Postives = 141/301 (46.84%), Query Frame = 1
Query:  115 DERKKVENLIQKYKKSYSIDAFTHVLNNTTNEMLIYETLAAYGDTVINNWSDFAIETQVNTYSCESTSNNNIKDLKPSPQLNQVVLGLMEWTLANQLRLSHSVWSQAIINLTKMIKKSYSEKINIFLEQFMNKVNGFLRLPQLKSKIIGLDMINGLLEVFSSLKITNQQLKISRNSEIKLRNEFEKTHLSDIFVMFLNLLNDYLSTMDSIKSEESVLFMKSVLVNLESIFSWNFLNKVLSMKLQILAKNETSRRFAPPSKWSNIITDLSIIEFLFKVHDKVRSNSQLGILSMSCIIQIAGL 1017
            D+RK  E +  + +   +I+    ++ ++++  ++++   A G+ V+  WS                       L  + ++  V   L+E+T A +  L   V ++ + +   +IK+   +K     E     + G L  P+ + + IG  +I+ L E FSS    N +  I+ +  +  + +FEKT L  +  M ++ L + +   D + +     F +  L   ES FSWNF  ++     ++ + N+ S  F PP  WS+++++ +     FK+H K RS+  L + S+ C++Q+A L
Sbjct:  291 DDRKAAEAIFTELRGVLTIEHAKTIMASSSHPFVLHQVGQAIGEFVLREWS-----------------------LLDASEVEAVYRMLIEFT-ATKENLPVYVVAEFLKSTAMIIKRGSLDKKTGDPEVLYETIRGLLAHPEARMQSIGCQLISSLCEQFSS-SWRNSKFSITWDFHLAAKTDFEKTGLRRLLEMAVSNLYNLVERSDILSNAFEKRFCEKFLEVAESAFSWNFSARIFR---KLFSMNQNSTSFRPPKSWSDLLSNEAFFLVFFKLHAKCRSDENLSVHSLGCLVQLASL 563          
BLAST of Exportin-4 vs. TrEMBL
Match: A0A0N4WL88 (Uncharacterized protein OS=Haemonchus placei OX=6290 GN=HPLM_LOCUS11894 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.186e-15
Identity = 66/301 (21.93%), Postives = 143/301 (47.51%), Query Frame = 1
Query:  115 DERKKVENLIQKYKKSYSIDAFTHVLNNTTNEMLIYETLAAYGDTVINNWSDFAIETQVNTYSCESTSNNNIKDLKPSPQLNQVVLGLMEWTLANQLRLSHSVWSQAIINLTKMIKKSYSEKINIFLEQFMNKVNGFLRLPQLKSKIIGLDMINGLLEVFSSLKITNQQLKISRNSEIKLRNEFEKTHLSDIFVMFLNLLNDYLSTMDSIKSEESVLFMKSVLVNLESIFSWNFLNKVLSMKLQILAKNETSRRFAPPSKWSNIITDLSIIEFLFKVHDKVRSNSQLGILSMSCIIQIAGL 1017
            + R++ E L    K+  +I+A   V+ +T N+ ++++     G+ V+ +W   + E  ++TY                         L+E+ +A +  LS+   ++ + ++  ++K+   ++     E+    ++  L  P  + + IG ++I+ + + FSS    N +  I+ +  ++ + +FE   L  +  M L  L+  LS  + +  E +       L   E+  SWNF +K+   ++  L + +T+  F PP+ W +++ +       F +H K+R++  L   S+SC++Q+AGL
Sbjct:   23 ESRREAEQLFHNIKQELTIEAAAQVIQSTKNQCVLFQIAQMTGEIVLRDWVLLSKEQVIHTYKM-----------------------LLEF-VAQREDLSNYAQTEFLRSVAMILKRGIIDEKTGDQEELFELIHNLLVNPHARLQAIGGELISAITQQFSS-SWRNAKFSITWDFHVRAKTKFEDIGLRRLLEMSLKTLHALLSQTNILSDEFAHRICGKFLEVAETTLSWNFASKIFR-RVFSLCQFQTTNSFRPPASWKDLLENDEFFTLFFHLHAKIRTDEDLSTRSLSCLVQLAGL 297          
BLAST of Exportin-4 vs. Ensembl Cavefish
Match: xpo4 (exportin 4 [Source:NCBI gene;Acc:324342])

HSP 1 Score: 73.559 bits (179), Expect = 1.420e-12
Identity = 145/752 (19.28%), Postives = 307/752 (40.82%), Query Frame = 1
Query: 1645 KLFEHFLQAHLVAPDGFRNITPECDIVVIETXXXXXXXXXXXXXKKAYESGLYAAGF----AALQCI---RNSLCDLSGLLHNRMLYLENVVFSGGNPSF-------SLLEDLHWLLSIIGYTIFNVTDDLISQNRLIYTR----------HVDCSDLRSIYGHSKEQLRSMLARESNKTDACDRIVKQYQSLLINGCSEIERGLENFRYSFDMDLNCCDDIIRLFYLTLRSLAFSIQHCESGQLMADFMWLMNRWMLGYIQLLDDCENPELSDVIVLAVFVRGELGKVCHQKVISICMKMINICIVKWNQDPTVMQSVINLMLNITCSLSIARLLLVSDVWMNEMSRAIVYAAPPYNSMNDVTFSQLITSVMNVASATSTEEQLNTYLA-ILDPIGARLTKLFSSPDITKVSESEIMT--CLAFIRGMVMTKWPSRLSRITSQWSMDYRRLFDTLYPWLEKGVEILCKHYLHCTAVIQXXXXXXXXXXXXXXXXXXXXQTTKFYLLNMNIFRLYSTKTFGISSTNNIAKEETITEIKYIFTIASELLSRQVFDEFDLDD--------SHDKEKVLGYDVIAQLIFQLAPFISSDVLEVPEVGTVFFQCITLVTEFKASTFLLKMNYEFNTSLLGLLRESILNSNSQISTFSLRSIISLASDYYLWTNNVESVDDSQMAFSLNSDFNAILLKIMNWLRSENVGNDMLDTASSALISLVKIDQNYFLAILSDWMKSLNNPFISNKIQSMANTL 3795
