Orthopedia homeobox

Overview
NameOrthopedia homeobox
Smed IDSMED30034301
Length (bp)1862
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Orthopedia homeobox (SMED30034301) t-SNE clustered cells

Violin plots show distribution of expression levels for Orthopedia homeobox (SMED30034301) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Orthopedia homeobox (SMED30034301) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Orthopedia homeobox (SMED30034301) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034301

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30034301SMESG000067397.1 SmedASXL_009406SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X2 cellSMED30034301SMESG000067397.1 SmedASXL_009406SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neuronSMED30034301SMESG000067397.1 dd_Smed_v4_19326_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30034301SMESG000067397.1 dd_Smed_v6_19326_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30034301SMESG000067397.1 OX_Smed_1.0.14894ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Orthopedia homeobox vs. Ensembl Human
Match: OTP (orthopedia homeobox [Source:HGNC Symbol;Acc:HGNC:8518])

HSP 1 Score: 119.398 bits (298), Expect = 5.581e-29
Identity = 63/70 (90.00%), Postives = 66/70 (94.29%), Query Frame = 1
Query:  856 RHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSAL 1065
            RHRTRFTPAQLNELER+F+KTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT+NVFR    L
Sbjct:  106 RHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTL 175          
BLAST of Orthopedia homeobox vs. Ensembl Human
Match: ARX (aristaless related homeobox [Source:HGNC Symbol;Acc:HGNC:18060])

HSP 1 Score: 113.235 bits (282), Expect = 1.218e-25
Identity = 51/71 (71.83%), Postives = 60/71 (84.51%), Query Frame = 1
Query:  826 SEDGKLA-KQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT 1035
            SE+G L  KQ+R+RT FT  QL ELERAF KTHYPD+F REELA+R+ LTE+RVQVWFQNRRAKW+KR+K 
Sbjct:  319 SEEGLLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKA 389          
BLAST of Orthopedia homeobox vs. Ensembl Human
Match: ALX1 (ALX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:1494])

HSP 1 Score: 105.916 bits (263), Expect = 2.356e-24
Identity = 43/67 (64.18%), Postives = 56/67 (83.58%), Query Frame = 1
Query:  844 AKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNV 1044
            +K++RHRT FT  QL ELE+ F KTHYPD+++RE+LALR  LTE+RVQVWFQNRRAKW+KR++   +
Sbjct:  130 SKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQI 196          
BLAST of Orthopedia homeobox vs. Ensembl Human
Match: PHOX2B (paired like homeobox 2B [Source:HGNC Symbol;Acc:HGNC:9143])

HSP 1 Score: 103.219 bits (256), Expect = 1.701e-23
Identity = 44/62 (70.97%), Postives = 55/62 (88.71%), Query Frame = 1
Query:  847 KQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKK 1032
            KQ+R RT FT AQL ELER F++THYPDI+ REELAL+I LTE+RVQVWFQNRRAK++K+++
Sbjct:   97 KQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQER 158          
BLAST of Orthopedia homeobox vs. Ensembl Human
Match: PHOX2A (paired like homeobox 2A [Source:HGNC Symbol;Acc:HGNC:691])

HSP 1 Score: 101.293 bits (251), Expect = 4.624e-23
Identity = 44/62 (70.97%), Postives = 55/62 (88.71%), Query Frame = 1
Query:  847 KQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKK 1032
            KQ+R RT FT AQL ELER F++THYPDI+ REELAL+I LTE+RVQVWFQNRRAK++K+++
Sbjct:   89 KQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQER 150          
BLAST of Orthopedia homeobox vs. Ensembl Celegans
Match: ceh-17 (C. Elegans Homeobox; CEH-17 [Source:UniProtKB/TrEMBL;Acc:G5EC89])

HSP 1 Score: 102.449 bits (254), Expect = 2.130e-24
Identity = 44/66 (66.67%), Postives = 55/66 (83.33%), Query Frame = 1
Query:  847 KQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNV 1044
            KQ+R RT FT  QL ELER+F +THYPDI+ REE+A+RI LTE+RVQVWFQNRRAK++K++K   V
Sbjct:  148 KQRRIRTTFTSGQLKELERSFCETHYPDIYTREEIAMRIDLTEARVQVWFQNRRAKYRKQEKIRRV 213          
BLAST of Orthopedia homeobox vs. Ensembl Celegans
Match: alr-1 (AristaLess (Drosophila homeodomain) Related [Source:UniProtKB/TrEMBL;Acc:Q21836])

HSP 1 Score: 102.834 bits (255), Expect = 1.820e-23
Identity = 42/70 (60.00%), Postives = 59/70 (84.29%), Query Frame = 1
Query:  829 EDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTS 1038
            +D    KQ+R+RT F+  QL+ELE+ F++THYPD+F REELA R+ LTE+RVQVWFQNRRAK++K++++S
Sbjct:  110 DDNGKRKQRRYRTTFSAFQLDELEKVFARTHYPDVFTREELATRVQLTEARVQVWFQNRRAKYRKQERSS 179          
BLAST of Orthopedia homeobox vs. Ensembl Celegans
Match: unc-4 (Homeobox protein unc-4 [Source:UniProtKB/Swiss-Prot;Acc:P29506])

HSP 1 Score: 98.9821 bits (245), Expect = 5.022e-23
Identity = 43/66 (65.15%), Postives = 53/66 (80.30%), Query Frame = 1
Query:  844 AKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSN 1041
            AK++R RT F+  QL ELE AF  +HYPD+FMRE LA+R+ L ESRVQVWFQNRRAKW+KR++  N
Sbjct:   86 AKRRRTRTNFSGWQLEELESAFEASHYPDVFMREALAMRLDLLESRVQVWFQNRRAKWRKREQNRN 151          
BLAST of Orthopedia homeobox vs. Ensembl Celegans
Match: unc-30 (Homeobox protein unc-30 [Source:UniProtKB/Swiss-Prot;Acc:P52906])

HSP 1 Score: 92.4337 bits (228), Expect = 3.266e-20
Identity = 41/76 (53.95%), Postives = 55/76 (72.37%), Query Frame = 1
Query:  805 DSNIDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKK 1032
            DS  + ++  GK+ K +R RT FT  QL ELE  FS+  YPD+  REE+A+ I LTE RV+VWF+NRRAKW+KR++
Sbjct:   97 DSTGNGSTNGGKIQKPRRQRTHFTSHQLTELENWFSRNRYPDMACREEIAVWISLTEPRVRVWFKNRRAKWRKRER 172          
BLAST of Orthopedia homeobox vs. Ensembl Celegans
Match: unc-30 (Homeobox protein unc-30 [Source:UniProtKB/Swiss-Prot;Acc:P52906])

HSP 1 Score: 92.0485 bits (227), Expect = 3.765e-20
Identity = 41/76 (53.95%), Postives = 55/76 (72.37%), Query Frame = 1
Query:  805 DSNIDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKK 1032
            DS  + ++  GK+ K +R RT FT  QL ELE  FS+  YPD+  REE+A+ I LTE RV+VWF+NRRAKW+KR++
Sbjct:   97 DSTGNGSTNGGKIQKPRRQRTHFTSHQLTELENWFSRNRYPDMACREEIAVWISLTEPRVRVWFKNRRAKWRKRER 172          
BLAST of Orthopedia homeobox vs. Ensembl Fly
Match: otp (gene:FBgn0015524 transcript:FBtr0110772)

HSP 1 Score: 134.035 bits (336), Expect = 5.659e-35
Identity = 76/100 (76.00%), Postives = 81/100 (81.00%), Query Frame = 1
Query:  847 KQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFS-CPMSDG 1143
            KQKRHRTRFTPAQLNELER FSKTHYPDIFMREE+A+RIGLTESRVQVWFQNRRAKWKKRKKT+NVFRT  AL       P+H   PFG N +   M DG
Sbjct:   12 KQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRTPGALL------PSHGLPPFGANITNIAMGDG 105          
BLAST of Orthopedia homeobox vs. Ensembl Fly
Match: otp (gene:FBgn0015524 transcript:FBtr0342795)

HSP 1 Score: 134.806 bits (338), Expect = 6.771e-35
Identity = 81/126 (64.29%), Postives = 89/126 (70.63%), Query Frame = 1
Query:  847 KQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFS-CPMSDGKSNAT------WPSLDINENAASWSQ 1203
            KQKRHRTRFTPAQLNELER FSKTHYPDIFMREE+A+RIGLTESRVQVWFQNRRAKWKKRKKT+NVFRT  AL       P+H   PFG N +   M DG           W S+ +N   A + Q
Sbjct:   12 KQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRTPGALL------PSHGLPPFGANITNIAMGDGLCGTGMFGGDRW-SVGVNPMTAGFGQ 130          
BLAST of Orthopedia homeobox vs. Ensembl Fly
Match: otp (gene:FBgn0015524 transcript:FBtr0342796)

HSP 1 Score: 132.494 bits (332), Expect = 1.770e-34
Identity = 75/99 (75.76%), Postives = 80/99 (80.81%), Query Frame = 1
Query:  850 QKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFS-CPMSDG 1143
            QKRHRTRFTPAQLNELER FSKTHYPDIFMREE+A+RIGLTESRVQVWFQNRRAKWKKRKKT+NVFRT  AL       P+H   PFG N +   M DG
Sbjct:    6 QKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRTPGALL------PSHGLPPFGANITNIAMGDG 98          
BLAST of Orthopedia homeobox vs. Ensembl Fly
Match: otp (gene:FBgn0015524 transcript:FBtr0342799)

HSP 1 Score: 135.191 bits (339), Expect = 2.088e-34
Identity = 76/100 (76.00%), Postives = 81/100 (81.00%), Query Frame = 1
Query:  847 KQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFS-CPMSDG 1143
            KQKRHRTRFTPAQLNELER FSKTHYPDIFMREE+A+RIGLTESRVQVWFQNRRAKWKKRKKT+NVFRT  AL       P+H   PFG N +   M DG
Sbjct:  115 KQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRTPGALL------PSHGLPPFGANITNIAMGDG 208          
BLAST of Orthopedia homeobox vs. Ensembl Fly
Match: otp (gene:FBgn0015524 transcript:FBtr0342800)

HSP 1 Score: 135.961 bits (341), Expect = 2.119e-34
Identity = 81/126 (64.29%), Postives = 89/126 (70.63%), Query Frame = 1
Query:  847 KQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFS-CPMSDGKSNAT------WPSLDINENAASWSQ 1203
            KQKRHRTRFTPAQLNELER FSKTHYPDIFMREE+A+RIGLTESRVQVWFQNRRAKWKKRKKT+NVFRT  AL       P+H   PFG N +   M DG           W S+ +N   A + Q
Sbjct:  115 KQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRTPGALL------PSHGLPPFGANITNIAMGDGLCGTGMFGGDRW-SVGVNPMTAGFGQ 233          
BLAST of Orthopedia homeobox vs. Ensembl Zebrafish
Match: otpb (orthopedia homeobox b [Source:NCBI gene;Acc:30316])

HSP 1 Score: 117.857 bits (294), Expect = 6.273e-29
Identity = 63/70 (90.00%), Postives = 66/70 (94.29%), Query Frame = 1
Query:  856 RHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSAL 1065
            RHRTRFTPAQLNELER+F+KTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT+NVFR    L
Sbjct:   88 RHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTL 157          
BLAST of Orthopedia homeobox vs. Ensembl Zebrafish
Match: otpb (orthopedia homeobox b [Source:NCBI gene;Acc:30316])

HSP 1 Score: 117.857 bits (294), Expect = 8.480e-29
Identity = 63/70 (90.00%), Postives = 66/70 (94.29%), Query Frame = 1
Query:  856 RHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSAL 1065
            RHRTRFTPAQLNELER+F+KTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT+NVFR    L
Sbjct:  101 RHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTL 170          
BLAST of Orthopedia homeobox vs. Ensembl Zebrafish
Match: otpa (orthopedia homeobox a [Source:ZFIN;Acc:ZDB-GENE-070216-1])

HSP 1 Score: 117.857 bits (294), Expect = 9.353e-29
Identity = 63/70 (90.00%), Postives = 66/70 (94.29%), Query Frame = 1
Query:  856 RHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSAL 1065
            RHRTRFTPAQLNELER+F+KTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT+NVFR    L
Sbjct:  103 RHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTL 172          
BLAST of Orthopedia homeobox vs. Ensembl Zebrafish
Match: otpb (orthopedia homeobox b [Source:NCBI gene;Acc:30316])

HSP 1 Score: 117.857 bits (294), Expect = 1.309e-28
Identity = 63/70 (90.00%), Postives = 66/70 (94.29%), Query Frame = 1
Query:  856 RHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSAL 1065
            RHRTRFTPAQLNELER+F+KTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT+NVFR    L
Sbjct:  114 RHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTL 183          
BLAST of Orthopedia homeobox vs. Ensembl Zebrafish
Match: otpa (orthopedia homeobox a [Source:ZFIN;Acc:ZDB-GENE-070216-1])

HSP 1 Score: 117.472 bits (293), Expect = 1.539e-28
Identity = 63/70 (90.00%), Postives = 66/70 (94.29%), Query Frame = 1
Query:  856 RHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSAL 1065
            RHRTRFTPAQLNELER+F+KTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT+NVFR    L
Sbjct:  116 RHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTL 185          
BLAST of Orthopedia homeobox vs. Ensembl Xenopus
Match: cmtm4 (CKLF-like MARVEL transmembrane domain containing 4 [Source:Xenbase;Acc:XB-GENE-983615])

HSP 1 Score: 120.553 bits (301), Expect = 1.565e-29
Identity = 64/71 (90.14%), Postives = 67/71 (94.37%), Query Frame = 1
Query:  853 KRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSAL 1065
            KRHRTRFTPAQLNELER+F+KTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT+NVFR    L
Sbjct:   97 KRHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTL 167          
BLAST of Orthopedia homeobox vs. Ensembl Xenopus
Match: cmtm4 (CKLF-like MARVEL transmembrane domain containing 4 [Source:Xenbase;Acc:XB-GENE-983615])

HSP 1 Score: 120.553 bits (301), Expect = 1.890e-29
Identity = 64/71 (90.14%), Postives = 67/71 (94.37%), Query Frame = 1
Query:  853 KRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSAL 1065
            KRHRTRFTPAQLNELER+F+KTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT+NVFR    L
Sbjct:  103 KRHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTL 173          
BLAST of Orthopedia homeobox vs. Ensembl Xenopus
Match: cmtm4 (CKLF-like MARVEL transmembrane domain containing 4 [Source:Xenbase;Acc:XB-GENE-983615])

HSP 1 Score: 120.168 bits (300), Expect = 2.401e-29
Identity = 64/71 (90.14%), Postives = 67/71 (94.37%), Query Frame = 1
Query:  853 KRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSAL 1065
            KRHRTRFTPAQLNELER+F+KTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT+NVFR    L
Sbjct:  101 KRHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTL 171          
BLAST of Orthopedia homeobox vs. Ensembl Xenopus
Match: ARX (aristaless related homeobox [Source:NCBI gene;Acc:100486727])

HSP 1 Score: 113.62 bits (283), Expect = 5.516e-26
Identity = 51/71 (71.83%), Postives = 60/71 (84.51%), Query Frame = 1
Query:  826 SEDGKLA-KQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT 1035
            SE+G L  KQ+R+RT FT  QL ELERAF KTHYPD+F REELA+R+ LTE+RVQVWFQNRRAKW+KR+K 
Sbjct:  292 SEEGMLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKA 362          
BLAST of Orthopedia homeobox vs. Ensembl Xenopus
Match: ENSXETT00000045443.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:38234864:38239775:1 gene:ENSXETG00000019174.1 transcript:ENSXETT00000045443.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 3.198e-25
Identity = 46/74 (62.16%), Postives = 61/74 (82.43%), Query Frame = 1
Query:  814 IDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT 1035
            ++ ++  GK  KQ+R+RT F+  QL ELE AF K+HYPD+F RE+LA+R+ LTE+RVQVWFQNRRAKW+KR+KT
Sbjct:    5 LESSAPSGK-RKQRRYRTTFSNLQLEELEMAFRKSHYPDVFTREDLAMRLDLTEARVQVWFQNRRAKWRKREKT 77          
BLAST of Orthopedia homeobox vs. Ensembl Mouse
Match: Otp (orthopedia homeobox [Source:MGI Symbol;Acc:MGI:99835])

HSP 1 Score: 119.398 bits (298), Expect = 3.831e-29
Identity = 63/70 (90.00%), Postives = 66/70 (94.29%), Query Frame = 1
Query:  856 RHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSAL 1065
            RHRTRFTPAQLNELER+F+KTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT+NVFR    L
Sbjct:  106 RHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTL 175          
BLAST of Orthopedia homeobox vs. Ensembl Mouse
Match: Arx (aristaless related homeobox [Source:MGI Symbol;Acc:MGI:1097716])