            ++F  ++Q HL APDG RN+T       + + ++    +++EDD++ +   L + G     AA  CI    + L D    LH ++   +  + +  +P          L ED+HWL+ + GY +    DD   +  LI T            VD +    I G   E+  S+     N+TD+  R++       +   SE+E                            R+   S+    S Q+  D +W + RW   Y+ L+D+    ++S  +  A     E      Q ++   ++ +   +  W+ +P +    + L++ +      A +++  + W + +++     +PP + ++      L+ +++    A    +    Y A +L P+  R   L +  +  ++ + E +    +A +  +      +++  + S        LF  L  +L   + ++ + Y +    + L++E  +E++   +  L ++++ K Y + + + ++YS    G    +  A+E+   ++  I  + + LLS++  D  D D+        S     V   DV+   +  + P +S D+L+ P +   +++ IT + E      + ++  E   SL+  L   + + +S+IS   L ++  LA          ++ +     F     F   L  + + L  +    +M   A  AL +LV + Q  +  ++   + S  +  I  ++    NTL
Sbjct:  409 QVFNSYIQCHLAAPDGTRNLTANG----VASHEEEEINELQEDDRELFSDQLASIGMLGRIAAEHCIPLLTSLLEDRVTRLHGQLQRHQQHLMASSDPESVDRKVLDDLYEDIHWLILVSGYLL---ADDPQGETPLIPTEVMEYSIKHSTEVDINTTLQILGSPGEKATSIPG--CNRTDSVIRLLSA-----VLRTSEVES---------------------------RATRASLTQLLSPQMGKDIVWFLRRWAKTYL-LVDEKLYGQISMPLSTAFGADTEGA----QWIVGYLLEKVINNLSVWSSEPELANDTVELLVTLVEKRERANIVVQCENWWS-LAKQFASRSPPLHLLSSPIQRTLMKALVLGGFAHMDSDTKQQYWAEVLHPLQQRFLNLINQENFAQICQEEAVKQEIVATLEALCGIAEATQIDNVGS--------LFSFLMDFLSSCIGLM-EVYQNSPETVNLIIEVFVEVAHKQICYLGETKSMKLYEVCLTLLQVYSKNNLGRKRLDVAAEEDQYQDLLLIMELLTNLLSKEFIDFSDTDEVFRGQEQSSGAGRTVSAADVVLFGVNIVLPLMSQDLLKFPSLCNQYYKLITFICEIFPEK-IPQLPEELFKSLMFSLELGMTSMSSEISQLCLEALSPLAE------QCAKTQEKDTPLFIATRHF---LKLVFDMLVLQKHNTEMTVAAGEALYTLVCLHQAEYSELVETLLSSQRDAVIYQRLADAFNTL 1094          
BLAST of Exportin-4 vs. Ensembl Nematostella
Match: EDO28766 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5J4])

HSP 1 Score: 62.3882 bits (150), Expect = 1.253e-9
Identity = 138/692 (19.94%), Postives = 282/692 (40.75%), Query Frame = 1
Query: 1852 LSGLLHNRMLYLE------NVVFSGGNP------SFSLLEDLHWLLSIIGYTIFNVTDDLISQNRLIYTRHVDCSDLRSIYGHSKEQLRSMLARESNKTDACDRIVKQYQSLLINGCSEIERGLENFRYSFDMDLNCCDDIIRLFYLTLRSLAFSIQHCESGQLMADFMWLMNRWMLGYIQLLDDCENPELSDVIVLAVFVRGELGKVCHQKVISICMKMINICIVKWNQDPTVMQSVINLMLNITCSLSIARLLLVSDVWMNEMSRAIVYAAPPYNSMNDVTFSQLITSVMNVASATSTEEQLNTYLA-ILDPIGARLTKLFSSPDITKVSE-----SEIMTCLAFIRGMVMTKWPSRLSRITSQWSMDYRRLFDTLYPWLEKGVEILCKHYLHCTAVIQXXXXXXXXXXXXXXXXXXXXQTTKFYLLNMNIFRLYSTKTFGISSTNNIAKEETITEIKYIFTIASELLSRQVFDEFDLDDSHDKEKVLGYDVIAQLIFQLAPFISSDVLEVPEVGTVFFQCITLVTEFKASTFLLKMNYEFNTSLLGLLRESILNSNSQISTFSLRSIISLASDYYLWTNNVESVDDSQMAFSLNSDFNAILLKIMNWLRSENVGNDMLDTASSALISLVKIDQNYFLAILSDWMKSLNNPFISNKIQSMANTLELAPSE-----GSHISSFHRSNIDKW 3858
            L+ LL NR+  LE          + G+P        +L EDLHWLL I G+ I    D+   +  LI +  V              Q  +     ++ T   D +       L  GCS +++     R    + L  C  +  L     +++A ++ H  S Q+    +W +  +   Y+   D+ ++ ELS  +  ++F +   G    + +I   +  +   +  W  +P + +  + L+L++  + S A +  VS   + ++ +       P + +        + +++   S+       + Y    L  +  R   +   P+  K+++     +E+ + L   +G+ +           + W+++   LFD L P L   V +L  ++  C  V  L+LE  +      +  LS++Q    +   +++   Y+    G  S +++ +EE   ++  +  + S +L++   D  +L      EK+   DV    +  + P I+ ++L+ P +   +F+  T V E      +   +  F+ +++  L   +   +S IS  SL S+ SL   ++         +  Q    +   F   L  I N +  E+   D+L  AS A  +L+  +Q Y+  ++   +    +P IS ++  +    +L PS+       H  +  R N+D +