HSP 1 Score: 112.849 bits (281), Expect = 9.946e-26
Identity = 51/71 (71.83%), Postives = 60/71 (84.51%), Query Frame = 1
Query:  826 SEDGKLA-KQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT 1035
            SE+G L  KQ+R+RT FT  QL ELERAF KTHYPD+F REELA+R+ LTE+RVQVWFQNRRAKW+KR+K 
Sbjct:  321 SEEGLLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKA 391          
BLAST of Orthopedia homeobox vs. Ensembl Mouse
Match: Arx (aristaless related homeobox [Source:MGI Symbol;Acc:MGI:1097716])

HSP 1 Score: 112.849 bits (281), Expect = 9.946e-26
Identity = 51/71 (71.83%), Postives = 60/71 (84.51%), Query Frame = 1
Query:  826 SEDGKLA-KQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT 1035
            SE+G L  KQ+R+RT FT  QL ELERAF KTHYPD+F REELA+R+ LTE+RVQVWFQNRRAKW+KR+K 
Sbjct:  321 SEEGLLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKA 391          
BLAST of Orthopedia homeobox vs. Ensembl Mouse
Match: Alx1 (ALX homeobox 1 [Source:MGI Symbol;Acc:MGI:104621])

HSP 1 Score: 105.145 bits (261), Expect = 7.612e-25
Identity = 43/67 (64.18%), Postives = 56/67 (83.58%), Query Frame = 1
Query:  844 AKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNV 1044
            +K++RHRT FT  QL ELE+ F KTHYPD+++RE+LALR  LTE+RVQVWFQNRRAKW+KR++   +
Sbjct:  130 SKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQI 196          
BLAST of Orthopedia homeobox vs. Ensembl Mouse
Match: Alx1 (ALX homeobox 1 [Source:MGI Symbol;Acc:MGI:104621])

HSP 1 Score: 105.916 bits (263), Expect = 1.712e-24
Identity = 43/67 (64.18%), Postives = 56/67 (83.58%), Query Frame = 1
Query:  844 AKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNV 1044
            +K++RHRT FT  QL ELE+ F KTHYPD+++RE+LALR  LTE+RVQVWFQNRRAKW+KR++   +
Sbjct:  130 SKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQI 196          
BLAST of Orthopedia homeobox vs. UniProt/SwissProt
Match: sp|Q6SZ65|OTP_LYTVA (Homeobox protein orthopedia OS=Lytechinus variegatus OX=7654 GN=Otp PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 3.879e-35
Identity = 79/114 (69.30%), Postives = 90/114 (78.95%), Query Frame = 1
Query:  829 EDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSL 1170
            +D K AKQKRHRTRFTPAQLNELER F+KTHYPDIFMREE+A+R+GLTESRVQVWFQNRRAKWKKRKKT+NVFRT  AL  L S G A F  P  ++F C    G+    WP++
Sbjct:  105 DDDKPAKQKRHRTRFTPAQLNELERNFAKTHYPDIFMREEIAMRVGLTESRVQVWFQNRRAKWKKRKKTTNVFRTPGAL--LPSHGLAQFPSPMNDSF-CNF-HGQDTRGWPAM 214          
BLAST of Orthopedia homeobox vs. UniProt/SwissProt
Match: sp|Q6SR68|OTP_HELTB (Homeobox protein orthopedia OS=Heliocidaris tuberculata OX=7635 GN=Otp PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 7.498e-35
Identity = 79/114 (69.30%), Postives = 90/114 (78.95%), Query Frame = 1
Query:  829 EDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSL 1170
            +D K AKQKRHRTRFTPAQLNELER F+KTHYPDIFMREE+A+R+GLTESRVQVWFQNRRAKWKKRKKT+NVFRT  AL  L S G A F  P  ++F C    G+    WP++
Sbjct:  107 DDDKPAKQKRHRTRFTPAQLNELERNFAKTHYPDIFMREEIAMRVGLTESRVQVWFQNRRAKWKKRKKTTNVFRTPGAL--LPSHGLAQFPSPMNDSF-CNF-HGQDTRGWPAM 216          
BLAST of Orthopedia homeobox vs. UniProt/SwissProt
Match: sp|Q6SR69|OTP_HELER (Homeobox protein orthopedia OS=Heliocidaris erythrogramma OX=7634 GN=Otp PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 7.498e-35
Identity = 79/114 (69.30%), Postives = 90/114 (78.95%), Query Frame = 1
Query:  829 EDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSL 1170
            +D K AKQKRHRTRFTPAQLNELER F+KTHYPDIFMREE+A+R+GLTESRVQVWFQNRRAKWKKRKKT+NVFRT  AL  L S G A F  P  ++F C    G+    WP++
Sbjct:  107 DDDKPAKQKRHRTRFTPAQLNELERNFAKTHYPDIFMREEIAMRVGLTESRVQVWFQNRRAKWKKRKKTTNVFRTPGAL--LPSHGLAQFPSPMNDSF-CNF-HGQDTRGWPAM 216          
BLAST of Orthopedia homeobox vs. UniProt/SwissProt
Match: sp|O76971|OTP_PARLI (Homeobox protein orthopedia OS=Paracentrotus lividus OX=7656 GN=OTP PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 8.861e-35
Identity = 79/114 (69.30%), Postives = 90/114 (78.95%), Query Frame = 1
Query:  829 EDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSL 1170
            +D K AKQKRHRTRFTPAQLNELER F+KTHYPDIFMREE+A+R+GLTESRVQVWFQNRRAKWKKRKKT+NVFRT  AL  L S G A F  P  ++F C    G+    WP++
Sbjct:  109 DDDKPAKQKRHRTRFTPAQLNELERNFAKTHYPDIFMREEIAMRVGLTESRVQVWFQNRRAKWKKRKKTTNVFRTPGAL--LPSHGLAQFPSPMNDSF-CNF-HGQDTRGWPAM 218          
BLAST of Orthopedia homeobox vs. UniProt/SwissProt
Match: sp|P56672|OTP_DROME (Homeobox protein orthopedia OS=Drosophila melanogaster OX=7227 GN=otp PE=2 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 7.505e-33
Identity = 80/125 (64.00%), Postives = 88/125 (70.40%), Query Frame = 1
Query:  850 QKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFS-CPMSDGKSNAT------WPSLDINENAASWSQ 1203
            QKRHRTRFTPAQLNELER FSKTHYPDIFMREE+A+RIGLTESRVQVWFQNRRAKWKKRKKT+NVFRT  AL       P+H   PFG N +   M DG           W S+ +N   A + Q
Sbjct:  109 QKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRTPGALL------PSHGLPPFGANITNIAMGDGLCGTGMFGGDRW-SVGVNPMTAGFGQ 226          
BLAST of Orthopedia homeobox vs. TrEMBL
Match: A0A0A7M693 (Orthopedia homeobox (Fragment) OS=Schmidtea polychroa OX=50054 GN=otp PE=2 SV=1)

HSP 1 Score: 464.922 bits (1195), Expect = 1.076e-158
Identity = 261/261 (100.00%), Postives = 261/261 (100.00%), Query Frame = 1
Query:  817 DETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMXXXXXXXXLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFINTPYHSSNIMDSYGVPDDVQAASHMLTTPYLXXXXXXXXXXXXXXXLGSISNTVFSTASSPTNP 1599
            DETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMPPPPPPPPLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFINTPYHSSNIMDSYGVPDDVQAASHMLTTPYLSSNNSVSSFFFPSTNLGSISNTVFSTASSPTNP
Sbjct:    1 DETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMPPPPPPPPLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFINTPYHSSNIMDSYGVPDDVQAASHMLTTPYLSSNNSVSSFFFPSTNLGSISNTVFSTASSPTNP 261          
BLAST of Orthopedia homeobox vs. TrEMBL
Match: A0A1B6KBZ1 (Homeobox domain-containing protein (Fragment) OS=Graphocephala atropunctata OX=36148 GN=g.54863 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 2.100e-34
Identity = 84/136 (61.76%), Postives = 95/136 (69.85%), Query Frame = 1
Query:  829 EDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFG--NNFSCPMSD-GKSNATWPSLDINENAASWSQRYWSMTAM 1227
            +DGK +KQKRHRTRFTPAQLNELER FSKTHYPDIFMREE+A+RIGLTESRVQVWFQNRRAKWKKRKKT+NVFRT  AL       P+H   PFG  ++  CP    G S+  W    +    +  SQ   SM   
Sbjct:   25 DDGKPSKQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRTPGALL------PSHGLPPFGSMSDGLCPSGMFGGSDTRWGVTSMTSGLSQLSQGGVSMGGF 154          
BLAST of Orthopedia homeobox vs. TrEMBL
Match: A0A1B6CD15 (Homeobox domain-containing protein (Fragment) OS=Clastoptera arizonana OX=38151 GN=g.1900 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 2.403e-33
Identity = 88/161 (54.66%), Postives = 101/161 (62.73%), Query Frame = 1
Query:  829 EDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFG--NNFSCPMSD-GKSNATWPSLDINENAASWSQRYWSMTAMXXXXXXXXLGLSHHLASSGCFSNNS 1302
            +D K +KQKRHRTRFTPAQLNELER FSKTHYPDIFMREE+A+RIGLTESRVQVWFQNRRAKWKKRKKT+NVFRT  AL       P+H   PFG  ++  CP    G  ++ W    +    +  SQ   SM             LS  L  +   SN S
Sbjct:   14 DDNKPSKQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRTPGALL------PSHGLPPFGSMSDGLCPSGMFGTGDSRWGVTSMTSGLSQLSQSGVSMGGFGQLTSHQSSALSSALPITSMASNGS 168          
BLAST of Orthopedia homeobox vs. TrEMBL
Match: A6YIC2 (Orthopedia OS=Platynereis dumerilii OX=6359 GN=otp PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.051e-32
Identity = 76/100 (76.00%), Postives = 83/100 (83.00%), Query Frame = 1
Query:  817 DETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGN 1116
            DE+ ED K+AKQKRHRTRFTPAQLNELER F+KTHYPDIFMREE+A+RIGLTESRVQVWFQNRRAKWKKRKKT+NVFRT  AL       P+    PFG 
Sbjct:   42 DESRED-KVAKQKRHRTRFTPAQLNELERCFAKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRTPGALL------PSTGLSPFGG 134          
BLAST of Orthopedia homeobox vs. TrEMBL
Match: R7TJG0 (Homeobox domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_99648 PE=4 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 1.853e-32
Identity = 59/69 (85.51%), Postives = 65/69 (94.20%), Query Frame = 1
Query:  823 TSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRK 1029
            +S++   +KQKRHRTRFTPAQ+NELE AFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKR+
Sbjct:   39 SSQESPGSKQKRHRTRFTPAQINELEHAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRR 107          
BLAST of Orthopedia homeobox vs. Ensembl Cavefish
Match: OTP (orthopedia homeobox [Source:NCBI gene;Acc:103045922])

HSP 1 Score: 125.946 bits (315), Expect = 1.196e-31
Identity = 90/187 (48.13%), Postives = 105/187 (56.15%), Query Frame = 1
Query:  847 KQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMXXXXXXXXLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFI 1407
            KQKRHRTRFTPAQLNELER+F+KTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT+NVFR    L       P H   P    F   M DG  +        + N   W+     M  +     PP LG    +A S   S  S     P T+ G+  + +   +    L  P+ P  +
Sbjct:   92 KQKRHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTLL------PTHHGLP---QFPSAMGDGLCS-------FHANDTRWAAA--GMPGVSQLQLPPALGRQQAMAQS--LSPCSLSAGPPPTSMGLSNMSSNGSSLQSHLYQPAFPGMV 258          
BLAST of Orthopedia homeobox vs. Ensembl Cavefish
Match: OTP (orthopedia homeobox [Source:NCBI gene;Acc:103045922])

HSP 1 Score: 125.561 bits (314), Expect = 3.349e-31
Identity = 90/187 (48.13%), Postives = 105/187 (56.15%), Query Frame = 1
Query:  847 KQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMXXXXXXXXLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFI 1407
            KQKRHRTRFTPAQLNELER+F+KTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT+NVFR    L       P H   P    F   M DG  +        + N   W+     M  +     PP LG    +A S   S  S     P T+ G+  + +   +    L  P+ P  +
Sbjct:  135 KQKRHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTLL------PTHHGLP---QFPSAMGDGLCS-------FHANDTRWAAA--GMPGVSQLQLPPALGRQQAMAQS--LSPCSLSAGPPPTSMGLSNMSSNGSSLQSHLYQPAFPGMV 301          
BLAST of Orthopedia homeobox vs. Ensembl Cavefish
Match: otpb (homeobox protein orthopedia B [Source:NCBI gene;Acc:103039275])

HSP 1 Score: 118.242 bits (295), Expect = 4.575e-29
Identity = 63/70 (90.00%), Postives = 66/70 (94.29%), Query Frame = 1
Query:  856 RHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSAL 1065
            RHRTRFTPAQLNELER+F+KTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT+NVFR    L
Sbjct:   89 RHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTL 158          
BLAST of Orthopedia homeobox vs. Ensembl Cavefish
Match: otpb (homeobox protein orthopedia B [Source:NCBI gene;Acc:103039275])

HSP 1 Score: 118.242 bits (295), Expect = 4.575e-29
Identity = 63/70 (90.00%), Postives = 66/70 (94.29%), Query Frame = 1
Query:  856 RHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSAL 1065
            RHRTRFTPAQLNELER+F+KTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT+NVFR    L
Sbjct:   89 RHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTL 158          
BLAST of Orthopedia homeobox vs. Ensembl Cavefish
Match: otpb (homeobox protein orthopedia B [Source:NCBI gene;Acc:103039275])

HSP 1 Score: 117.857 bits (294), Expect = 9.511e-29
Identity = 63/70 (90.00%), Postives = 66/70 (94.29%), Query Frame = 1
Query:  856 RHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSAL 1065
            RHRTRFTPAQLNELER+F+KTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT+NVFR    L
Sbjct:  115 RHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTL 184          
BLAST of Orthopedia homeobox vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010761.1 (pep scaffold:Pmarinus_7.0:GL476415:928307:936594:-1 gene:ENSPMAG00000009746.1 transcript:ENSPMAT00000010761.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 2.534e-21
Identity = 43/72 (59.72%), Postives = 56/72 (77.78%), Query Frame = 1
Query:  847 KQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSA 1062
            KQ+R RT FT AQL+ LE  FSKT YPDIFMREE+AL+I L ESRVQVWF+NRRAK ++++++    +  +A
Sbjct:    5 KQRRERTTFTRAQLDVLEALFSKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGGQSKARAA 76          
BLAST of Orthopedia homeobox vs. Ensembl Sea Lamprey
Match: dmbx1b (diencephalon/mesencephalon homeobox 1b [Source:NCBI gene;Acc:550288])

HSP 1 Score: 85.1149 bits (209), Expect = 3.257e-18
Identity = 36/62 (58.06%), Postives = 48/62 (77.42%), Query Frame = 1
Query:  850 QKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT 1035
            Q+R RT FT  QL  LE+ F KTHYPD+ MRE LA+   L E+RVQVWF+NRRAK++K++++
Sbjct:   43 QRRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRS 104          
BLAST of Orthopedia homeobox vs. Ensembl Sea Lamprey
Match: otx5 (orthodenticle homolog 5 [Source:ZFIN;Acc:ZDB-GENE-030508-1])

HSP 1 Score: 73.9442 bits (180), Expect = 8.803e-15
Identity = 37/56 (66.07%), Postives = 42/56 (75.00%), Query Frame = 1
Query:  847 KQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAK 1014
            KQ+R RT FT AQL+ LE  FSKT YPDIFMREE+AL+I L ESRVQ+ F   R K
Sbjct:   37 KQRRERTTFTRAQLD-LESLFSKTRYPDIFMREEVALKINLPESRVQINFPESRVK 91          
BLAST of Orthopedia homeobox vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001141.1 (pep scaffold:Pmarinus_7.0:GL478075:36995:38394:-1 gene:ENSPMAG00000001023.1 transcript:ENSPMAT00000001141.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 2.176e-12
Identity = 36/83 (43.37%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  844 AKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPA 1092
             K +R RT F+  QL ELER FS+  Y     R ++A  + LTE++V++WFQNRR KWK+ K           LQ   S GPA
Sbjct:    1 GKCRRPRTAFSSQQLLELERHFSRQRYLSRPQRFQVASALMLTETQVKIWFQNRRMKWKRGK--------GGQLQEKQSLGPA 75          
BLAST of Orthopedia homeobox vs. Ensembl Sea Lamprey
Match: emx2 (empty spiracles homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-990415-54])

HSP 1 Score: 64.6994 bits (156), Expect = 9.097e-12
Identity = 37/76 (48.68%), Postives = 48/76 (63.16%), Query Frame = 1
Query:  820 ETSEDGKL------AKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRK 1029
            ET  +G L       K KR RT F+P+QL  LE AF K HY     R++LA  + LTE++V+VWFQNRR K K++K
Sbjct:  171 ETGHEGLLFPGPFARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGSERKQLASSLSLTETQVKVWFQNRRTKHKRQK 246          
BLAST of Orthopedia homeobox vs. Ensembl Yeast
Match: PHO2 (Homeobox transcription factor; regulatory targets include genes involved in phosphate metabolism; binds cooperatively with Pho4p to the PHO5 promoter; phosphorylation of Pho2p facilitates interaction with Pho4p; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002264])