Sbjct:   37 LTALLENRVCKLEERLTALQTAANSGSPIPPIQGMENLFEDLHWLLLIAGHMI---ADESTGETPLIPSAVV--------------QYSAACVERTDVTATLDFMFGSQSGAL--GCSSMDKS----RVDPVVKLVTC--VCCLASAGNKAIASNMAHFLSPQVAGTVVWFLRNFTRSYL-FPDERDSVELSASLS-SIFGKDSTGG---KWMIGFLLDTVRANLTYWASEPALAEDTVLLLLSLVDTKSRAEVA-VSFECLWQLGQLQASREGPISQLPAEVHRFYVQALVLAGSSEGDHPLRDRYWKQFLQSMHNRFGIVCHQPNFVKLAQKEPIKAEVQSLLESFKGVALA---------VNAWNVN--ELFDFLLPVLRDSVTLLSVYHT-CPEVAVLVLEFYVNAVEAFVNFLSQTQANHLFKACLSLLDTYTKCNMGKHSLSSLVEEEQFYDLLLLMKLLSHMLAQ---DILNLGPDDGTEKISAGDVTLYGLNIILPLITVELLKFPSLCEEYFKLSTFVCEVYPEKVVALPDGLFH-NMMSTLEVGLSIYDSDISKMSLESVASLIEHFFKEMRE----NPPQRMLEIVRHF---LRLIFNMVLLESFDMDLLQPASCAFHALICSNQGYYTELVRSLLAHQGDPVISQRL--LGAFHQLTPSDMKLSLDKHSKAQFRRNLDTF 672          
BLAST of Exportin-4 vs. Ensembl Medaka
Match: xpo4 (exportin 4 [Source:NCBI gene;Acc:101165185])

HSP 1 Score: 62.003 bits (149), Expect = 5.572e-9
Identity = 126/660 (19.09%), Postives = 274/660 (41.52%), Query Frame = 1
Query: 1645 KLFEHFLQAHLVAPDGFRNITPECDIVVIETXXXXXXXXXXXXXKKAYESGLYAAGF----AALQCI---RNSLCDLSGLLHNRMLYLENVVFSGGNPSF-------SLLEDLHWLLSIIGYTIFNVTDDLISQNRLI----------YTRHVDCSDLRSIYGHSKEQLRSMLARESNKTDACDRIVKQYQSLLINGCSEIERGLENFRYSFDMDLNCCDDIIRLFYLTLRSLAFSIQHCESGQLMADFMWLMNRWMLGYIQLLDDCENPELSDVIVLAVFVRGELGKVCHQKVISICMKMINICIVKWNQDPTVMQSVINLMLNITCSLSIARLLLVSDVWMNEMSRAIVYAAPPYNSMNDVTFSQLITSVMNVASATSTEEQLNTYLA-ILDPIGARLTKLFSSPDITKVSESEIMT--CLAFIRGMVMTKWPSRLSRITSQWSMDYRRLFDTLYPWLEKGVEILCKHYLHCTAVIQXXXXXXXXXXXXXXXXXXXXQTTKFYLLNMNIFRLYSTKTFGISSTNNIAKEETITEIKYIFTIASELLSRQVFDEFDLDD---SHDK------EKVLGYDVIAQLIFQLAPFISSDVLEVPEVGTVFFQCITLVTEFKASTFLLKMNYEFNTSLLGLLRESILNSNSQISTFSLRSIISL 3516
            ++F  ++Q HL APDG RN++    +  I + ++    +++EDD++ +   L + G     AA  CI    + L D    LH ++   +  + +  +           L ED+HWL+ + GY +    DD   +  LI          ++  VD +    I G   E+  S+     N+TD+  R++       +   SE+E                            R+   S+    S Q+  D +W + RW   Y+ L+D+    ++S  +  A     E      Q ++   ++ +   +  W+ +  +    + L++ +      A +++  + W + +++     +PP + ++      L+ +++    A    +    Y A +L P+  R   L +  +  ++S+ E +    +A +  +      +++  + S        LF  L  +L   + ++ + Y +    I L++E  +E++   +  L + ++ K Y L + + ++YS         +  A+E+   ++  I  + + LLS++  D  D D+   + D+        V   DV+   +  + P +S D+L+ P +   +++ IT + E      + ++  +   SL+  L   + +  S+IS   L ++  L
Sbjct:  419 QVFNSYIQCHLAAPDGTRNLS----VNGISSHEEEEINELQEDDRELFSDQLSSIGMLGRVAADHCIPLLTSLLEDRVNRLHGQLQRTQQHLMASSDLGSVDRKVLDDLYEDIHWLILVSGYLL---ADDPQGETPLIPSEVMEFSIKHSTEVDINTTLQILGSPGEKASSIPG--FNRTDSVIRLLSA-----VLRTSEVES---------------------------RATRASLTELLSPQMGKDIVWFLRRWAKTYL-LVDEKLYQQISIPLSTAFGADTEGA----QWIVGYLLEKVINNLSVWSSETDLANDTVELLVTLVEKRERANIVVQCESWWS-LAKQFASRSPPLHMLSSCVQRSLMKALVLGGFAQMDSDTKQQYWAEVLHPLQQRFLNLINQENFAQISQEEAVKQEIIATLEALCGIAEATQIDNVAS--------LFSFLMDFLSSCIGLM-EVYSNTPETINLIIEVFVEVAHKQICYLGEMKSMKLYELCLTLLQVYSKNNQSRKRGDATAEEDQYQDLLLIMELLTNLLSKEFIDFSDTDEVFRNQDQGTPASSRTVSAADVVLYGVNIVLPLMSQDLLKFPSLCNQYYKLITFICEIFPEK-IPQLPEDLFKSLMFSLELGMTSMGSEISQLCLEALSPL 1021          