HSP 1 Score: 54.6842 bits (130), Expect = 3.136e-8
Identity = 25/64 (39.06%), Postives = 39/64 (60.94%), Query Frame = 1
Query:  850 QKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSN 1041
            Q+  RTR     L+ L+R F     P +  R++++  IG+ E  V++WFQNRRAK +K++  SN
Sbjct:   77 QRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQHGSN 140          
BLAST of Orthopedia homeobox vs. Ensembl Yeast
Match: YOX1 (Homeobox transcriptional repressor; binds to Mcm1p and to early cell cycle boxes (ECBs) in the promoters of cell cycle-regulated genes expressed in M/G1 phase; expression is cell cycle-regulated; phosphorylated by Cdc28p; relocalizes from nucleus to cytoplasm upon DNA replication stress; YOX1 has a paralog, YHP1, that arose from the whole genome duplication [Source:SGD;Acc:S000004489])

HSP 1 Score: 47.7506 bits (112), Expect = 2.961e-6
Identity = 28/87 (32.18%), Postives = 51/87 (58.62%), Query Frame = 1
Query:  829 EDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGP 1089
            ++  LA++KR RT  +  +L+ L+  F K   P    R ELA    +TE  VQ+WFQN+R   K+++  ++  ++++ +QT++   P
Sbjct:  171 DNAPLARRKRRRT--SSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKRQRIATS--KSTTIIQTVSPPSP 253          
BLAST of Orthopedia homeobox vs. Ensembl Nematostella
Match: EDO42148 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2G9])

HSP 1 Score: 120.168 bits (300), Expect = 1.154e-29
Identity = 72/125 (57.60%), Postives = 85/125 (68.00%), Query Frame = 1
Query:  805 DSNIDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQE-----PFGNNFSCPMSDGKSNATWP 1164
            D + D  S D + AKQKRHRTRFTPAQLNELER F++THYPD+FMREELA RIGLTESRVQVWFQNRRAKWKKRKKT+++ R        A   P+H  +     P G+      +D +    WP
Sbjct:   75 DQDDDRKSTDSQAAKQKRHRTRFTPAQLNELERCFARTHYPDVFMREELAARIGLTESRVQVWFQNRRAKWKKRKKTASILRPP------APILPSHMAQGYNAGPIGDTLCTFHNDHR----WP 189          
BLAST of Orthopedia homeobox vs. Ensembl Nematostella
Match: EDO42103 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2G7])

HSP 1 Score: 108.227 bits (269), Expect = 7.929e-27
Identity = 49/76 (64.47%), Postives = 59/76 (77.63%), Query Frame = 1
Query:  808 SNIDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT 1035
            S  +   EDGK  K +R RT FT  QL++LERAF KT YPD+F REELALR+ L+E+RVQVWFQNRRAKW+KR+K 
Sbjct:    6 SGEESAGEDGKPRKVRRSRTTFTTYQLHQLERAFEKTQYPDVFTREELALRLDLSEARVQVWFQNRRAKWRKREKA 81          
BLAST of Orthopedia homeobox vs. Ensembl Nematostella
Match: EDO38926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBH9])

HSP 1 Score: 102.449 bits (254), Expect = 2.765e-25
Identity = 43/66 (65.15%), Postives = 55/66 (83.33%), Query Frame = 1
Query:  847 KQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNV 1044
            K++R+RT FT  QL E+ER F KTHYPD++ RE+LALR  LTE+RVQVWFQNRRAKW+KR++ + V
Sbjct:   13 KKRRNRTTFTAYQLEEMERVFQKTHYPDVYTREQLALRCALTEARVQVWFQNRRAKWRKRERFTQV 78          
BLAST of Orthopedia homeobox vs. Ensembl Nematostella
Match: EDO31796 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWY2])

HSP 1 Score: 98.5969 bits (244), Expect = 5.400e-25
Identity = 50/77 (64.94%), Postives = 61/77 (79.22%), Query Frame = 1
Query:  805 DSNIDETSEDGKLA-KQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKK 1032
            DSN +   +D     KQ+R+RT FT  QL ELERAF+KTHYPD+F RE LA++I LTE+RVQVWFQNRRAKW+KR+K
Sbjct:   15 DSNNELEGKDSTAKRKQRRYRTTFTSYQLEELERAFAKTHYPDVFTREALAVKIDLTEARVQVWFQNRRAKWRKREK 91          
BLAST of Orthopedia homeobox vs. Ensembl Nematostella
Match: EDO39362 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA96])

HSP 1 Score: 95.1301 bits (235), Expect = 4.840e-24
Identity = 42/72 (58.33%), Postives = 57/72 (79.17%), Query Frame = 1
Query:  817 DETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKK 1032
            +++S +    K+ R+RT F+  Q+ ELERAF K  YPD+F REELA ++GLTE+R+QVWFQNRRAKW+KR+K
Sbjct:    2 EDSSANAAKKKKTRYRTTFSQYQIEELERAFDKAPYPDVFAREELAAKLGLTEARIQVWFQNRRAKWRKREK 73          
BLAST of Orthopedia homeobox vs. Ensembl Medaka
Match: OTP (homeobox protein orthopedia B [Source:NCBI gene;Acc:101157220])

HSP 1 Score: 126.331 bits (316), Expect = 6.213e-32
Identity = 68/81 (83.95%), Postives = 72/81 (88.89%), Query Frame = 1
Query:  823 TSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSAL 1065
            TS+     KQKRHRTRFTPAQLNELER+F+KTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT+NVFR    L
Sbjct:   76 TSQTASQQKQKRHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTL 156          
BLAST of Orthopedia homeobox vs. Ensembl Medaka
Match: OTP (homeobox protein orthopedia B [Source:NCBI gene;Acc:101157220])

HSP 1 Score: 125.946 bits (315), Expect = 1.407e-31
Identity = 68/81 (83.95%), Postives = 72/81 (88.89%), Query Frame = 1
Query:  823 TSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSAL 1065
            TS+     KQKRHRTRFTPAQLNELER+F+KTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT+NVFR    L
Sbjct:  102 TSQTASQQKQKRHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTL 182          
BLAST of Orthopedia homeobox vs. Ensembl Medaka
Match: OTP (orthopedia homeobox [Source:NCBI gene;Acc:111948311])

HSP 1 Score: 117.087 bits (292), Expect = 1.951e-28
Identity = 63/70 (90.00%), Postives = 66/70 (94.29%), Query Frame = 1
Query:  856 RHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSAL 1065
            RHRTRFTPAQLNELER+F+KTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT+NVFR    L
Sbjct:  120 RHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTL 189          
BLAST of Orthopedia homeobox vs. Ensembl Medaka
Match: arx (aristaless related homeobox [Source:NCBI gene;Acc:100144363])

HSP 1 Score: 113.235 bits (282), Expect = 2.609e-26
Identity = 51/71 (71.83%), Postives = 60/71 (84.51%), Query Frame = 1
Query:  826 SEDGKLA-KQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT 1035
            SE+G L  KQ+R+RT FT  QL ELERAF KTHYPD+F REELA+R+ LTE+RVQVWFQNRRAKW+KR+K 
Sbjct:  213 SEEGMLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKA 283          
BLAST of Orthopedia homeobox vs. Ensembl Medaka
Match: arx (aristaless related homeobox [Source:NCBI gene;Acc:100144363])

HSP 1 Score: 113.235 bits (282), Expect = 4.366e-26
Identity = 51/71 (71.83%), Postives = 60/71 (84.51%), Query Frame = 1
Query:  826 SEDGKLA-KQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKT 1035
            SE+G L  KQ+R+RT FT  QL ELERAF KTHYPD+F REELA+R+ LTE+RVQVWFQNRRAKW+KR+K 
Sbjct:  213 SEEGMLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKA 283          
BLAST of Orthopedia homeobox vs. Planmine SMEST
Match: SMESG000067397.1 (SMESG000067397.1)