BLAST of Exportin-4 vs. Ensembl Medaka
Match: xpo4 (exportin 4 [Source:NCBI gene;Acc:101165185])

HSP 1 Score: 60.8474 bits (146), Expect = 1.024e-8
Identity = 124/660 (18.79%), Postives = 273/660 (41.36%), Query Frame = 1
Query: 1645 KLFEHFLQAHLVAPDGFRNITPECDIVVIETXXXXXXXXXXXXXKKAYESGLYAAGF----AALQCI---RNSLCDLSGLLHNRMLYLENVVFSGGNPSF-------SLLEDLHWLLSIIGYTIFNVTDDLISQNRLI----------YTRHVDCSDLRSIYGHSKEQLRSMLARESNKTDACDRIVKQYQSLLINGCSEIERGLENFRYSFDMDLNCCDDIIRLFYLTLRSLAFSIQHCESGQLMADFMWLMNRWMLGYIQLLDDCENPELSDVIVLAVFVRGELGKVCHQKVISICMKMINICIVKWNQDPTVMQSVINLMLNITCSLSIARLLLVSDVWMNEMSRAIVYAAPPYNSMNDVTFSQLITSVMNVASATSTEEQLNTYLA-ILDPIGARLTKLFSSPDITKVSESEIMT--CLAFIRGMVMTKWPSRLSRITSQWSMDYRRLFDTLYPWLEKGVEILCKHYLHCTAVIQXXXXXXXXXXXXXXXXXXXXQTTKFYLLNMNIFRLYSTKTFGISSTNNIAKEETITEIKYIFTIASELLSRQVFDEFDLDD---SHDK------EKVLGYDVIAQLIFQLAPFISSDVLEVPEVGTVFFQCITLVTEFKASTFLLKMNYEFNTSLLGLLRESILNSNSQISTFSLRSIISL 3516
            ++F  ++Q HL APDG RN++    +  I + ++    +++EDD++ +   L + G     AA  CI    + L D    LH ++   +  + +  +           L ED+HWL+ + GY +    DD   +  LI          ++  VD +    I G   E+  S+     N+TD+  R++                                  ++R   +  R+   S+    S Q+  D +W + RW   Y+ L+D+    ++S  +  A     E      Q ++   ++ +   +  W+ +  +    + L++ +      A +++  + W + +++     +PP + ++      L+ +++    A    +    Y A +L P+  R   L +  +  ++S+ E +    +A +  +      +++  + S        LF  L  +L   + ++ + Y +    I L++E  +E++   +  L + ++ K Y L + + ++YS         +  A+E+   ++  I  + + LLS++  D  D D+   + D+        V   DV+   +  + P +S D+L+ P +   +++ IT + E      + ++  +   SL+  L   + +  S+IS   L ++  L
Sbjct:  382 QVFNSYIQCHLAAPDGTRNLS----VNGISSHEEEEINELQEDDRELFSDQLSSIGMLGRVAADHCIPLLTSLLEDRVNRLHGQLQRTQQHLMASSDLGSVDRKVLDDLYEDIHWLILVSGYLL---ADDPQGETPLIPSEVMEFSIKHSTEVDINTTLQILGSPGEKASSIPG--FNRTDSVIRLLSA--------------------------------VLRTSEVESRATRASLTELLSPQMGKDIVWFLRRWAKTYL-LVDEKLYQQISIPLSTAFGADTEGA----QWIVGYLLEKVINNLSVWSSETDLANDTVELLVTLVEKRERANIVVQCESWWS-LAKQFASRSPPLHMLSSCVQRSLMKALVLGGFAQMDSDTKQQYWAEVLHPLQQRFLNLINQENFAQISQEEAVKQEIIATLEALCGIAEATQIDNVAS--------LFSFLMDFLSSCIGLM-EVYSNTPETINLIIEVFVEVAHKQICYLGEMKSMKLYELCLTLLQVYSKNNQSRKRGDATAEEDQYQDLLLIMELLTNLLSKEFIDFSDTDEVFRNQDQGTPASSRTVSAADVVLYGVNIVLPLMSQDLLKFPSLCNQYYKLITFICEIFPEK-IPQLPEDLFKSLMFSLELGMTSMGSEISQLCLEALSPL 984          
BLAST of Exportin-4 vs. Planmine SMEST
Match: SMESG000055190.1 (SMESG000055190.1)

HSP 1 Score: 2523.43 bits (6539), Expect = 0.000e+0
Identity = 1280/1282 (99.84%), Postives = 1280/1282 (99.84%), Query Frame = 1
Query:   52 MSGYLQDLESYCIIFSTTSDNDERKKVENLIQKYKKSYSIDAFTHVLNNTTNEMLIYETLAAYGDTVINNWSDFAIETQVNTYSCESTSNNNIKDLKPSPQLNQVVLGLMEWTLANQLRLSHSVWSQAIINLTKMIKKSYSEKINIFLEQFMNKVNGFLRLPQLKSKIIGLDMINGLLEVFSSLKITNQQLKISRNSEIKLRNEFEKTHLSDIFVMFLNLLNDYLSTMDSIKSEESVLFMKSVLVNLESIFSWNFLNKVLSMKLQILAKNETSRRFAPPSKWSNIITDLSIIEFLFKVHDKVRSNSQLGILSMSCIIQIAGLKVKFRHNSLIENDTDICSYQFSHMEFSFAFIDVMCQYXXXXXXXXXXXXXTSQCDNLKEFYDYEVPLVADMIYQLQEHLNSSVWLDGLVLHITGKHIQLDNDRNIPRYVGEDFARYVVEKLQKFIHFYAQFCMKCIEGSAAEKITKSDTIFIETEERILSRFVAFTNFHEYLYYTDKVSTITNPDFMSTNDWDRLVFQELINVSYGCHKKLFEHFLQAHLVAPDGFRNITPECDIVVIETXXXXXXXXXXXXXKKAYESGLYAAGFAALQCIRNSLCDLSGLLHNRMLYLENVVFSGGNPSFSLLEDLHWLLSIIGYTIFNVTDDLISQNRLIYTRHVDCSDLRSIYGHSKEQLRSMLARESNKTDACDRIVKQYQSLLINGCSEIERGLENFRYSFDMDLNCCDDIIRLFYLTLRSLAFSIQHCESGQLMADFMWLMNRWMLGYIQLLDDCENPELSDVIVLAVFVRGELGKVCHQKVISICMKMINICIVKWNQDPTVMQSVINLMLNITCSLSIARLLLVSDVWMNEMSRAIVYAAPPYNSMNDVTFSQLITSVMNVASATSTEEQLNTYLAILDPIGARLTKLFSSPDITKVSESEIMTCLAFIRGMVMTKWPSRLSRITSQWSMDYRRLFDTLYPWLEKGVEILCKHYLHCTAVIQXXXXXXXXXXXXXXXXXXXXQTTKFYLLNMNIFRLYSTKTFGISSTNNIAKEETITEIKYIFTIASELLSRQVFDEFDLDDSHDKEKVLGYDVIAQLIFQLAPFISSDVLEVPEVGTVFFQCITLVTEFKASTFLLKMNYEFNTSLLGLLRESILNSNSQISTFSLRSIISLASDYYLWTNNVESVDDSQMAFSLNSDFNAILLKIMNWLRSENVGNDMLDTASSALISLVKIDQNYFLAILSDWMKSLNNPFISNKIQSMANTLELAPSEGSHISSFHRSNIDKWNDFVQLVNNYGDL 3897
            MSGYLQDLESYCIIFSTTSDNDERKKVENLIQKYKKSYSIDAFTHVLNNTTNEMLIYETLAAYGDTVINNWSDFAIETQVNTYSCESTSNNNIKDLKPSPQLNQVVLGLMEWTLANQLRLSHSVWSQAIINLTKMIKKSYSEKINIFLEQFMNKVNGFLRLPQLKSKIIGLDMINGLLEVFSSLKITNQQLKISRNSEIKLRNEFEKTHLSDIFVMFLNLLNDYLSTMDSIKSEESVLFMKSVLVNLESIFSWNFLNKVLSMKLQILAKNETSRRFAPPSKWSNIITDLSIIEFLFKVHDKVRSNSQLGILSMSCIIQIAGLKVKFRHNSLIENDTDICSYQFSHMEFSFAFIDVMCQYFNMKNSFNNNGFNTSQCDNLKEFYDYEVPLVADMIYQLQEHLNSSVWLDGLVLHITGKHIQLDNDRNIPRYVGEDFARYVVEKLQKFIHFYAQFCMKCIEGSAAEKITKSDTIFIETEERILSRFVAFTNFHEYLYYTDKVSTITNPDFMSTNDWDRLVFQELINVSYGCHKKLFEHFLQAHLVAPDGFRNITPECDIVVIETDDDNLDLDIEEDDKKAYESGLYAAGFAALQCIRNSLCDLSGLLHNRMLYLENVVFSGGNPSFSLLEDLHWLLSIIGYTIFNVTDDLISQNRLIYTRHVDCSDLRSIYGHSKEQLRSMLARESNKTDACDRIVKQYQSLLINGCSEIERGLENFRYSFDMDLNCCDDIIRLFYLTLRSLAFSIQHCESGQLMADFMWLMNRWMLGYIQLLDDCENPELSDVIVLAVFVRGELGKVCHQKVISICMKMINICIVKWNQDPTVMQSVINLMLNITCSLSIARLLLVSDVWMNEMSRAIVYAAPPYNSMNDVTFSQLITSVMNVASATSTEEQLNTYLAILDPIGARLTKLFSSPDITKVSESEIMTCLAFIRGMVMTKWPSRLSR TSQWSMDYRRLFDTLYPWLEKGVEILCKHYLHCTAVIQLLLESVLEMSSTMLLELSKSQTTKFYLLNMNIFRLYSTKTFGISSTNNIAKEETITEIKYIFTIASELLSRQVFDEFDLDDSHDKEKVLGYDVIAQLIFQLAPFISSDVLEVPEVGTVFFQCITLVTEFKASTFLLKMNYEFNTSLLGLLRESILNSNSQISTFSLRSIISLASDYYLWTNNVESVDDSQMAFSLNSDFNAILLKIMNWLRSENVGNDMLDT SSALISLVKIDQNYFLAILSDWMKSLNNPFISNKIQSMANTLELAPSEGSHISSFHRSNIDKWNDFVQLVNNYGDL
Sbjct:    1 MSGYLQDLESYCIIFSTTSDNDERKKVENLIQKYKKSYSIDAFTHVLNNTTNEMLIYETLAAYGDTVINNWSDFAIETQVNTYSCESTSNNNIKDLKPSPQLNQVVLGLMEWTLANQLRLSHSVWSQAIINLTKMIKKSYSEKINIFLEQFMNKVNGFLRLPQLKSKIIGLDMINGLLEVFSSLKITNQQLKISRNSEIKLRNEFEKTHLSDIFVMFLNLLNDYLSTMDSIKSEESVLFMKSVLVNLESIFSWNFLNKVLSMKLQILAKNETSRRFAPPSKWSNIITDLSIIEFLFKVHDKVRSNSQLGILSMSCIIQIAGLKVKFRHNSLIENDTDICSYQFSHMEFSFAFIDVMCQYFNMKNSFNNNGFNTSQCDNLKEFYDYEVPLVADMIYQLQEHLNSSVWLDGLVLHITGKHIQLDNDRNIPRYVGEDFARYVVEKLQKFIHFYAQFCMKCIEGSAAEKITKSDTIFIETEERILSRFVAFTNFHEYLYYTDKVSTITNPDFMSTNDWDRLVFQELINVSYGCHKKLFEHFLQAHLVAPDGFRNITPECDIVVIETDDDNLDLDIEEDDKKAYESGLYAAGFAALQCIRNSLCDLSGLLHNRMLYLENVVFSGGNPSFSLLEDLHWLLSIIGYTIFNVTDDLISQNRLIYTRHVDCSDLRSIYGHSKEQLRSMLARESNKTDACDRIVKQYQSLLINGCSEIERGLENFRYSFDMDLNCCDDIIRLFYLTLRSLAFSIQHCESGQLMADFMWLMNRWMLGYIQLLDDCENPELSDVIVLAVFVRGELGKVCHQKVISICMKMINICIVKWNQDPTVMQSVINLMLNITCSLSIARLLLVSDVWMNEMSRAIVYAAPPYNSMNDVTFSQLITSVMNVASATSTEEQLNTYLAILDPIGARLTKLFSSPDITKVSESEIMTCLAFIRGMVMTKWPSRLSRTTSQWSMDYRRLFDTLYPWLEKGVEILCKHYLHCTAVIQLLLESVLEMSSTMLLELSKSQTTKFYLLNMNIFRLYSTKTFGISSTNNIAKEETITEIKYIFTIASELLSRQVFDEFDLDDSHDKEKVLGYDVIAQLIFQLAPFISSDVLEVPEVGTVFFQCITLVTEFKASTFLLKMNYEFNTSLLGLLRESILNSNSQISTFSLRSIISLASDYYLWTNNVESVDDSQMAFSLNSDFNAILLKIMNWLRSENVGNDMLDTVSSALISLVKIDQNYFLAILSDWMKSLNNPFISNKIQSMANTLELAPSEGSHISSFHRSNIDKWNDFVQLVNNYGDL 1282          