HSP 1 Score: 866.685 bits (2238), Expect = 0.000e+0
Identity = 530/531 (99.81%), Postives = 531/531 (100.00%), Query Frame = 1
Query:   88 MNEEMMMASILSQHPYHQHYGAYPSSALMSTDFLFPNGFHNSSAQAYXXXXXXXXXXXXXXXXXSILDQLPSGSINNFDRININRSTADDIISQHAQIQLEHQLHAAPSFLNSSHGLSTNYLMSAVTNGHSKFXXXXXXXXXXXNGLPKSSVEQDLKTMKQESVENNRYCLSDFNLKPNRLLESSNENNVDDKSSPNKSQNLLSESDHVSSDKFPNSFYXXXXXXXXXXXXXXXXXXXXDSNIDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMXXXXXXXXLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFINTPYHSSNIMDSYGVPDDVQAASHMLTTPYLXXXXXXXXXXXXXXXLGSISNTVFSTASSPTNPXXXXXXXXXXXXXXIPQLSSSNGGRSD 1680
            MNEEMMMASILSQHPYHQHYGAYPSSALMSTDFLFPNGFHNSSAQAYNHINQHPQHQQHQSTNNSILDQLPSGSINNFDRININRSTADDIISQHAQIQLEHQLHAAPSFLNSSHGLSTNYLMSAVTNGHSKFSLHSQSPNSSSNGLPKSSVEQDLKTMKQESVENNRYCLSDFNLKPNRLLESSNENNVDDKSSPNKSQNLLSESDHVSSDKFPNSF+NNSENSKNSIKSSLLKINNIDSNIDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMPPPPPPPPLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFINTPYHSSNIMDSYGVPDDVQAASHMLTTPYLSSNNSVSSFFFPSTNLGSISNTVFSTASSPTNPSLSSMYHAAAMASYIPQLSSSNGGRSD
Sbjct:    1 MNEEMMMASILSQHPYHQHYGAYPSSALMSTDFLFPNGFHNSSAQAYNHINQHPQHQQHQSTNNSILDQLPSGSINNFDRININRSTADDIISQHAQIQLEHQLHAAPSFLNSSHGLSTNYLMSAVTNGHSKFSLHSQSPNSSSNGLPKSSVEQDLKTMKQESVENNRYCLSDFNLKPNRLLESSNENNVDDKSSPNKSQNLLSESDHVSSDKFPNSFFNNSENSKNSIKSSLLKINNIDSNIDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMPPPPPPPPLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFINTPYHSSNIMDSYGVPDDVQAASHMLTTPYLSSNNSVSSFFFPSTNLGSISNTVFSTASSPTNPSLSSMYHAAAMASYIPQLSSSNGGRSD 531          
BLAST of Orthopedia homeobox vs. Planmine SMEST
Match: SMESG000067397.1 (SMESG000067397.1)

HSP 1 Score: 857.44 bits (2214), Expect = 0.000e+0
Identity = 526/527 (99.81%), Postives = 527/527 (100.00%), Query Frame = 1
Query:  100 MMMASILSQHPYHQHYGAYPSSALMSTDFLFPNGFHNSSAQAYXXXXXXXXXXXXXXXXXSILDQLPSGSINNFDRININRSTADDIISQHAQIQLEHQLHAAPSFLNSSHGLSTNYLMSAVTNGHSKFXXXXXXXXXXXNGLPKSSVEQDLKTMKQESVENNRYCLSDFNLKPNRLLESSNENNVDDKSSPNKSQNLLSESDHVSSDKFPNSFYXXXXXXXXXXXXXXXXXXXXDSNIDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMXXXXXXXXLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFINTPYHSSNIMDSYGVPDDVQAASHMLTTPYLXXXXXXXXXXXXXXXLGSISNTVFSTASSPTNPXXXXXXXXXXXXXXIPQLSSSNGGRSD 1680
            MMMASILSQHPYHQHYGAYPSSALMSTDFLFPNGFHNSSAQAYNHINQHPQHQQHQSTNNSILDQLPSGSINNFDRININRSTADDIISQHAQIQLEHQLHAAPSFLNSSHGLSTNYLMSAVTNGHSKFSLHSQSPNSSSNGLPKSSVEQDLKTMKQESVENNRYCLSDFNLKPNRLLESSNENNVDDKSSPNKSQNLLSESDHVSSDKFPNSF+NNSENSKNSIKSSLLKINNIDSNIDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMPPPPPPPPLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFINTPYHSSNIMDSYGVPDDVQAASHMLTTPYLSSNNSVSSFFFPSTNLGSISNTVFSTASSPTNPSLSSMYHAAAMASYIPQLSSSNGGRSD
Sbjct:    1 MMMASILSQHPYHQHYGAYPSSALMSTDFLFPNGFHNSSAQAYNHINQHPQHQQHQSTNNSILDQLPSGSINNFDRININRSTADDIISQHAQIQLEHQLHAAPSFLNSSHGLSTNYLMSAVTNGHSKFSLHSQSPNSSSNGLPKSSVEQDLKTMKQESVENNRYCLSDFNLKPNRLLESSNENNVDDKSSPNKSQNLLSESDHVSSDKFPNSFFNNSENSKNSIKSSLLKINNIDSNIDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMPPPPPPPPLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFINTPYHSSNIMDSYGVPDDVQAASHMLTTPYLSSNNSVSSFFFPSTNLGSISNTVFSTASSPTNPSLSSMYHAAAMASYIPQLSSSNGGRSD 527          
BLAST of Orthopedia homeobox vs. Planmine SMEST
Match: SMESG000067397.1 (SMESG000067397.1)

HSP 1 Score: 853.203 bits (2203), Expect = 0.000e+0
Identity = 524/525 (99.81%), Postives = 525/525 (100.00%), Query Frame = 1
Query:  106 MASILSQHPYHQHYGAYPSSALMSTDFLFPNGFHNSSAQAYXXXXXXXXXXXXXXXXXSILDQLPSGSINNFDRININRSTADDIISQHAQIQLEHQLHAAPSFLNSSHGLSTNYLMSAVTNGHSKFXXXXXXXXXXXNGLPKSSVEQDLKTMKQESVENNRYCLSDFNLKPNRLLESSNENNVDDKSSPNKSQNLLSESDHVSSDKFPNSFYXXXXXXXXXXXXXXXXXXXXDSNIDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMXXXXXXXXLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFINTPYHSSNIMDSYGVPDDVQAASHMLTTPYLXXXXXXXXXXXXXXXLGSISNTVFSTASSPTNPXXXXXXXXXXXXXXIPQLSSSNGGRSD 1680
            MASILSQHPYHQHYGAYPSSALMSTDFLFPNGFHNSSAQAYNHINQHPQHQQHQSTNNSILDQLPSGSINNFDRININRSTADDIISQHAQIQLEHQLHAAPSFLNSSHGLSTNYLMSAVTNGHSKFSLHSQSPNSSSNGLPKSSVEQDLKTMKQESVENNRYCLSDFNLKPNRLLESSNENNVDDKSSPNKSQNLLSESDHVSSDKFPNSF+NNSENSKNSIKSSLLKINNIDSNIDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMPPPPPPPPLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFINTPYHSSNIMDSYGVPDDVQAASHMLTTPYLSSNNSVSSFFFPSTNLGSISNTVFSTASSPTNPSLSSMYHAAAMASYIPQLSSSNGGRSD
Sbjct:    1 MASILSQHPYHQHYGAYPSSALMSTDFLFPNGFHNSSAQAYNHINQHPQHQQHQSTNNSILDQLPSGSINNFDRININRSTADDIISQHAQIQLEHQLHAAPSFLNSSHGLSTNYLMSAVTNGHSKFSLHSQSPNSSSNGLPKSSVEQDLKTMKQESVENNRYCLSDFNLKPNRLLESSNENNVDDKSSPNKSQNLLSESDHVSSDKFPNSFFNNSENSKNSIKSSLLKINNIDSNIDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMPPPPPPPPLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFINTPYHSSNIMDSYGVPDDVQAASHMLTTPYLSSNNSVSSFFFPSTNLGSISNTVFSTASSPTNPSLSSMYHAAAMASYIPQLSSSNGGRSD 525          
BLAST of Orthopedia homeobox vs. Planmine SMEST
Match: SMESG000067397.1 (SMESG000067397.1)