The following BLAST results are available for this feature:
BLAST of Exportin-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
XPO42.057e-1219.71exportin 4 [Source:HGNC Symbol;Acc:HGNC:17796][more]
XPO42.457e-1219.71exportin 4 [Source:HGNC Symbol;Acc:HGNC:17796][more]
back to top
BLAST of Exportin-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y69A2AR.165.348e-1122.19pep chromosome:WBcel235:IV:2497801:2530296:1 gene:... [more]
Y69A2AR.166.585e-734.67pep chromosome:WBcel235:IV:2504327:2530296:1 gene:... [more]
back to top
BLAST of Exportin-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Exportin-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
xpo47.419e-1318.64exportin 4 [Source:NCBI gene;Acc:324342][more]
xpo47.419e-1318.64exportin 4 [Source:NCBI gene;Acc:324342][more]
xpo49.804e-1318.64exportin 4 [Source:NCBI gene;Acc:324342][more]
back to top
BLAST of Exportin-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Exportin-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Xpo48.077e-1319.38exportin 4 [Source:MGI Symbol;Acc:MGI:1888526][more]
Xpo48.355e-1319.38exportin 4 [Source:MGI Symbol;Acc:MGI:1888526][more]
back to top
BLAST of Exportin-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ESJ0|XPO4_MOUSE5.650e-1219.38Exportin-4 OS=Mus musculus OX=10090 GN=Xpo4 PE=1 S... [more]
sp|Q9C0E2|XPO4_HUMAN9.879e-1219.71Exportin-4 OS=Homo sapiens OX=9606 GN=XPO4 PE=1 SV... [more]
sp|Q802D3|XPO4_DANRE1.614e-1119.39Exportin-4 OS=Danio rerio OX=7955 GN=xpo4 PE=2 SV=... [more]
sp|Q5ZMR9|XPO4_CHICK2.947e-1019.31Exportin-4 OS=Gallus gallus OX=9031 GN=XPO4 PE=2 S... [more]
sp|Q499Y0|XPO4_XENLA5.381e-620.00Exportin-4 OS=Xenopus laevis OX=8355 GN=xpo4 PE=2 ... [more]
back to top
BLAST of Exportin-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A368H3M37.931e-1722.92Uncharacterized protein OS=Ancylostoma caninum OX=... [more]
A0A016VXP41.068e-1622.92Uncharacterized protein OS=Ancylostoma ceylanicum ... [more]
A0A2A6CMJ29.722e-1623.59Regulator of chromosome condensation repeat contai... [more]
H3FYU19.722e-1623.59Regulator of chromosome condensation repeat contai... [more]
A0A0N4WL881.186e-1521.93Uncharacterized protein OS=Haemonchus placei OX=62... [more]
back to top
BLAST of Exportin-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
xpo41.420e-1219.28exportin 4 [Source:NCBI gene;Acc:324342][more]
back to top
BLAST of Exportin-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Exportin-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Exportin-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO287661.253e-919.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Exportin-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
xpo45.572e-919.09exportin 4 [Source:NCBI gene;Acc:101165185][more]
xpo41.024e-818.79exportin 4 [Source:NCBI gene;Acc:101165185][more]
back to top
BLAST of Exportin-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000055190.10.000e+099.84SMESG000055190.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034303 ID=SMED30034303|Name=Exportin-4|organism=Schmidtea mediterranea sexual|type=transcript|length=4222bp
ATTTAAAAAGATTGAATATTTGAAATTCTTTATATAAAATTCGCTATTTT
AATGTCTGGTTATTTGCAAGACCTCGAATCATACTGTATAATATTTTCAA
CAACAAGTGATAATGATGAAAGAAAAAAAGTTGAGAATTTAATTCAAAAA
TACAAGAAAAGTTATTCCATTGATGCATTCACACATGTTTTAAATAACAC
AACCAATGAGATGCTTATTTATGAGACATTAGCTGCATATGGCGACACAG
TTATAAATAATTGGTCTGATTTTGCTATCGAAACTCAAGTGAATACCTAT
TCATGTGAAAGTACTTCAAATAATAACATAAAAGATCTCAAACCTAGTCC
TCAGTTAAATCAAGTCGTGTTGGGATTAATGGAGTGGACATTGGCTAACC
AATTAAGATTATCTCATTCCGTGTGGTCTCAAGCAATTATAAACCTAACA
AAAATGATTAAAAAGTCGTATTCCGAAAAAATTAACATTTTTCTAGAACA
ATTTATGAATAAAGTAAACGGATTTTTAAGATTACCTCAGCTGAAAAGCA
AAATAATCGGCCTTGACATGATCAATGGATTGCTTGAAGTTTTCTCGAGC
TTAAAGATCACAAATCAACAACTGAAAATATCAAGAAATTCTGAAATTAA
ATTGCGAAATGAATTCGAGAAAACCCATTTATCAGATATATTTGTTATGT
TCCTGAATCTACTGAATGACTATTTGTCAACGATGGATTCGATTAAATCA
GAGGAATCAGTTTTATTTATGAAATCAGTATTGGTGAATCTTGAGAGTAT
ATTTTCCTGGAACTTCCTCAATAAAGTTCTATCCATGAAATTACAAATAC
TAGCAAAAAATGAAACATCAAGAAGGTTTGCACCACCATCAAAATGGTCA
AATATAATTACCGATCTCTCAATTATTGAATTTTTATTCAAAGTTCACGA
TAAAGTGAGATCAAATTCCCAACTAGGAATTCTATCTATGTCATGCATTA
TCCAAATAGCTGGATTGAAAGTAAAATTTCGACATAATTCGTTAATTGAA
AACGATACAGACATTTGTTCTTATCAATTTTCCCACATGGAATTTAGCTT
TGCATTTATCGACGTAATGTGCCAGTATTTCAACATGAAAAATAGTTTTA
ACAATAACGGTTTCAATACAAGCCAGTGTGATAATTTGAAAGAGTTTTAT
GATTATGAAGTGCCATTGGTTGCTGACATGATTTATCAACTGCAAGAACA
TTTAAATAGTAGCGTATGGCTTGATGGATTAGTGCTTCACATAACTGGCA
AACACATACAATTGGACAATGACCGAAACATCCCTAGATATGTTGGGGAA
GATTTCGCTCGTTATGTCGTTGAAAAACTTCAAAAGTTTATTCATTTCTA
TGCTCAATTCTGTATGAAATGCATTGAAGGATCAGCAGCTGAAAAAATTA
CAAAATCAGATACAATTTTTATAGAAACCGAAGAACGTATTCTTTCTCGT
TTTGTTGCTTTTACGAATTTCCATGAGTATTTATATTACACTGACAAAGT
TTCGACAATAACTAATCCTGATTTCATGTCAACAAATGATTGGGATCGGT
TGGTTTTTCAGGAGCTCATCAATGTGTCTTATGGATGTCATAAGAAGCTA
TTTGAACATTTTCTTCAAGCTCATTTAGTTGCCCCAGATGGATTTCGGAA
TATTACTCCAGAATGTGATATCGTAGTAATTGAAACAGACGATGACAATC
TCGATCTTGATATCGAAGAGGATGATAAAAAAGCATACGAAAGCGGATTG
TATGCAGCTGGCTTTGCTGCATTACAGTGCATAAGAAACTCACTGTGTGA
CCTGAGTGGATTATTGCACAATAGGATGCTTTATTTAGAAAATGTTGTAT
TCTCAGGGGGAAATCCTTCCTTTTCTCTACTAGAAGACCTCCACTGGTTA
TTGTCTATTATTGGATATACAATTTTCAATGTCACTGATGATTTAATTTC
CCAAAATCGTTTGATTTACACCAGACATGTCGATTGTTCAGATTTACGAT
CAATATACGGGCATTCAAAAGAGCAACTTAGGTCAATGCTCGCCAGGGAA
AGTAATAAAACAGATGCCTGTGACCGAATTGTAAAGCAGTATCAGAGTTT
ATTGATTAATGGGTGTTCTGAAATAGAACGCGGTCTAGAAAATTTTAGAT
ATTCATTCGACATGGATCTCAATTGTTGTGATGATATTATCAGATTATTT
TACCTCACATTGAGATCGTTAGCATTTTCAATACAACATTGTGAAAGTGG
TCAATTGATGGCAGATTTTATGTGGCTGATGAATCGCTGGATGCTAGGAT
ACATCCAGTTATTGGATGACTGTGAAAACCCTGAGTTATCTGATGTAATC
GTGCTAGCAGTTTTTGTGAGAGGAGAACTAGGTAAAGTTTGTCATCAGAA
AGTCATTAGCATTTGCATGAAAATGATAAACATTTGTATTGTGAAATGGA
ATCAAGATCCCACAGTGATGCAGTCTGTGATCAATCTCATGCTAAACATT
ACTTGTTCACTGTCAATAGCGAGATTACTTTTAGTATCAGATGTTTGGAT
GAATGAAATGAGTCGTGCAATTGTATATGCAGCTCCGCCTTATAATAGTA
TGAATGATGTAACATTCTCGCAATTGATAACATCTGTTATGAATGTGGCA
TCAGCGACTTCAACTGAAGAACAACTGAATACTTATCTTGCGATACTCGA
TCCGATTGGCGCCAGACTAACTAAATTATTTTCCTCTCCCGACATTACTA
AAGTTTCTGAATCGGAAATAATGACTTGTCTTGCATTTATTCGTGGAATG
GTGATGACAAAATGGCCCTCGAGATTATCGAGAATTACGTCACAATGGTC
TATGGATTATCGTAGATTATTTGACACTCTTTATCCGTGGTTAGAGAAAG
GCGTTGAAATTTTATGCAAACATTATTTGCATTGCACGGCTGTCATTCAA