HSP 1 Score: 840.106 bits (2169), Expect = 0.000e+0
Identity = 504/531 (94.92%), Postives = 504/531 (94.92%), Query Frame = 1
Query:   88 MNEEMMMASILSQHPYHQHYGAYPSSALMSTDFLFPNGFHNSSAQAYXXXXXXXXXXXXXXXXXSILDQLPSGSINNFDRININRSTADDIISQHAQIQLEHQLHAAPSFLNSSHGLSTNYLMSAVTNGHSKFXXXXXXXXXXXNGLPKSSVEQDLKTMKQESVENNRYCLSDFNLKPNRLLESSNENNVDDKSSPNKSQNLLSESDHVSSDKFPNSFYXXXXXXXXXXXXXXXXXXXXDSNIDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMXXXXXXXXLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFINTPYHSSNIMDSYGVPDDVQAASHMLTTPYLXXXXXXXXXXXXXXXLGSISNTVFSTASSPTNPXXXXXXXXXXXXXXIPQLSSSNGGRSD 1680
            MNEEMMMASILSQHPYHQHYGAYPSSALMSTDFLFPNGFHNSSAQAYNHINQHPQHQQHQSTNNSILDQLPSGSINNFDRININRSTADDIISQHAQIQLEHQLHAAPSFLNSSHGLSTNYLMSAVTNGHSKFSLHSQSPNSSSNGLPKSSVEQDLKTMKQESVENNRYCLSDFNLKPNRLLESSNENNVDDKSSPNKSQNLLSESDH S  K  N                      IDSNIDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMPPPPPPPPLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFINTPYHSSNIMDSYGVPDDVQAASHMLTTPYLSSNNSVSSFFFPSTNLGSISNTVFSTASSPTNPSLSSMYHAAAMASYIPQLSSSNGGRSD
Sbjct:    1 MNEEMMMASILSQHPYHQHYGAYPSSALMSTDFLFPNGFHNSSAQAYNHINQHPQHQQHQSTNNSILDQLPSGSINNFDRININRSTADDIISQHAQIQLEHQLHAAPSFLNSSHGLSTNYLMSAVTNGHSKFSLHSQSPNSSSNGLPKSSVEQDLKTMKQESVENNRYCLSDFNLKPNRLLESSNENNVDDKSSPNKSQNLLSESDHSSLLKINN----------------------IDSNIDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMPPPPPPPPLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFINTPYHSSNIMDSYGVPDDVQAASHMLTTPYLSSNNSVSSFFFPSTNLGSISNTVFSTASSPTNPSLSSMYHAAAMASYIPQLSSSNGGRSD 509          
BLAST of Orthopedia homeobox vs. Planmine SMEST
Match: SMESG000067397.1 (SMESG000067397.1)

HSP 1 Score: 831.247 bits (2146), Expect = 0.000e+0
Identity = 500/527 (94.88%), Postives = 500/527 (94.88%), Query Frame = 1
Query:  100 MMMASILSQHPYHQHYGAYPSSALMSTDFLFPNGFHNSSAQAYXXXXXXXXXXXXXXXXXSILDQLPSGSINNFDRININRSTADDIISQHAQIQLEHQLHAAPSFLNSSHGLSTNYLMSAVTNGHSKFXXXXXXXXXXXNGLPKSSVEQDLKTMKQESVENNRYCLSDFNLKPNRLLESSNENNVDDKSSPNKSQNLLSESDHVSSDKFPNSFYXXXXXXXXXXXXXXXXXXXXDSNIDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMXXXXXXXXLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFINTPYHSSNIMDSYGVPDDVQAASHMLTTPYLXXXXXXXXXXXXXXXLGSISNTVFSTASSPTNPXXXXXXXXXXXXXXIPQLSSSNGGRSD 1680
            MMMASILSQHPYHQHYGAYPSSALMSTDFLFPNGFHNSSAQAYNHINQHPQHQQHQSTNNSILDQLPSGSINNFDRININRSTADDIISQHAQIQLEHQLHAAPSFLNSSHGLSTNYLMSAVTNGHSKFSLHSQSPNSSSNGLPKSSVEQDLKTMKQESVENNRYCLSDFNLKPNRLLESSNENNVDDKSSPNKSQNLLSESDH S  K  N                      IDSNIDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMPPPPPPPPLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFINTPYHSSNIMDSYGVPDDVQAASHMLTTPYLSSNNSVSSFFFPSTNLGSISNTVFSTASSPTNPSLSSMYHAAAMASYIPQLSSSNGGRSD
Sbjct:    1 MMMASILSQHPYHQHYGAYPSSALMSTDFLFPNGFHNSSAQAYNHINQHPQHQQHQSTNNSILDQLPSGSINNFDRININRSTADDIISQHAQIQLEHQLHAAPSFLNSSHGLSTNYLMSAVTNGHSKFSLHSQSPNSSSNGLPKSSVEQDLKTMKQESVENNRYCLSDFNLKPNRLLESSNENNVDDKSSPNKSQNLLSESDHSSLLKINN----------------------IDSNIDETSEDGKLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMSDGKSNATWPSLDINENAASWSQRYWSMTAMPPPPPPPPLGLSHHLASSGCFSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFINTPYHSSNIMDSYGVPDDVQAASHMLTTPYLSSNNSVSSFFFPSTNLGSISNTVFSTASSPTNPSLSSMYHAAAMASYIPQLSSSNGGRSD 505          
The following BLAST results are available for this feature:
BLAST of Orthopedia homeobox vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OTP5.581e-2990.00orthopedia homeobox [Source:HGNC Symbol;Acc:HGNC:8... [more]
ARX1.218e-2571.83aristaless related homeobox [Source:HGNC Symbol;Ac... [more]
ALX12.356e-2464.18ALX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:1494][more]
PHOX2B1.701e-2370.97paired like homeobox 2B [Source:HGNC Symbol;Acc:HG... [more]
PHOX2A4.624e-2370.97paired like homeobox 2A [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Orthopedia homeobox vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-172.130e-2466.67C. Elegans Homeobox; CEH-17 [Source:UniProtKB/TrE... [more]
alr-11.820e-2360.00AristaLess (Drosophila homeodomain) Related [Sour... [more]
unc-45.022e-2365.15Homeobox protein unc-4 [Source:UniProtKB/Swiss-Pr... [more]
unc-303.266e-2053.95Homeobox protein unc-30 [Source:UniProtKB/Swiss-P... [more]
unc-303.765e-2053.95Homeobox protein unc-30 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Orthopedia homeobox vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otp5.659e-3576.00gene:FBgn0015524 transcript:FBtr0110772[more]
otp6.771e-3564.29gene:FBgn0015524 transcript:FBtr0342795[more]
otp1.770e-3475.76gene:FBgn0015524 transcript:FBtr0342796[more]
otp2.088e-3476.00gene:FBgn0015524 transcript:FBtr0342799[more]
otp2.119e-3464.29gene:FBgn0015524 transcript:FBtr0342800[more]
back to top
BLAST of Orthopedia homeobox vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otpb6.273e-2990.00orthopedia homeobox b [Source:NCBI gene;Acc:30316][more]
otpb8.480e-2990.00orthopedia homeobox b [Source:NCBI gene;Acc:30316][more]
otpa9.353e-2990.00orthopedia homeobox a [Source:ZFIN;Acc:ZDB-GENE-07... [more]
otpb1.309e-2890.00orthopedia homeobox b [Source:NCBI gene;Acc:30316][more]
otpa1.539e-2890.00orthopedia homeobox a [Source:ZFIN;Acc:ZDB-GENE-07... [more]
back to top
BLAST of Orthopedia homeobox vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmtm41.565e-2990.14CKLF-like MARVEL transmembrane domain containing 4... [more]
cmtm41.890e-2990.14CKLF-like MARVEL transmembrane domain containing 4... [more]
cmtm42.401e-2990.14CKLF-like MARVEL transmembrane domain containing 4... [more]
ARX5.516e-2671.83aristaless related homeobox [Source:NCBI gene;Acc:... [more]
ENSXETT00000045443.13.198e-2562.16pep primary_assembly:Xenopus_tropicalis_v9.1:8:382... [more]
back to top
BLAST of Orthopedia homeobox vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Otp3.831e-2990.00orthopedia homeobox [Source:MGI Symbol;Acc:MGI:998... [more]
Arx9.946e-2671.83aristaless related homeobox [Source:MGI Symbol;Acc... [more]
Arx9.946e-2671.83aristaless related homeobox [Source:MGI Symbol;Acc... [more]
Alx17.612e-2564.18ALX homeobox 1 [Source:MGI Symbol;Acc:MGI:104621][more]
Alx11.712e-2464.18ALX homeobox 1 [Source:MGI Symbol;Acc:MGI:104621][more]
back to top
BLAST of Orthopedia homeobox vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6SZ65|OTP_LYTVA3.879e-3569.30Homeobox protein orthopedia OS=Lytechinus variegat... [more]
sp|Q6SR68|OTP_HELTB7.498e-3569.30Homeobox protein orthopedia OS=Heliocidaris tuberc... [more]
sp|Q6SR69|OTP_HELER7.498e-3569.30Homeobox protein orthopedia OS=Heliocidaris erythr... [more]
sp|O76971|OTP_PARLI8.861e-3569.30Homeobox protein orthopedia OS=Paracentrotus livid... [more]
sp|P56672|OTP_DROME7.505e-3364.00Homeobox protein orthopedia OS=Drosophila melanoga... [more]
back to top
BLAST of Orthopedia homeobox vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A7M6931.076e-158100.00Orthopedia homeobox (Fragment) OS=Schmidtea polych... [more]
A0A1B6KBZ12.100e-3461.76Homeobox domain-containing protein (Fragment) OS=G... [more]
A0A1B6CD152.403e-3354.66Homeobox domain-containing protein (Fragment) OS=C... [more]
A6YIC21.051e-3276.00Orthopedia OS=Platynereis dumerilii OX=6359 GN=otp... [more]
R7TJG01.853e-3285.51Homeobox domain-containing protein (Fragment) OS=C... [more]
back to top
BLAST of Orthopedia homeobox vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OTP1.196e-3148.13orthopedia homeobox [Source:NCBI gene;Acc:10304592... [more]
OTP3.349e-3148.13orthopedia homeobox [Source:NCBI gene;Acc:10304592... [more]
otpb4.575e-2990.00homeobox protein orthopedia B [Source:NCBI gene;Ac... [more]
otpb4.575e-2990.00homeobox protein orthopedia B [Source:NCBI gene;Ac... [more]
otpb9.511e-2990.00homeobox protein orthopedia B [Source:NCBI gene;Ac... [more]
back to top
BLAST of Orthopedia homeobox vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010761.12.534e-2159.72pep scaffold:Pmarinus_7.0:GL476415:928307:936594:-... [more]
dmbx1b3.257e-1858.06diencephalon/mesencephalon homeobox 1b [Source:NCB... [more]
otx58.803e-1566.07orthodenticle homolog 5 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000001141.12.176e-1243.37pep scaffold:Pmarinus_7.0:GL478075:36995:38394:-1 ... [more]
emx29.097e-1248.68empty spiracles homeobox 2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Orthopedia homeobox vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PHO23.136e-839.06Homeobox transcription factor; regulatory targets ... [more]
YOX12.961e-632.18Homeobox transcriptional repressor; binds to Mcm1p... [more]
back to top
BLAST of Orthopedia homeobox vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO421481.154e-2957.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421037.929e-2764.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389262.765e-2565.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317965.400e-2564.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393624.840e-2458.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Orthopedia homeobox vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OTP6.213e-3283.95homeobox protein orthopedia B [Source:NCBI gene;Ac... [more]
OTP1.407e-3183.95homeobox protein orthopedia B [Source:NCBI gene;Ac... [more]
OTP1.951e-2890.00orthopedia homeobox [Source:NCBI gene;Acc:11194831... [more]
arx2.609e-2671.83aristaless related homeobox [Source:NCBI gene;Acc:... [more]
arx4.366e-2671.83aristaless related homeobox [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Orthopedia homeobox vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067397.10.000e+099.81SMESG000067397.1[more]
SMESG000067397.10.000e+099.81SMESG000067397.1[more]
SMESG000067397.10.000e+099.81SMESG000067397.1[more]
SMESG000067397.10.000e+094.92SMESG000067397.1[more]
SMESG000067397.10.000e+094.88SMESG000067397.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034301 ID=SMED30034301|Name=Orthopedia homeobox|organism=Schmidtea mediterranea sexual|type=transcript|length=1862bp
AGAAGACTGGAAAATAGCAAAAAAAACGTTTGTTTGTTTATTCGTAATTA
AATTTGATTTTGACAAATTCACCGATTTGATTTCGGAATGAATGAGGAGA
TGATGATGGCTTCAATTTTGTCTCAGCATCCTTATCATCAACATTACGGT
GCCTATCCGTCGTCGGCTTTGATGTCAACTGATTTTCTATTTCCAAATGG
ATTTCACAATTCTTCGGCACAAGCTTATAATCATATTAATCAACACCCTC
AACATCAACAGCACCAATCAACGAACAATTCGATATTGGATCAATTGCCA
TCTGGATCAATAAATAATTTTGATCGGATCAATATCAATCGAAGCACCGC
AGATGACATCATATCCCAACACGCTCAGATACAGCTGGAACATCAGCTTC
ATGCTGCTCCTTCGTTTCTGAATTCCAGTCATGGATTATCAACGAACTAT
TTAATGTCCGCTGTAACAAACGGGCATTCTAAGTTTTCATTGCATTCTCA
ATCTCCAAATTCTTCGTCGAATGGTCTACCGAAATCGTCAGTAGAACAAG
ATTTGAAAACGATGAAACAAGAATCTGTGGAAAACAACCGATATTGTCTA
TCAGATTTCAATCTGAAACCGAATAGACTTTTAGAATCATCAAATGAAAA
TAATGTCGACGATAAATCTTCACCGAACAAATCGCAGAATTTATTATCGG
AATCAGATCATGTGAGCAGTGATAAATTTCCCAATAGTTTTTATAATAAT
TCTGAAAATTCCAAAAACAGTATCAAATCTTCTTTATTGAAAATTAACAA
CATTGATTCCAACATTGATGAAACGAGTGAAGACGGAAAACTTGCAAAGC
AAAAACGACACCGTACAAGATTTACCCCAGCTCAACTTAATGAACTTGAA
AGAGCATTTTCCAAAACTCACTATCCAGACATTTTTATGAGGGAAGAATT
AGCACTTCGGATCGGATTAACTGAGTCCCGTGTTCAGGTCTGGTTTCAAA
ACCGACGAGCCAAATGGAAAAAAAGAAAAAAGACATCAAATGTTTTTAGA
ACATCTAGTGCCCTTCAGACATTGGCTTCTTTCGGCCCAGCACATTTTCA
AGAACCGTTTGGAAACAATTTCTCTTGTCCCATGTCTGACGGTAAATCAA
ATGCGACTTGGCCATCTTTAGATATCAATGAAAATGCCGCTTCCTGGTCC
CAAAGATATTGGAGTATGACTGCTATGCCACCTCCCCCGCCTCCGCCTCC
TCTTGGATTAAGCCATCATCTAGCATCTTCTGGTTGTTTCTCAAACAATT
CAAGAAAAACTGCCTCACCATCGACTAATGGAGGTGTTCAGCAAGTCATA
AATGGTAACGTCAATCGATCAGTCCAATTGCCCTCTCCTTCTTTACCTTC
TTTTATAAATACACCATATCACTCTTCAAACATAATGGACTCATACGGTG
TACCAGATGATGTCCAAGCAGCAAGCCACATGCTCACAACACCATATCTC
TCATCAAATAACTCGGTCTCTTCATTTTTCTTTCCATCAACAAATCTTGG
TTCAATATCCAATACAGTGTTCAGTACAGCCAGCTCACCAACAAATCCCA
GCTTATCATCCATGTATCACGCGGCAGCCATGGCGTCCTATATCCCACAA
TTGTCATCCTCAAATGGTGGAAGGAGTGATTGATATTAATTTACAAGATT
ATTGTATAGTGTACTAACCGTAGCATCACGAAACCTTGATAGGTTTCAGT
ACATAGGCAATGGCAAAATCAAGCGTTCTTTGGACCTAATAAATAAATTT
CCAAAATGAATGTTTTCTATTGATATTGATAGTGATCATTTCATCATTGT
CTTAAATTTCAC
back to top