TTGTTACTCGAAAGTGTTCTCGAAATGTCAAGTACAATGCTATTAGAATT
GAGCAAATCACAAACCACAAAATTCTATTTATTAAATATGAATATTTTCC
GGTTATACTCCACAAAGACTTTCGGTATATCCAGCACGAATAATATTGCA
AAAGAAGAAACAATAACCGAAATCAAATATATATTTACAATTGCTTCTGA
ACTATTAAGTCGACAAGTGTTTGATGAATTTGATCTGGACGATTCTCATG
ACAAAGAAAAGGTGTTAGGTTACGACGTTATTGCTCAACTTATATTTCAA
CTGGCACCATTCATATCATCCGATGTTCTAGAGGTCCCTGAAGTCGGAAC
TGTATTTTTTCAATGCATCACGCTTGTAACTGAATTTAAAGCGTCCACTT
TTCTTTTGAAAATGAATTATGAATTCAACACGTCTCTTCTTGGTCTGTTG
AGAGAATCGATTTTAAACTCGAATTCCCAGATAAGTACATTTAGCCTCCG
GTCAATCATTTCATTGGCCAGTGATTATTACCTGTGGACTAATAATGTAG
AATCTGTTGATGATTCGCAAATGGCGTTTTCTTTAAATAGTGATTTTAAT
GCTATATTGCTAAAAATAATGAATTGGCTACGATCAGAAAATGTTGGCAA
CGACATGTTAGACACCGCCAGTAGTGCTCTTATTTCATTAGTCAAGATAG
ATCAAAATTATTTCCTTGCAATTTTATCTGATTGGATGAAATCTCTAAAC
AATCCATTTATATCCAATAAGATTCAGTCAATGGCAAATACATTGGAACT
TGCACCATCCGAAGGATCGCATATTTCTTCCTTTCATCGATCCAATATTG
ACAAGTGGAATGATTTTGTGCAACTAGTCAATAATTATGGCGATTTGTAA
AATATCGATGTTTATTAAAATATTGCTTATTTGTTTGTATTGCATTTTAT
CATTTTTAAATAATCCGAACTTGCAGCTTTTATAAAAATAAGTGTCAAAT
ACATTTTCATTTTCAATTTATTTTGTTTCACTGTAAATCAATAATTCTCA
TTTAACACAAATTCTCCTCACTGCCTTTTATAGCCGGATTTTAAATGAGT
GGTGAAATATGGGATCCAATACCGGAATTCTGGTCAATTTTTGCCAAGGT
ATTCAAAGGTTAAATACCTGTATTACGGTTATGCGAAATGTAAACATATA
AAGGGGTTTGATGATCATTTTG
back to top

protein sequence of SMED30034303-orf-1

>SMED30034303-orf-1 ID=SMED30034303-orf-1|Name=SMED30034303-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1283bp
MSGYLQDLESYCIIFSTTSDNDERKKVENLIQKYKKSYSIDAFTHVLNNT
TNEMLIYETLAAYGDTVINNWSDFAIETQVNTYSCESTSNNNIKDLKPSP
QLNQVVLGLMEWTLANQLRLSHSVWSQAIINLTKMIKKSYSEKINIFLEQ
FMNKVNGFLRLPQLKSKIIGLDMINGLLEVFSSLKITNQQLKISRNSEIK
LRNEFEKTHLSDIFVMFLNLLNDYLSTMDSIKSEESVLFMKSVLVNLESI
FSWNFLNKVLSMKLQILAKNETSRRFAPPSKWSNIITDLSIIEFLFKVHD
KVRSNSQLGILSMSCIIQIAGLKVKFRHNSLIENDTDICSYQFSHMEFSF
AFIDVMCQYFNMKNSFNNNGFNTSQCDNLKEFYDYEVPLVADMIYQLQEH
LNSSVWLDGLVLHITGKHIQLDNDRNIPRYVGEDFARYVVEKLQKFIHFY
AQFCMKCIEGSAAEKITKSDTIFIETEERILSRFVAFTNFHEYLYYTDKV
STITNPDFMSTNDWDRLVFQELINVSYGCHKKLFEHFLQAHLVAPDGFRN
ITPECDIVVIETDDDNLDLDIEEDDKKAYESGLYAAGFAALQCIRNSLCD
LSGLLHNRMLYLENVVFSGGNPSFSLLEDLHWLLSIIGYTIFNVTDDLIS
QNRLIYTRHVDCSDLRSIYGHSKEQLRSMLARESNKTDACDRIVKQYQSL
LINGCSEIERGLENFRYSFDMDLNCCDDIIRLFYLTLRSLAFSIQHCESG
QLMADFMWLMNRWMLGYIQLLDDCENPELSDVIVLAVFVRGELGKVCHQK
VISICMKMINICIVKWNQDPTVMQSVINLMLNITCSLSIARLLLVSDVWM
NEMSRAIVYAAPPYNSMNDVTFSQLITSVMNVASATSTEEQLNTYLAILD
PIGARLTKLFSSPDITKVSESEIMTCLAFIRGMVMTKWPSRLSRITSQWS
MDYRRLFDTLYPWLEKGVEILCKHYLHCTAVIQLLLESVLEMSSTMLLEL
SKSQTTKFYLLNMNIFRLYSTKTFGISSTNNIAKEETITEIKYIFTIASE
LLSRQVFDEFDLDDSHDKEKVLGYDVIAQLIFQLAPFISSDVLEVPEVGT
VFFQCITLVTEFKASTFLLKMNYEFNTSLLGLLRESILNSNSQISTFSLR
SIISLASDYYLWTNNVESVDDSQMAFSLNSDFNAILLKIMNWLRSENVGN
DMLDTASSALISLVKIDQNYFLAILSDWMKSLNNPFISNKIQSMANTLEL
APSEGSHISSFHRSNIDKWNDFVQLVNNYGDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0015031protein transport
GO:0006886intracellular protein transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
Vocabulary: molecular function
TermDefinition
GO:0008536Ran GTPase binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR12596:SF1EXPORTIN-4coord: 25..1256
NoneNo IPR availablePANTHERPTHR12596EXPORTIN 4,7-RELATEDcoord: 25..1256