protein sequence of SMED30034301-orf-1

>SMED30034301-orf-1 ID=SMED30034301-orf-1|Name=SMED30034301-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=532bp
MNEEMMMASILSQHPYHQHYGAYPSSALMSTDFLFPNGFHNSSAQAYNHI
NQHPQHQQHQSTNNSILDQLPSGSINNFDRININRSTADDIISQHAQIQL
EHQLHAAPSFLNSSHGLSTNYLMSAVTNGHSKFSLHSQSPNSSSNGLPKS
SVEQDLKTMKQESVENNRYCLSDFNLKPNRLLESSNENNVDDKSSPNKSQ
NLLSESDHVSSDKFPNSFYNNSENSKNSIKSSLLKINNIDSNIDETSEDG
KLAKQKRHRTRFTPAQLNELERAFSKTHYPDIFMREELALRIGLTESRVQ
VWFQNRRAKWKKRKKTSNVFRTSSALQTLASFGPAHFQEPFGNNFSCPMS
DGKSNATWPSLDINENAASWSQRYWSMTAMPPPPPPPPLGLSHHLASSGC
FSNNSRKTASPSTNGGVQQVINGNVNRSVQLPSPSLPSFINTPYHSSNIM
DSYGVPDDVQAASHMLTTPYLSSNNSVSSFFFPSTNLGSISNTVFSTASS
PTNPSLSSMYHAAAMASYIPQLSSSNGGRSD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000047HTH_motif
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000047Helix-turn-helix motifPRINTSPR00031HTHREPRESSRcoord: 284..293
score: 44.08
coord: 293..309
score: 60.14
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 255..317
e-value: 2.3E-28
score: 110.3
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 256..312
e-value: 4.6E-24
score: 84.0
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 253..313
score: 20.973
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 256..307
e-value: 2.06544E-20
score: 82.6764
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 240..318
e-value: 9.5E-32
score: 110.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 185..209
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 133..154
NoneNo IPR availablePANTHERPTHR46770FAMILY NOT NAMEDcoord: 189..433
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 288..311
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 249..316